Citrus Sinensis ID: 038256
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 691 | 2.2.26 [Sep-21-2011] | |||||||
| Q8RXD4 | 941 | Protein BREAST CANCER SUS | no | no | 0.497 | 0.365 | 0.441 | 4e-85 | |
| Q9QZH2 | 768 | BRCA1-associated RING dom | yes | no | 0.198 | 0.178 | 0.387 | 1e-19 | |
| O70445 | 765 | BRCA1-associated RING dom | yes | no | 0.238 | 0.215 | 0.320 | 2e-18 | |
| Q99728 | 777 | BRCA1-associated RING dom | yes | no | 0.191 | 0.169 | 0.387 | 5e-18 | |
| P20659 | 3726 | Histone-lysine N-methyltr | yes | no | 0.173 | 0.032 | 0.321 | 1e-12 | |
| Q24742 | 3828 | Histone-lysine N-methyltr | N/A | no | 0.149 | 0.026 | 0.341 | 1e-11 | |
| Q9EPQ8 | 1983 | Transcription factor 20 O | no | no | 0.114 | 0.039 | 0.412 | 9e-11 | |
| Q9UGU0 | 1960 | Transcription factor 20 O | no | no | 0.114 | 0.040 | 0.412 | 1e-10 | |
| Q9GKK8 | 1863 | Breast cancer type 1 susc | no | no | 0.227 | 0.084 | 0.265 | 1e-10 | |
| Q6J6I9 | 1863 | Breast cancer type 1 susc | no | no | 0.224 | 0.083 | 0.268 | 1e-10 |
| >sp|Q8RXD4|BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana GN=BRCA1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 316 bits (809), Expect = 4e-85, Method: Compositional matrix adjust.
Identities = 166/376 (44%), Positives = 214/376 (56%), Gaps = 32/376 (8%)
Query: 323 SCANNYICGFCQSSRISEVTGLMLHYANGKPVVGEEADRSHVIHVHSKCIEWAPQVYYAG 382
S + C FCQ S +E +G M HY G+PV + S VIHVH C EWAP VY+
Sbjct: 557 SLTKKFTCAFCQCSEDTEASGEMTHYYRGEPVSADFNGGSKVIHVHKNCAEWAPNVYFND 616
Query: 383 DTVKNLKAELARGSKLKCSRCGLKGAALGCYVRSCRRSYHVPCALEISECRWDTENFLVL 442
T+ NL EL R ++ CS CGLKGAALGCY +SC+ S+HV CA I ECRWD F++L
Sbjct: 617 LTIVNLDVELTRSRRISCSCCGLKGAALGCYNKSCKNSFHVTCAKLIPECRWDNVKFVML 676
Query: 443 CPVHSSVKFPIEKSGHRS---IRNRAAPLQLTPQEPS------------FWGSSPNKAKE 487
CP+ +S+K P E++ + R PL P++ S F G S K+
Sbjct: 677 CPLDASIKLPCEEANSKDRKCKRTPKEPLHSQPKQVSGKANIRELHIKQFHGFS----KK 732
Query: 488 WVFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILN 547
V S L+VEEK ++ F + GV +SK W VTHVIA+ + G+C RTLK +MAIL
Sbjct: 733 LVLSCSGLTVEEKTVIAEFAELSGVTISKNWDSTVTHVIASINENGACKRTLKFMMAILE 792
Query: 548 GNWVLKIDWIKACMEAMNPVGEEPYEINLDNHGCEEGPKTGRLRALNKAPKLFDGLSFYF 607
G W+L IDWIKACM+ V EEPYEI +D HG EGP GR RAL K PKLF GL FY
Sbjct: 793 GKWILTIDWIKACMKNTKYVSEEPYEITMDVHGIREGPYLGRQRALKKKPKLFTGLKFYI 852
Query: 608 SGNFMLGYKEDLQSLVITAGGTIWKSEGELLAQCRNDETAPSKVLVVYNLDFPEGSLIGE 667
G+F L YK LQ L++ AGGTI + +D+ S ++V S+
Sbjct: 853 MGDFELAYKGYLQDLIVAAGGTILRRR-----PVSSDDNEASTIVVF--------SVEPS 899
Query: 668 EVSTIWNRLNEAEELA 683
+ T+ R ++AE LA
Sbjct: 900 KKKTLTQRRSDAEALA 915
|
May play a role in DNA repair and in cell-cycle control. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9EPQ8|TCF20_MOUSE Transcription factor 20 OS=Mus musculus GN=Tcf20 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9UGU0|TCF20_HUMAN Transcription factor 20 OS=Homo sapiens GN=TCF20 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9GKK8|BRCA1_PANTR Breast cancer type 1 susceptibility protein homolog OS=Pan troglodytes GN=BRCA1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q6J6I9|BRCA1_MACMU Breast cancer type 1 susceptibility protein homolog OS=Macaca mulatta GN=BRCA1 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 691 | ||||||
| 255571240 | 744 | brca1 associated ring domain, putative [ | 0.972 | 0.903 | 0.540 | 0.0 | |
| 449509416 | 679 | PREDICTED: protein BREAST CANCER SUSCEPT | 0.934 | 0.951 | 0.489 | 1e-174 | |
| 449468570 | 679 | PREDICTED: protein BREAST CANCER SUSCEPT | 0.934 | 0.951 | 0.488 | 1e-173 | |
| 356503626 | 678 | PREDICTED: protein BREAST CANCER SUSCEPT | 0.908 | 0.926 | 0.486 | 1e-165 | |
| 357510115 | 687 | PHD finger protein 11-like protein [Medi | 0.923 | 0.928 | 0.465 | 1e-158 | |
| 297843214 | 708 | ATBARD1/BARD1 [Arabidopsis lyrata subsp. | 0.917 | 0.895 | 0.450 | 1e-156 | |
| 145362227 | 713 | BRCA1-associated RING domain protein 1 [ | 0.921 | 0.893 | 0.451 | 1e-151 | |
| 42561677 | 714 | BRCA1-associated RING domain protein 1 [ | 0.931 | 0.901 | 0.451 | 1e-150 | |
| 224070137 | 380 | predicted protein [Populus trichocarpa] | 0.522 | 0.95 | 0.677 | 1e-142 | |
| 194244951 | 674 | BARD1 [Arabidopsis thaliana] | 0.878 | 0.900 | 0.433 | 1e-136 |
| >gi|255571240|ref|XP_002526570.1| brca1 associated ring domain, putative [Ricinus communis] gi|223534131|gb|EEF35848.1| brca1 associated ring domain, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 724 bits (1868), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 388/718 (54%), Positives = 476/718 (66%), Gaps = 46/718 (6%)
Query: 15 MADSAANSK--RSFNPLVLHLQKLALELKCPLCLNLFSRPLLLPCDHIFCNSCIPRSAQC 72
MADS ++ RS NP VLHLQKL LELKCPLCLN RP LLPCDHIFCNSC+ +
Sbjct: 1 MADSMKHNSVIRSMNPWVLHLQKLGLELKCPLCLNFLKRPFLLPCDHIFCNSCLHERTKF 60
Query: 73 ESECPLCKSQCTYADLRPLAFLENIIAIYKGLDASPSSNLLQPVYSAFGR---------- 122
SECP+CK Q DLRPL F+EN++AIY+ LD++ +N+ Q S G+
Sbjct: 61 ASECPVCKDQYVGRDLRPLPFIENMVAIYRSLDSAFCANMFQSSCSDTGKISEQCPTSAG 120
Query: 123 ------------HQEDNSSSGQS---LSANTLVQVSFNNSACDGQ------KGKGFELTG 161
QEDNSSSG+S L N L QV N+S + K +T
Sbjct: 121 ADCNDKLSKESIGQEDNSSSGRSMYLLKGNQLAQVPLNSSQNGARNIDMADKSNVQRVTK 180
Query: 162 MGENKRDGG---QNPNSAQPSSHTQAGGIRDCRPAQIDINQLDQLSPCSPPSFGDIKGSD 218
GE + GG QN NS SS +AG +++C +I NQ DQLS SPPSFGD+K +
Sbjct: 181 DGEYEIVGGDAKQNINSTPISSQVRAGRLQECGLLRISTNQADQLSTGSPPSFGDVKSPE 240
Query: 219 NESNDQGGELSPESYLANRSVKRGFDDRTRQEHR--LSSSETAGSFRDSKRLKGFNYGPD 276
N+S DQG + SP +Y A R VKR DD T QE +S G+ RD KR K +YG
Sbjct: 241 NDSCDQGDD-SPTNYQAIRLVKRSPDDMTSQERHDGFASGTEGGNLRDPKRHKKLDYGQL 299
Query: 277 SVGVKSSGHSQSTVFRSESLMASKSDSELKSVAALASEKMPPISIDSCANNYICGFCQSS 336
+ + + S ++E+ A S K V + P + DS +CGFCQSS
Sbjct: 300 N---RDTNRSSPISSQTENPGACCSQLGHKFVPPHIDGQPPALLEDSSVAKIMCGFCQSS 356
Query: 337 RISEVTGLMLHYANGKPVVGEEADRSHVIHVHSKCIEWAPQVYYAGDTVKNLKAELARGS 396
R S+ TG M HY NGK V G+EA + +HVH CIEWAPQVY+ +TVKNLKAELARGS
Sbjct: 357 RTSKDTGPMFHYVNGKLVEGDEASGPNALHVHRICIEWAPQVYFVDETVKNLKAELARGS 416
Query: 397 KLKCSRCGLKGAALGCYVRSCRRSYHVPCALEISECRWDTENFLVLCPVHSSVKFPIEKS 456
KLKCS+CGLKGAALGC+ +SCRRSYHV CA+EI+ CRWD +NFLVLCP HSSV+FP EK
Sbjct: 417 KLKCSKCGLKGAALGCFQKSCRRSYHVTCAMEIAGCRWDYDNFLVLCPSHSSVRFPDEKK 476
Query: 457 GH---RSIRNRAAPLQLTPQEPSFWGSSPNKAKEWVFCGSALSVEEKLLLVRFGNMIGVP 513
S+ P Q+ PQ+P+FW S AKEWVFCGSALS EEK LL+ FG MIGVP
Sbjct: 477 SKSKKHSLERHHVPTQVPPQQPNFWAESATGAKEWVFCGSALSSEEKSLLIEFGRMIGVP 536
Query: 514 VSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNGNWVLKIDWIKACMEAMNPVGEEPYE 573
V+KFW+PNVTHVIAATD KG+CTRTLKVLMAILNG WVL IDW+KACM +M+ V EEPYE
Sbjct: 537 VTKFWQPNVTHVIAATDTKGACTRTLKVLMAILNGRWVLTIDWVKACMRSMHYVDEEPYE 596
Query: 574 INLDNHGCEEGPKTGRLRALNKAPKLFDGLSFYFSGNFMLGYKEDLQSLVITAGGTIWKS 633
++LDNHGC GP+TGRL L+ APKLF GL+FYF+G+F+ GYKEDLQ+LV+ AGGTI S
Sbjct: 597 VSLDNHGCHSGPRTGRLSVLDNAPKLFSGLNFYFAGDFVSGYKEDLQNLVLAAGGTILDS 656
Query: 634 EGELLAQCRNDETAPSKVLVVYNLDFPEGSLIGEEVSTIWNRLNEAEELASKIGCRVI 691
+ +++ Q N+ T PS+ LVVYN D P G +GEEV+ +W RL+EAE+LA+KIG +VI
Sbjct: 657 KEKVVEQSHNEAT-PSRTLVVYNFDPPLGCKLGEEVTILWQRLSEAEDLAAKIGSQVI 713
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449509416|ref|XP_004163582.1| PREDICTED: protein BREAST CANCER SUSCEPTIBILITY 1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449468570|ref|XP_004151994.1| PREDICTED: protein BREAST CANCER SUSCEPTIBILITY 1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356503626|ref|XP_003520608.1| PREDICTED: protein BREAST CANCER SUSCEPTIBILITY 1 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357510115|ref|XP_003625346.1| PHD finger protein 11-like protein [Medicago truncatula] gi|355500361|gb|AES81564.1| PHD finger protein 11-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297843214|ref|XP_002889488.1| ATBARD1/BARD1 [Arabidopsis lyrata subsp. lyrata] gi|297335330|gb|EFH65747.1| ATBARD1/BARD1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|145362227|ref|NP_973758.2| BRCA1-associated RING domain protein 1 [Arabidopsis thaliana] gi|332189525|gb|AEE27646.1| BRCA1-associated RING domain protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42561677|ref|NP_171898.2| BRCA1-associated RING domain protein 1 [Arabidopsis thaliana] gi|332189526|gb|AEE27647.1| BRCA1-associated RING domain protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224070137|ref|XP_002303120.1| predicted protein [Populus trichocarpa] gi|222844846|gb|EEE82393.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|194244951|gb|ACF35259.1| BARD1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 691 | ||||||
| TAIR|locus:2024244 | 714 | BARD1 "AT1G04020" [Arabidopsis | 0.545 | 0.528 | 0.593 | 5.8e-150 | |
| TAIR|locus:2133109 | 941 | BRCA1 "breast cancer susceptib | 0.772 | 0.567 | 0.350 | 2e-81 | |
| RGD|621072 | 768 | Bard1 "BRCA1 associated RING d | 0.198 | 0.178 | 0.394 | 6.7e-23 | |
| UNIPROTKB|G3V7X7 | 768 | Bard1 "BRCA1 associated RING d | 0.198 | 0.178 | 0.394 | 6.7e-23 | |
| UNIPROTKB|F1SSQ2 | 780 | BARD1 "Uncharacterized protein | 0.191 | 0.169 | 0.394 | 1.9e-20 | |
| UNIPROTKB|F1MAV4 | 772 | LOC100848694 "Uncharacterized | 0.191 | 0.170 | 0.380 | 2.5e-20 | |
| MGI|MGI:1328361 | 765 | Bard1 "BRCA1 associated RING d | 0.238 | 0.215 | 0.326 | 4.5e-20 | |
| UNIPROTKB|Q5ZKJ1 | 750 | BARD1 "Uncharacterized protein | 0.211 | 0.194 | 0.363 | 7.2e-20 | |
| UNIPROTKB|Q90X95 | 772 | bard1 "BRCA1-associated RING d | 0.204 | 0.182 | 0.364 | 4e-19 | |
| UNIPROTKB|F1P8X2 | 728 | BARD1 "Uncharacterized protein | 0.191 | 0.181 | 0.394 | 7.4e-19 |
| TAIR|locus:2024244 BARD1 "AT1G04020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1190 (424.0 bits), Expect = 5.8e-150, Sum P(2) = 5.8e-150
Identities = 226/381 (59%), Positives = 278/381 (72%)
Query: 313 SEKMPPISIDSCANNYICGFCQSSRISEVTGLMLHYANGKPVVGEEADRSHVIHVHSKCI 372
SEK+ + +N ICGFCQS+R+SE TG MLHY+ G+PV G++ RS+VIHVHS CI
Sbjct: 317 SEKISKALEQTSSNITICGFCQSARVSEATGEMLHYSRGRPVDGDDIFRSNVIHVHSACI 376
Query: 373 EWAPQVYYAGDTVKNLKAELARGSKLKCSRCGLKGAALGCYVRSCRRSYHVPCALEISEC 432
EWAPQVYY GDTVKNLKAELARG K+KC++C LKGAALGC+V+SCRRSYHVPCA EIS C
Sbjct: 377 EWAPQVYYEGDTVKNLKAELARGMKIKCTKCSLKGAALGCFVKSCRRSYHVPCAREISRC 436
Query: 433 RWDTENFLVLCPVHSSVKFPIEKSGHRSIRNRAAPL-QLTPQEPSFWGSSPNKAKEWVFC 491
RWD E+FL+LCP HSSVKFP EKSGHR +RA PL ++ P E +P KE V C
Sbjct: 437 RWDYEDFLLLCPAHSSVKFPNEKSGHRV--SRAEPLPKINPAELCSLEQTPAFTKELVLC 494
Query: 492 GSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNGNWV 551
GSALS +K L+ +S++W P+VTHVIA+TD KG+CTRTLKVLM ILNG W+
Sbjct: 495 GSALSKSDKKLMESLAVRFNATISRYWNPSVTHVIASTDEKGACTRTLKVLMGILNGKWI 554
Query: 552 LKIDWIKACMEAMNPVGEEPYEINLDNHGCEEGPKTGRLRALNKAPKLFDGLSFYFSGNF 611
+ W+KA ++A PV EEP+EI +D GC++GPKT RLRA PKLF+GL FYF G+F
Sbjct: 555 INAAWMKASLKASQPVDEEPFEIQIDTQGCQDGPKTARLRAETNKPKLFEGLKFYFFGDF 614
Query: 612 MLGYKEDLQSLVITAGGTIWKSEGELLAQCRND-ETAPSKVLVVYNLDFPEGSLIGEEVS 670
GYKEDLQ+LV AGGTI +E EL A+ N+ S +VVYN+D P G +GEEV+
Sbjct: 615 YKGYKEDLQNLVKVAGGTILNTEDELGAESSNNVNDQRSSSIVVYNIDPPHGCALGEEVT 674
Query: 671 TIWNRLNEAEELASKIGCRVI 691
IW R N+AE LAS+ G R++
Sbjct: 675 IIWQRANDAEALASQTGSRLV 695
|
|
| TAIR|locus:2133109 BRCA1 "breast cancer susceptibility1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|621072 Bard1 "BRCA1 associated RING domain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V7X7 Bard1 "BRCA1 associated RING domain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSQ2 BARD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAV4 LOC100848694 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1328361 Bard1 "BRCA1 associated RING domain 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKJ1 BARD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q90X95 bard1 "BRCA1-associated RING domain protein" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P8X2 BARD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | fgenesh2_kg.1__333__AT1G04020.1 | annotation not avaliable (708 aa) | |||||||||
(Arabidopsis lyrata) | |||||||||||
 | fgenesh2_kg.5__1873__AT3G54750.2 | • | 0.402 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 691 | |||
| pfam13771 | 89 | pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai | 2e-17 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-08 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-07 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 3e-07 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 6e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 6e-06 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 9e-06 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 1e-05 | |
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 2e-05 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 6e-05 | |
| pfam13832 | 109 | pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma | 4e-04 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 7e-04 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 0.002 |
| >gnl|CDD|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain | Back alignment and domain information |
|---|
Score = 77.4 bits (191), Expect = 2e-17
Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 11/90 (12%)
Query: 368 HSKCIEWAPQVYYAGDT------VKNLKAELARGSKLKCSRCGLKGAALGCYVRSCRRSY 421
H C W+P+V GD ++++ + R KLKCS C KGA +GC V++CRR++
Sbjct: 1 HVNCALