Citrus Sinensis ID: 038112


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-----
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAST
ccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccc
ccEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccc
MVISAKRLLNLLKAEKNPHTALALfdsatrepgyahsphLFHHILRRLIDPKLVVHVSRILELIEIqkcycpedVALSVIQAygknsmpdKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWekglkpdvysyGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINglckcgrfdeCLEMWDRMKknerekdsftycSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVmgrkgclnVVSYNILIRGLlengkvdeAISIWELLREkncnadstthGVLINglckngylNKAIQILNEveeggegrlADAASLVNRmdkhgcklnayTCNSLMNGFIQASKLENAIFLFKemsrkgcsptvVSYNTLINGLCKVERFGEAYSFVKEMLekgwkpdmiTYSLLINGLCQSKKIDMALKLCCQFLqkgftpdvtMYNILIHGLCSAGKVEDALQLYSNmkkrncvpnlvtYNTLMDGLFKTGDCDKALEIWNHILEerlrpdiisynitlkglcscsRMSDAFEFLNDALcrgilpttITWHILVRAVMNNGAST
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSlwekglkpdVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHIleerlrpdiISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAST
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAST
********LNLL******HTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVM******
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAS*
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAST
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNNGAST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query625 2.2.26 [Sep-21-2011]
Q9SS81687 Pentatricopeptide repeat- yes no 0.988 0.899 0.549 0.0
Q9LFF1754 Pentatricopeptide repeat- no no 0.929 0.770 0.295 1e-79
Q9FMF6730 Pentatricopeptide repeat- no no 0.979 0.838 0.275 2e-75
Q3EDF8598 Pentatricopeptide repeat- no no 0.771 0.806 0.295 2e-72
Q9CA58 763 Putative pentatricopeptid no no 0.948 0.777 0.284 4e-72
Q9FIX3747 Pentatricopeptide repeat- no no 0.849 0.710 0.293 3e-71
O49436660 Pentatricopeptide repeat- no no 0.764 0.724 0.301 6e-69
Q9M302659 Pentatricopeptide repeat- no no 0.926 0.878 0.271 5e-68
Q9LQ14629 Pentatricopeptide repeat- no no 0.744 0.739 0.311 6e-68
Q76C99 791 Protein Rf1, mitochondria N/A no 0.817 0.646 0.300 1e-67
>sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 Back     alignment and function desciption
 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/679 (54%), Positives = 473/679 (69%), Gaps = 61/679 (8%)

Query: 3   ISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILE 62
           +S K +L LLK+EKNP  A ALFDSATR PGYAHS  ++HHILRRL + ++V HVSRI+E
Sbjct: 8   LSPKHVLKLLKSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSETRMVNHVSRIVE 67

Query: 63  LIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGIL------------ 110
           LI  Q+C C EDVALSVI+ YGKNSMPD+ALDVF+RM EIFGCE  I             
Sbjct: 68  LIRSQECKCDEDVALSVIKTYGKNSMPDQALDVFKRMREIFGCEPAIRSYNTLLNAFVEA 127

Query: 111 --------------------------------CRKRQFEKAKRFLNSLWEKGLKPDVYSY 138
                                           C+K++FEKA+ FL+ +W++G KPDV+SY
Sbjct: 128 KQWVKVESLFAYFETAGVAPNLQTYNVLIKMSCKKKEFEKARGFLDWMWKEGFKPDVFSY 187

Query: 139 GTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVM 198
            TVIN L K+G L  AL +FDEM ERGV  +V CYNILIDGF K+ D+  A E+W+RL+ 
Sbjct: 188 STVINDLAKAGKLDDALELFDEMSERGVAPDVTCYNILIDGFLKEKDHKTAMELWDRLLE 247

Query: 199 ETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVE 258
           ++SVYPNV T+N+MI+GL KCGR D+CL++W+RMK+NEREKD +TY S IHGLC AGNV+
Sbjct: 248 DSSVYPNVKTHNIMISGLSKCGRVDDCLKIWERMKQNEREKDLYTYSSLIHGLCDAGNVD 307

Query: 259 GAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIR 318
            AE V+ E+ E    +D VTYN M+ GFCR GKIKE  ELW +M  K  +N+VSYNILI+
Sbjct: 308 KAESVFNELDERKASIDVVTYNTMLGGFCRCGKIKESLELWRIMEHKNSVNIVSYNILIK 367

Query: 319 GLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGG--- 375
           GLLENGK+DEA  IW L+  K   AD TT+G+ I+GLC NGY+NKA+ ++ EVE  G   
Sbjct: 368 GLLENGKIDEATMIWRLMPAKGYAADKTTYGIFIHGLCVNGYVNKALGVMQEVESSGGHL 427

Query: 376 --------------EGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLF 421
                         + RL +A++LV  M KHG +LN++ CN+L+ G I+ S+L  A F  
Sbjct: 428 DVYAYASIIDCLCKKKRLEEASNLVKEMSKHGVELNSHVCNALIGGLIRDSRLGEASFFL 487

Query: 422 KEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQS 481
           +EM + GC PTVVSYN LI GLCK  +FGEA +FVKEMLE GWKPD+ TYS+L+ GLC+ 
Sbjct: 488 REMGKNGCRPTVVSYNILICGLCKAGKFGEASAFVKEMLENGWKPDLKTYSILLCGLCRD 547

Query: 482 KKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTY 541
           +KID+AL+L  QFLQ G   DV M+NILIHGLCS GK++DA+ + +NM+ RNC  NLVTY
Sbjct: 548 RKIDLALELWHQFLQSGLETDVMMHNILIHGLCSVGKLDDAMTVMANMEHRNCTANLVTY 607

Query: 542 NTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALC 601
           NTLM+G FK GD ++A  IW ++ +  L+PDIISYN  +KGLC C  +S A EF +DA  
Sbjct: 608 NTLMEGFFKVGDSNRATVIWGYMYKMGLQPDIISYNTIMKGLCMCRGVSYAMEFFDDARN 667

Query: 602 RGILPTTITWHILVRAVMN 620
            GI PT  TW+ILVRAV+N
Sbjct: 668 HGIFPTVYTWNILVRAVVN 686





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 Back     alignment and function description
>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query625
225434476691 PREDICTED: pentatricopeptide repeat-cont 0.996 0.901 0.618 0.0
224139020694 predicted protein [Populus trichocarpa] 0.992 0.893 0.625 0.0
255586501701 pentatricopeptide repeat-containing prot 0.976 0.870 0.629 0.0
147833070 913 hypothetical protein VITISV_034996 [Viti 0.947 0.648 0.588 0.0
297745840650 unnamed protein product [Vitis vinifera] 0.902 0.867 0.608 0.0
449460383701 PREDICTED: pentatricopeptide repeat-cont 0.992 0.884 0.562 0.0
15232008687 pentatricopeptide repeat-containing prot 0.988 0.899 0.549 0.0
297833654689 pentatricopeptide repeat-containing prot 0.988 0.896 0.544 0.0
356520989682 PREDICTED: pentatricopeptide repeat-cont 0.974 0.892 0.538 0.0
125528410703 hypothetical protein OsI_04465 [Oryza sa 0.984 0.874 0.421 1e-157
>gi|225434476|ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/684 (61%), Positives = 518/684 (75%), Gaps = 61/684 (8%)

Query: 3   ISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILE 62
           +S KR++ LLK+EKNPH+AL++FDS TR PGY+H+P++FHHIL+RL DPKLV HVSRI+E
Sbjct: 8   LSPKRVIKLLKSEKNPHSALSIFDSVTRFPGYSHTPYVFHHILKRLFDPKLVAHVSRIVE 67

Query: 63  LIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGIL------------ 110
           LI  QKC CPEDVAL+VI+AY KNSMPD+ALD+FQRM+EIFGC+ GI             
Sbjct: 68  LIRTQKCKCPEDVALTVIKAYAKNSMPDQALDIFQRMHEIFGCQPGIRSYNSLLNALIES 127

Query: 111 --------------------------------CRKRQFEKAKRFLNSLWEKGLKPDVYSY 138
                                           CRK+QF+KAK  LN +WE+G  PDV+SY
Sbjct: 128 NKWDEAESFFLYFETMGLSPNLQTYNILIKISCRKKQFDKAKELLNWMWEQGFSPDVFSY 187

Query: 139 GTVINGLVKSGDLLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVM 198
           GT+IN L K+G +  AL +FDEM ERGV  +V CYNILIDGFFKKGD + A EIWERL+ 
Sbjct: 188 GTLINSLAKNGYMSDALKLFDEMPERGVTPDVACYNILIDGFFKKGDILNASEIWERLLK 247

Query: 199 ETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVE 258
             SVYPN+ +YNVMINGLCKCG+FDE  E+W RMKKNER +D +TY + IHGLC +GN++
Sbjct: 248 GPSVYPNIPSYNVMINGLCKCGKFDESFEIWHRMKKNERGQDLYTYSTLIHGLCGSGNLD 307

Query: 259 GAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIR 318
           GA RVY+EM E+G+  D V YN M++G+ RAG+I+EC ELW+VM ++GC  VVSYNILIR
Sbjct: 308 GATRVYKEMAENGVSPDVVVYNTMLNGYLRAGRIEECLELWKVMEKEGCRTVVSYNILIR 367

Query: 319 GLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEG---- 374
           GL EN KVDEAISIWELL EK+C ADS T+GVL++GLCKNGYLNKA+ IL E E G    
Sbjct: 368 GLFENAKVDEAISIWELLPEKDCCADSMTYGVLVHGLCKNGYLNKALSILEEAENGRGDL 427

Query: 375 -------------GEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLF 421
                         EGRL + A ++++M KHGCK N + CN+++NGF++ASKLE+A+  F
Sbjct: 428 DTFAYSSMINGLCREGRLDEVAGVLDQMTKHGCKPNPHVCNAVINGFVRASKLEDALRFF 487

Query: 422 KEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQS 481
             M  KGC PTVV+YNTLINGL K ERF EAY+ VKEML KGWKP+MITYSLL+NGLCQ 
Sbjct: 488 GNMVSKGCFPTVVTYNTLINGLSKAERFSEAYALVKEMLHKGWKPNMITYSLLMNGLCQG 547

Query: 482 KKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTY 541
           KK+DMAL L CQ L+KGF PDV M+NI+IHGLCS+GKVEDALQLYS MK+R CVPNLVT+
Sbjct: 548 KKLDMALNLWCQALEKGFKPDVKMHNIIIHGLCSSGKVEDALQLYSEMKQRKCVPNLVTH 607

Query: 542 NTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALC 601
           NTLM+G +K  D ++A +IW+HIL+   +PDIISYNITLKGLCSC R+SDA  FLNDA+ 
Sbjct: 608 NTLMEGFYKVRDFERASKIWDHILQYGPQPDIISYNITLKGLCSCHRISDAVGFLNDAVD 667

Query: 602 RGILPTTITWHILVRAVMNNGAST 625
           RG+LPT ITW+ILVRAV++NGA T
Sbjct: 668 RGVLPTAITWNILVRAVLDNGALT 691




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224139020|ref|XP_002322960.1| predicted protein [Populus trichocarpa] gi|222867590|gb|EEF04721.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255586501|ref|XP_002533891.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526155|gb|EEF28491.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147833070|emb|CAN77584.1| hypothetical protein VITISV_034996 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745840|emb|CBI15896.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449460383|ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] gi|449516585|ref|XP_004165327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15232008|ref|NP_187518.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207466|sp|Q9SS81.1|PP221_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g09060 gi|5923671|gb|AAD56322.1|AC009326_9 hypothetical protein [Arabidopsis thaliana] gi|332641194|gb|AEE74715.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297833654|ref|XP_002884709.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330549|gb|EFH60968.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356520989|ref|XP_003529141.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Glycine max] Back     alignment and taxonomy information
>gi|125528410|gb|EAY76524.1| hypothetical protein OsI_04465 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query625
TAIR|locus:2095309687 AT3G09060 "AT3G09060" [Arabido 0.963 0.876 0.345 1.1e-92
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.972 0.806 0.295 7.3e-75
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.424 0.421 0.303 1.3e-36
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.652 0.682 0.277 2e-49
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.510 0.519 0.291 1.4e-38
TAIR|locus:2119747660 EMB1025 "embryo defective 1025 0.843 0.798 0.327 5.1e-67
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.588 0.594 0.284 6.2e-42
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.473 0.469 0.305 1.6e-38
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.849 0.710 0.301 7.4e-66
TAIR|locus:2015213629 AT1G63150 [Arabidopsis thalian 0.648 0.643 0.274 4.7e-40
TAIR|locus:2095309 AT3G09060 "AT3G09060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 923 (330.0 bits), Expect = 1.1e-92, P = 1.1e-92
 Identities = 219/633 (34%), Positives = 348/633 (54%)

Query:     3 ISAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILE 62
             +S K +L LLK+EKNP  A ALFDSATR PGYAHS  ++HHILRRL + ++V HVSRI+E
Sbjct:     8 LSPKHVLKLLKSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSETRMVNHVSRIVE 67

Query:    63 LIEIQKCYCPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRK---RQFEKA 119
             LI  Q+C C EDVALSVI+ YGKNSMPD+ALDVF+RM EIFGCE  I         F +A
Sbjct:    68 LIRSQECKCDEDVALSVIKTYGKNSMPDQALDVFKRMREIFGCEPAIRSYNTLLNAFVEA 127

Query:   120 KRFLN--SLWE----KGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNVVCY 173
             K+++   SL+      G+ P++ +Y  +I    K  +   A    D M++ G + +V  Y
Sbjct:   128 KQWVKVESLFAYFETAGVAPNLQTYNVLIKMSCKKKEFEKARGFLDWMWKEGFKPDVFSY 187

Query:   174 NILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMK 233
             + +I+   K G    A E+++ +  E  V P+V  YN++I+G  K       +E+WDR+ 
Sbjct:   188 STVINDLAKAGKLDDALELFDEM-SERGVAPDVTCYNILIDGFLKEKDHKTAMELWDRLL 246

Query:   234 KNEREKDSF-TYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKI 292
             ++     +  T+   I GL K G V+   +++  M ++    D  TY+++I G C AG +
Sbjct:   247 EDSSVYPNVKTHNIMISGLSKCGRVDDCLKIWERMKQNEREKDLYTYSSLIHGLCDAGNV 306

Query:   293 KECFELW-EVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVL 351
              +   ++ E+  RK  ++VV+YN ++ G    GK+ E++ +W ++  KN + +  ++ +L
Sbjct:   307 DKAESVFNELDERKASIDVVTYNTMLGGFCRCGKIKESLELWRIMEHKN-SVNIVSYNIL 365

Query:   352 INGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQA 411
             I GL +NG +++A  I   +    +G  AD  +       +G  ++   C   +NG++  
Sbjct:   366 IKGLLENGKIDEATMIWRLMP--AKGYAADKTT-------YGIFIHGL-C---VNGYVN- 411

Query:   412 SKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITY 471
                  A+ + +E+   G    V +Y ++I+ LCK +R  EA + VKEM + G + +    
Sbjct:   412 ----KALGVMQEVESSGGHLDVYAYASIIDCLCKKKRLEEASNLVKEMSKHGVELNSHVC 467

Query:   472 SLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKK 531
             + LI GL +  ++  A     +  + G  P V  YNILI GLC AGK  +A      M +
Sbjct:   468 NALIGGLIRDSRLGEASFFLREMGKNGCRPTVVSYNILICGLCKAGKFGEASAFVKEMLE 527

Query:   532 RNCVPNLVTYNTLMDGLFKTGDCDKALEIWNHILEERLRPDIISYNITLKGLCSCSRMSD 591
                 P+L TY+ L+ GL +    D ALE+W+  L+  L  D++ +NI + GLCS  ++ D
Sbjct:   528 NGWKPDLKTYSILLCGLCRDRKIDLALELWHQFLQSGLETDVMMHNILIHGLCSVGKLDD 587

Query:   592 AFEFLNDALCRGILPTTITWHILVRAVMNNGAS 624
             A   + +   R      +T++ L+      G S
Sbjct:   588 AMTVMANMEHRNCTANLVTYNTLMEGFFKVGDS 620


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119747 EMB1025 "embryo defective 1025" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015213 AT1G63150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SS81PP221_ARATHNo assigned EC number0.54930.98880.8995yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query625
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-36
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-32
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-30
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-28
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-20
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-20
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-18
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-18
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-13
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-12
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-10
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-07
pfam0153531 pfam01535, PPR, PPR repeat 2e-07
pfam0153531 pfam01535, PPR, PPR repeat 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
pfam0153531 pfam01535, PPR, PPR repeat 9e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 6e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 8e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  146 bits (369), Expect = 2e-36
 Identities = 109/420 (25%), Positives = 168/420 (40%), Gaps = 84/420 (20%)

Query: 111 CRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFDEMFERGVETNV 170
              +  + A R L  + E GLK D   Y T+I+   KSG +     VF EM   GVE NV
Sbjct: 448 ASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANV 507

Query: 171 VCYNILIDGFFKKGDY---------MRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGR 221
             +  LIDG  + G           MR+K           V P+ V +N +I+    CG+
Sbjct: 508 HTFGALIDGCARAGQVAKAFGAYGIMRSKN----------VKPDRVVFNALISA---CGQ 554

Query: 222 -------FDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFV 274
                  FD   EM  + + +  + D  T  + +     AG V+ A+ VY+ + E  I  
Sbjct: 555 SGAVDRAFDVLAEM--KAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNI-- 610

Query: 275 DAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWE 334
                                         KG   V  Y I +    + G  D A+SI++
Sbjct: 611 ------------------------------KGTPEV--YTIAVNSCSQKGDWDFALSIYD 638

Query: 335 LLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGC 394
            +++K    D      L++     G L+KA +IL +                    K G 
Sbjct: 639 DMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQD------------------ARKQGI 680

Query: 395 KLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYS 454
           KL   + +SLM     A   + A+ L++++      PTV + N LI  LC+  +  +A  
Sbjct: 681 KLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALE 740

Query: 455 FVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLC 514
            + EM   G  P+ ITYS+L+    +    D+ L L  Q  + G  P++ M   +  GLC
Sbjct: 741 VLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCIT-GLC 799


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 625
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.96
KOG2076895 consensus RNA polymerase III transcription factor 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.93
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.9
KOG2076 895 consensus RNA polymerase III transcription factor 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG1915677 consensus Cell cycle control protein (crooked neck 99.86
KOG2003840 consensus TPR repeat-containing protein [General f 99.86
KOG2003 840 consensus TPR repeat-containing protein [General f 99.86
KOG1915677 consensus Cell cycle control protein (crooked neck 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.77
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.77
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.75
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
KOG1126638 consensus DNA-binding cell division cycle control 99.75
KOG0547606 consensus Translocase of outer mitochondrial membr 99.74
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.74
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.74
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.73
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.73
KOG0547606 consensus Translocase of outer mitochondrial membr 99.72
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.69
KOG1126638 consensus DNA-binding cell division cycle control 99.68
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.67
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.66
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.65
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.64
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.61
PRK12370553 invasion protein regulator; Provisional 99.6
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.57
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.56
KOG1129478 consensus TPR repeat-containing protein [General f 99.55
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.55
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.54
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.54
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.53
KOG1129478 consensus TPR repeat-containing protein [General f 99.52
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.52
PRK12370553 invasion protein regulator; Provisional 99.51
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.49
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.48
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.48
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.46
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.46
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.42
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.42
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.41
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.4
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.39
KOG1125579 consensus TPR repeat-containing protein [General f 99.38
PRK11189296 lipoprotein NlpI; Provisional 99.38
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.37
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.36
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.33
PRK11189296 lipoprotein NlpI; Provisional 99.33
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.31
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.31
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.25
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.25
PRK04841903 transcriptional regulator MalT; Provisional 99.24
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.19
PF1304150 PPR_2: PPR repeat family 99.18
KOG1125579 consensus TPR repeat-containing protein [General f 99.18
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.15
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.13
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.11
PRK04841903 transcriptional regulator MalT; Provisional 99.11
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.09
PF1304150 PPR_2: PPR repeat family 99.07
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.05
PLN02789320 farnesyltranstransferase 99.05
PLN02789320 farnesyltranstransferase 99.02
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.99
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.98
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.97
KOG1128777 consensus Uncharacterized conserved protein, conta 98.94
PRK15359144 type III secretion system chaperone protein SscB; 98.92
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.89
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.88
PRK10370198 formate-dependent nitrite reductase complex subuni 98.87
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
PRK10370198 formate-dependent nitrite reductase complex subuni 98.82
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.81
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.8
PRK15359144 type III secretion system chaperone protein SscB; 98.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.77
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.73
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.68
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.61
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.59
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.54
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.54
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.52
COG3898531 Uncharacterized membrane-bound protein [Function u 98.5
PF1285434 PPR_1: PPR repeat 98.45
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.4
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.37
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.36
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.35
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.35
PF1285434 PPR_1: PPR repeat 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.31
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.27
KOG0553304 consensus TPR repeat-containing protein [General f 98.26
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.24
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.23
KOG20411189 consensus WD40 repeat protein [General function pr 98.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.21
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.21
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.19
KOG0553304 consensus TPR repeat-containing protein [General f 98.18
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.16
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.15
COG4700251 Uncharacterized protein conserved in bacteria cont 98.14
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.12
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.1
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.1
KOG20411189 consensus WD40 repeat protein [General function pr 98.07
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.06
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.06
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 98.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.04
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.04
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.03
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.99
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.98
PRK10803263 tol-pal system protein YbgF; Provisional 97.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.97
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.97
PF12688120 TPR_5: Tetratrico peptide repeat 97.94
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.93
PRK15331165 chaperone protein SicA; Provisional 97.93
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.92
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.91
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.88
PF12688120 TPR_5: Tetratrico peptide repeat 97.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.85
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.83
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.81
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.8
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.79
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.79
PF1337173 TPR_9: Tetratricopeptide repeat 97.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.76
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.75
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.74
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.73
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.71
PRK10803263 tol-pal system protein YbgF; Provisional 97.7
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.68
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.67
COG3898531 Uncharacterized membrane-bound protein [Function u 97.66
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.64
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.62
PF13512142 TPR_18: Tetratricopeptide repeat 97.57
KOG1258577 consensus mRNA processing protein [RNA processing 97.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.56
PF13512142 TPR_18: Tetratricopeptide repeat 97.43
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.41
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.41
KOG1585308 consensus Protein required for fusion of vesicles 97.4
PF1337173 TPR_9: Tetratricopeptide repeat 97.37
PRK15331165 chaperone protein SicA; Provisional 97.37
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.29
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.28
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.28
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.28
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.25
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.21
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.16
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.15
KOG1258577 consensus mRNA processing protein [RNA processing 97.14
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.14
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.12
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.1
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.08
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.07
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.07
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.04
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.92
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.92
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.87
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.83
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.79
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.79
KOG1586288 consensus Protein required for fusion of vesicles 96.76
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.75
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.75
PF1342844 TPR_14: Tetratricopeptide repeat 96.72
KOG4555175 consensus TPR repeat-containing protein [Function 96.71
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.65
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.64
PRK11906458 transcriptional regulator; Provisional 96.58
PF1342844 TPR_14: Tetratricopeptide repeat 96.54
KOG4555175 consensus TPR repeat-containing protein [Function 96.5
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.42
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.41
PRK11906458 transcriptional regulator; Provisional 96.34
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.28
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.19
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.17
KOG1585308 consensus Protein required for fusion of vesicles 96.15
KOG1941518 consensus Acetylcholine receptor-associated protei 96.08
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.06
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.03
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.89
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.86
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.82
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.7
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.68
PF1343134 TPR_17: Tetratricopeptide repeat 95.63
smart00299140 CLH Clathrin heavy chain repeat homology. 95.63
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.61
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.36
COG3629280 DnrI DNA-binding transcriptional activator of the 95.3
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.3
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.16
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.15
KOG4648536 consensus Uncharacterized conserved protein, conta 95.14
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.8
smart00299140 CLH Clathrin heavy chain repeat homology. 94.79
PF1343134 TPR_17: Tetratricopeptide repeat 94.79
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.75
KOG4234271 consensus TPR repeat-containing protein [General f 94.71
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.65
PRK11619 644 lytic murein transglycosylase; Provisional 94.6
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.55
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.54
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.39
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 94.38
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 94.29
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.27
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.17
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.14
COG3629280 DnrI DNA-binding transcriptional activator of the 94.09
KOG4234271 consensus TPR repeat-containing protein [General f 94.04
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.98
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.96
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.93
PF06552186 TOM20_plant: Plant specific mitochondrial import r 93.78
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.73
KOG1550552 consensus Extracellular protein SEL-1 and related 93.64
PRK11619644 lytic murein transglycosylase; Provisional 93.6
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.49
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.32
KOG1586288 consensus Protein required for fusion of vesicles 93.26
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.1
KOG3941 406 consensus Intermediate in Toll signal transduction 93.08
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.08
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.06
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.92
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.81
KOG4648 536 consensus Uncharacterized conserved protein, conta 92.52
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.45
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.15
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.96
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.78
KOG3941 406 consensus Intermediate in Toll signal transduction 91.69
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 91.64
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.46
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.38
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 91.07
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 90.92
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.88
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.85
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 90.69
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.53
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.45
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.28
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.17
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.01
KOG1550552 consensus Extracellular protein SEL-1 and related 89.94
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.81
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.79
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.78
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.71
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 89.63
KOG4507 886 consensus Uncharacterized conserved protein, conta 89.17
KOG2471 696 consensus TPR repeat-containing protein [General f 89.04
KOG4570 418 consensus Uncharacterized conserved protein [Funct 88.87
KOG2062 929 consensus 26S proteasome regulatory complex, subun 88.42
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.4
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 88.17
KOG4507886 consensus Uncharacterized conserved protein, conta 87.83
KOG2422665 consensus Uncharacterized conserved protein [Funct 87.39
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.04
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 86.75
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.58
COG3947361 Response regulator containing CheY-like receiver a 86.52
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.48
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.45
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.33
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 86.29
KOG3364149 consensus Membrane protein involved in organellar 86.01
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.4
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.36
PRK09687280 putative lyase; Provisional 85.33
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.32
COG3947361 Response regulator containing CheY-like receiver a 85.32
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 85.23
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.99
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 84.75
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.33
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.1
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.08
KOG3364149 consensus Membrane protein involved in organellar 84.06
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.75
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.48
PRK10941269 hypothetical protein; Provisional 83.46
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 83.22
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 82.92
PF13929292 mRNA_stabil: mRNA stabilisation 82.73
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 81.53
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 81.19
PRK10941269 hypothetical protein; Provisional 80.74
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 80.48
KOG2300629 consensus Uncharacterized conserved protein [Funct 80.06
KOG4570418 consensus Uncharacterized conserved protein [Funct 80.02
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-71  Score=584.80  Aligned_cols=598  Identities=20%  Similarity=0.295  Sum_probs=523.9

Q ss_pred             CHHHHHHHHHccCChhHHHHHHHhhccCCCCCCCHHHHHHHHHHhhCCCChhHHHHHHHHHHHhcCCCCHHHHHHHHHHH
Q 038112            4 SAKRLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAY   83 (625)
Q Consensus         4 ~~~~l~~~l~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~   83 (625)
                      +++.+.+.+.+.|++++|..+|+... ..|.+++..++..++.++.+.+.++.|..++..+.+.++.++..+++.++..|
T Consensus        53 ~~n~~i~~l~~~g~~~~A~~l~~~m~-~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~  131 (857)
T PLN03077         53 DSNSQLRALCSHGQLEQALKLLESMQ-ELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMF  131 (857)
T ss_pred             hHHHHHHHHHhCCCHHHHHHHHHHHH-hcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHH
Confidence            34677889999999999999999854 45778899999999999999999999999999999999888889999999999


Q ss_pred             HccCCchHHHHHHHHhHHh----hCCCcchhhhcCChHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCChhhHHHHHH
Q 038112           84 GKNSMPDKALDVFQRMNEI----FGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFD  159 (625)
Q Consensus        84 ~~~~~~~~A~~~~~~~~~~----~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~  159 (625)
                      .+.|+.+.|+.+|+.+++.    +......|.+.|++++|..+|++|...|+.||..+|+.++.+|.+.+++..+.+++.
T Consensus       132 ~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~  211 (857)
T PLN03077        132 VRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHA  211 (857)
T ss_pred             HhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHH
Confidence            9999999999999999653    222233389999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCCCCchhhHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCCcchHHHHHHHHHhcCChhhHHHHHHHHHhCCCCC
Q 038112          160 EMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREK  239 (625)
Q Consensus       160 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~  239 (625)
                      .+.+.|+.||..+++.++.+|++.|+++.|..+|+.|.     .||..+|+.++.+|++.|++++|+++|++|...|+.|
T Consensus       212 ~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~-----~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~P  286 (857)
T PLN03077        212 HVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMP-----RRDCISWNAMISGYFENGECLEGLELFFTMRELSVDP  286 (857)
T ss_pred             HHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCC-----CCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCC
Confidence            99999999999999999999999999999999999984     4788999999999999999999999999999999999


Q ss_pred             ChhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHH
Q 038112          240 DSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRG  319 (625)
Q Consensus       240 ~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~  319 (625)
                      |..+|+.++.+|.+.|+.+.+.+++..+.+.|+.||..+++.++.+|++.|++++|.++|+.|..   ++..+|+.++.+
T Consensus       287 d~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~---~d~~s~n~li~~  363 (857)
T PLN03077        287 DLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMET---KDAVSWTAMISG  363 (857)
T ss_pred             ChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCC---CCeeeHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999875   488899999999


Q ss_pred             HHhCCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHhcC-----------------CCchHHH
Q 038112          320 LLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGG-----------------EGRLADA  382 (625)
Q Consensus       320 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~-----------------~~~~~~a  382 (625)
                      |.+.|++++|+++|++|...|+.||..|+..++.+|++.|+++.|.++++.+.+.+                 .++.++|
T Consensus       364 ~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A  443 (857)
T PLN03077        364 YEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKA  443 (857)
T ss_pred             HHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHH
Confidence            99999999999999999999999999999999999999999999999999776654                 4566667


Q ss_pred             HHHHHHHhhCCCCccHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHhccCCHHHHHHHHHHHHHC
Q 038112          383 ASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYSFVKEMLEK  462 (625)
Q Consensus       383 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~  462 (625)
                      ..+++.|..    ++..+|+.++.+|.+.|+.++|..+|++|.. +..||..+|+.++.+|++.|..+.+.+++..+.+.
T Consensus       444 ~~vf~~m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~  518 (857)
T PLN03077        444 LEVFHNIPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRT  518 (857)
T ss_pred             HHHHHhCCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHh
Confidence            777766653    3556777777777777777777777777764 46677777777777777777777777777777777


Q ss_pred             CCCCCHhhHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHhCCCCCCHHHHH
Q 038112          463 GWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYN  542 (625)
Q Consensus       463 ~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  542 (625)
                      |+.++..+++.++.+|++.|++++|.++|+.+     .||..+|+.++.+|++.|+.++|.++|++|.+.|+.||..||+
T Consensus       519 g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~  593 (857)
T PLN03077        519 GIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFI  593 (857)
T ss_pred             CCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHH
Confidence            77777777777777777777777777777765     4678888888888888888888888888888888888888888


Q ss_pred             HHHHHHHccCChhHHHHHHHHHH-HcCCCCCHHHHHHHHHHHhhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhc
Q 038112          543 TLMDGLFKTGDCDKALEIWNHIL-EERLRPDIISYNITLKGLCSCSRMSDAFEFLNDALCRGILPTTITWHILVRAVMNN  621 (625)
Q Consensus       543 ~l~~~~~~~g~~~~A~~~~~~~~-~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  621 (625)
                      .++.+|.+.|++++|.++|+.|. +.|+.|+..+|..++++|.+.|++++|.+++++|   .+.||..+|++|+.+|...
T Consensus       594 ~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m---~~~pd~~~~~aLl~ac~~~  670 (857)
T PLN03077        594 SLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKM---PITPDPAVWGALLNACRIH  670 (857)
T ss_pred             HHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHc
Confidence            88888888888888888888888 5688888888888888888888888888888888   3778888888888888776


Q ss_pred             CC
Q 038112          622 GA  623 (625)
Q Consensus       622 g~  623 (625)
                      |+
T Consensus       671 ~~  672 (857)
T PLN03077        671 RH  672 (857)
T ss_pred             CC
Confidence            65



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query625
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 86.4 bits (212), Expect = 1e-17
 Identities = 22/199 (11%), Positives = 65/199 (32%), Gaps = 4/199 (2%)

Query: 378 RLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENA---IFLFKEMSRKGCSPTVV 434
            L    +   +  +           +     +   +L  A   + +     +K    T+ 
Sbjct: 107 SLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLD 166

Query: 435 SYNTLINGLCKVERFGEAYSFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMAL-KLCCQ 493
            YN ++ G  +   F E    +  + + G  PD+++Y+  +  + +  +    + +   Q
Sbjct: 167 MYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQ 226

Query: 494 FLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKRNCVPNLVTYNTLMDGLFKTGD 553
             Q+G         +L+     A  ++   ++         +P  V  + L+  ++    
Sbjct: 227 MSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDG 286

Query: 554 CDKALEIWNHILEERLRPD 572
                ++   +   +   +
Sbjct: 287 RVSYPKLHLPLKTLQCLFE 305


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query625
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.9
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.9
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.89
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.83
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.77
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.76
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.74
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.73
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.71
3u4t_A272 TPR repeat-containing protein; structural genomics 99.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.68
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.67
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.67
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.65
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.63
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.63
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.63
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.62
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.61
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.59
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.58
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.54
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.52
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.5
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.49
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.47
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.46
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.38
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.37
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.34
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.33
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.33
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.31
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.28
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.26
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.24
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.23
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.23
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.22
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.2
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.19
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.19
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.18
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.18
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.13
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.11
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.02
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.0
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.99
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.98
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.98
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.95
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.95
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.95
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.95
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.94
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.93
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.92
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.92
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.92
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.9
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.9
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.89
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.88
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.85
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.84
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.84
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.84
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.82
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.77
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.76
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.75
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.75
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.74
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.73
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.73
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.72
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.72
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.69
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.69
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.66
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.64
3k9i_A117 BH0479 protein; putative protein binding protein, 98.64
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.63
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.63
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.61
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.6
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.6
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.58
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.55
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.54
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.52
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.51
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.46
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.45
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.43
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.42
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.38
3k9i_A117 BH0479 protein; putative protein binding protein, 98.37
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.36
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.35
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.33
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.31
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.29
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.26
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.23
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.22
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.2
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.12
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.07
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.01
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.0
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.97
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.95
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.94
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.93
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.72
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.71
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.58
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.47
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.39
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.35
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.26
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.2
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.11
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.09
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.06
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.74
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.68
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.64
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.58
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.3
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.19
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.05
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.74
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.67
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.64
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.5
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.5
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.21
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.12
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.04
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.77
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.68
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.2
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.51
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.44
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.22
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.05
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.59
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.23
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.09
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.28
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.09
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.71
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.55
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.25
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.83
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.87
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.29
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 87.88
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.36
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.99
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 86.7
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.5
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.73
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 83.99
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 82.25
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.5e-40  Score=339.87  Aligned_cols=488  Identities=13%  Similarity=0.011  Sum_probs=360.0

Q ss_pred             CCHHHHHHHHHHHHccCCchHHHHHHHHhHHhhCCCcchhhhcCChHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCC
Q 038112           71 CPEDVALSVIQAYGKNSMPDKALDVFQRMNEIFGCEAGILCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGD  150 (625)
Q Consensus        71 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  150 (625)
                      ++...+..++..+.+.|++++|+.+|+++...                             .|+..++..++.+|.+.|+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-----------------------------~p~~~~~~~l~~~~~~~g~  132 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDI-----------------------------TGNPNDAFWLAQVYCCTGD  132 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH-----------------------------HCCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhh-----------------------------CCCchHHHHHHHHHHHcCc
Confidence            34566667777777777777777777766331                             1344455555555555555


Q ss_pred             hhhHHHHHHHHHhCCCCCCchhhHHHHHHHHhcCChhHHHHHHHHHHhCC--------------CCCCCcchHHHHHHHH
Q 038112          151 LLGALAVFDEMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMET--------------SVYPNVVTYNVMINGL  216 (625)
Q Consensus       151 ~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~--------------~~~~~~~~~~~l~~~~  216 (625)
                      +++|..+|+++...  ++++.++..++.+|.+.|++++|+++|+++....              +.+++..+|+.++.+|
T Consensus       133 ~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  210 (597)
T 2xpi_A          133 YARAKCLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVY  210 (597)
T ss_dssp             HHHHHHHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHH
Confidence            55555555555432  3455555555555555555555555555322211              2345677888888888


Q ss_pred             HhcCChhhHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCCHHHHHH--H-HHHHHHCCCCcCHHHHHHHHHHHHhcCCHH
Q 038112          217 CKCGRFDECLEMWDRMKKNEREKDSFTYCSFIHGLCKAGNVEGAER--V-YREMVESGIFVDAVTYNAMIDGFCRAGKIK  293 (625)
Q Consensus       217 ~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~--~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  293 (625)
                      .+.|++++|+++|+++.+.++ .+...+..++..+...+..+.+..  + +..+...+..+...++..++..|.+.|+++
T Consensus       211 ~~~g~~~~A~~~~~~~~~~~p-~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  289 (597)
T 2xpi_A          211 TNLSNFDRAKECYKEALMVDA-KCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELR  289 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHH
T ss_pred             HHcCCHHHHHHHHHHHHHhCc-hhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHH
Confidence            888888888888888887653 245556656555444333222221  1 455555544445566666778888888899


Q ss_pred             HHHHHHHHHHhcCCCcHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 038112          294 ECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEE  373 (625)
Q Consensus       294 ~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~  373 (625)
                      +|.++|+.+... +++..+|+.++.++.+.|++++|..+|+++.+.++. +..++..++..+...|++++|..++++   
T Consensus       290 ~A~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~---  364 (597)
T 2xpi_A          290 RAEDYLSSINGL-EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISND---  364 (597)
T ss_dssp             HHHHHHHTSTTG-GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHH---
T ss_pred             HHHHHHHHhhcC-CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHH---
Confidence            999999888766 468888889999999999999999999988877644 677888888888999999999988884   


Q ss_pred             cCCCchHHHHHHHHHHhhCCCCccHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCChhhHHHHHHHHhccCCHHHHH
Q 038112          374 GGEGRLADAASLVNRMDKHGCKLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAY  453 (625)
Q Consensus       374 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~  453 (625)
                                     +... .+.+..++..++..|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|+
T Consensus       365 ---------------~~~~-~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~  427 (597)
T 2xpi_A          365 ---------------LVDR-HPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAI  427 (597)
T ss_dssp             ---------------HHHH-CTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHH
T ss_pred             ---------------HHhh-CcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHH
Confidence                           3322 23467788888999999999999999999988753 236778999999999999999999


Q ss_pred             HHHHHHHHCCCCCCHhhHHHHHHHHhccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHhC-
Q 038112          454 SFVKEMLEKGWKPDMITYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGLCSAGKVEDALQLYSNMKKR-  532 (625)
Q Consensus       454 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-  532 (625)
                      .+|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+. 
T Consensus       428 ~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  505 (597)
T 2xpi_A          428 SAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLV  505 (597)
T ss_dssp             HHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhh
Confidence            9999988763 4477888899999999999999999999998764 447888999999999999999999999998875 


Q ss_pred             ---CCCCC--HHHHHHHHHHHHccCChhHHHHHHHHHHHcCCCC-CHHHHHHHHHHHhhcCChHHHHHHHHHHHHCCCCC
Q 038112          533 ---NCVPN--LVTYNTLMDGLFKTGDCDKALEIWNHILEERLRP-DIISYNITLKGLCSCSRMSDAFEFLNDALCRGILP  606 (625)
Q Consensus       533 ---~~~~~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~  606 (625)
                         +..|+  ..+|..++.+|.+.|++++|.++++++++  ..| +..+|..++.+|.+.|++++|.++++++++.  .|
T Consensus       506 ~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~--~p  581 (597)
T 2xpi_A          506 KKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLL--LSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI--SP  581 (597)
T ss_dssp             HHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CT
T ss_pred             hccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHH--hCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc--CC
Confidence               45676  78899999999999999999999999988  445 6788999999999999999999999999874  45


Q ss_pred             C-HHHHHHHHHHH
Q 038112          607 T-TITWHILVRAV  618 (625)
Q Consensus       607 ~-~~~~~~l~~~~  618 (625)
                      + ...+..+..+|
T Consensus       582 ~~~~~~~~l~~~~  594 (597)
T 2xpi_A          582 NEIMASDLLKRAL  594 (597)
T ss_dssp             TCHHHHHHHHHTT
T ss_pred             CChHHHHHHHHHH
Confidence            4 45555555544



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 625
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 1e-04
 Identities = 41/328 (12%), Positives = 90/328 (27%), Gaps = 21/328 (6%)

Query: 288 RAGKIKECFELWEVMGRKGCLNVVSYNILIRGLLENGKVDEAISIWELLREKN------- 340
           +AG  +        + R+   N     +L     +  ++D +     L  ++N       
Sbjct: 11  QAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAY 70

Query: 341 ------CNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGC 394
                           + +           I     +            ++   +     
Sbjct: 71  SNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQY 130

Query: 395 KLNAYTCNSLMNGFIQASKLENAIFLFKEMSRKGCSPTVVSYNTLINGLCKVERFGEAYS 454
             + Y   S +   ++A             + +      V+++ L            A  
Sbjct: 131 NPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIH 190

Query: 455 FVKEMLEKGWKPDMI-TYSLLINGLCQSKKIDMALKLCCQFLQKGFTPDVTMYNILIHGL 513
             ++ +     P+ +  Y  L N L +++  D A+    + L       V   N L    
Sbjct: 191 HFEKAVTL--DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN-LACVY 247

Query: 514 CSAGKVEDALQLYSNMKKRNCVPNLV-TYNTLMDGLFKTGDCDKALEIWNHILEERLRPD 572
              G ++ A+  Y    +    P+    Y  L + L + G   +A + +N  L       
Sbjct: 248 YEQGLIDLAIDTYRRAIELQ--PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHA 305

Query: 573 IISYNITLKGLCSCSRMSDAFEFLNDAL 600
               N+          + +A      AL
Sbjct: 306 DSLNNLANI-KREQGNIEEAVRLYRKAL 332


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query625
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.76
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.7
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.49
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.42
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.42
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.41
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.34
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.33
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.3
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.27
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.92
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.88
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.88
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.85
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.78
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.76
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.74
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.72
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.62
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.56
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.48
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.47
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.46
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.39
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.38
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.24
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.23
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.11
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.03
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.93
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.81
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.79
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.78
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.76
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.35
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.27
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.09
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.25
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.16
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.56
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.05
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 91.48
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.35
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.51
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=1e-24  Score=208.65  Aligned_cols=378  Identities=15%  Similarity=0.066  Sum_probs=319.0

Q ss_pred             HHHHHHHccCChhHHHHHHHhhccCCCCCCCHHHHHHHHHHhhCCCChhHHHHHHHHHHHhcCCCCHHHHHHHHHHHHcc
Q 038112            7 RLLNLLKAEKNPHTALALFDSATREPGYAHSPHLFHHILRRLIDPKLVVHVSRILELIEIQKCYCPEDVALSVIQAYGKN   86 (625)
Q Consensus         7 ~l~~~l~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~   86 (625)
                      .++....+.|++++|+..|+.+++..  |.++.++..++.++.+.|++++|...++.+++.+| .+..++..++.+|.+.
T Consensus         4 ~la~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p-~~~~a~~~l~~~~~~~   80 (388)
T d1w3ba_           4 ELAHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKER   80 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHhhhh
Confidence            47888899999999999999999887  89999999999999999999999999999999974 5788999999999999


Q ss_pred             CCchHHHHHHHHhHHhhCCCcch-------hhhcCChHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCChhhHHHHHH
Q 038112           87 SMPDKALDVFQRMNEIFGCEAGI-------LCRKRQFEKAKRFLNSLWEKGLKPDVYSYGTVINGLVKSGDLLGALAVFD  159 (625)
Q Consensus        87 ~~~~~A~~~~~~~~~~~~~~~~~-------~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~  159 (625)
                      |++++|+..+.......+.....       ....+....+........... .................+....+...+.
T Consensus        81 g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (388)
T d1w3ba_          81 GQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACYL  159 (388)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHHH
Confidence            99999999999998876666555       444556666666666555544 3445555566666778888888988888


Q ss_pred             HHHhCCCCCCchhhHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCCcchHHHHHHHHHhcCChhhHHHHHHHHHhCCCCC
Q 038112          160 EMFERGVETNVVCYNILIDGFFKKGDYMRAKEIWERLVMETSVYPNVVTYNVMINGLCKCGRFDECLEMWDRMKKNEREK  239 (625)
Q Consensus       160 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~  239 (625)
                      ...... +.+...+..++..+...|++++|...++...+..  +.+..++..+...+...|++++|+..+++.....+ .
T Consensus       160 ~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~--p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~  235 (388)
T d1w3ba_         160 KAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD--PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSP-N  235 (388)
T ss_dssp             HHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT-T
T ss_pred             HhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC--cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhh-h
Confidence            888764 3366788889999999999999999999988763  45667889999999999999999999999887654 4


Q ss_pred             ChhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHH
Q 038112          240 DSFTYCSFIHGLCKAGNVEGAERVYREMVESGIFVDAVTYNAMIDGFCRAGKIKECFELWEVMGRKGCLNVVSYNILIRG  319 (625)
Q Consensus       240 ~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~  319 (625)
                      +...+..+...+...|++++|+..|+++++..+. +..++..+..++...|++++|++.++......|.+...+..+..+
T Consensus       236 ~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~  314 (388)
T d1w3ba_         236 HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI  314 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSS-CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHH
Confidence            6777888999999999999999999999987543 678899999999999999999999999999999999999999999


Q ss_pred             HHhCCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHhhCCCCccHH
Q 038112          320 LLENGKVDEAISIWELLREKNCNADSTTHGVLINGLCKNGYLNKAIQILNEVEEGGEGRLADAASLVNRMDKHGCKLNAY  399 (625)
Q Consensus       320 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  399 (625)
                      +...|++++|+..|++..+..+. +..++..+...+...|++++|...++++.                  +.. |-+..
T Consensus       315 ~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~la~~~~~~g~~~~A~~~~~~al------------------~l~-P~~~~  374 (388)
T d1w3ba_         315 KREQGNIEEAVRLYRKALEVFPE-FAAAHSNLASVLQQQGKLQEALMHYKEAI------------------RIS-PTFAD  374 (388)
T ss_dssp             HHTTTCHHHHHHHHHHHTTSCTT-CHHHHHHHHHHHHTTTCCHHHHHHHHHHH------------------TTC-TTCHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHH------------------HhC-CCCHH
Confidence            99999999999999999887543 57778889999999999999999999533                  322 22566


Q ss_pred             HHHHHHHHHHhcCC
Q 038112          400 TCNSLMNGFIQASK  413 (625)
Q Consensus       400 ~~~~l~~~~~~~~~  413 (625)
                      .+..+..+|.+.||
T Consensus       375 a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         375 AYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHcCC
Confidence            78888888877664



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure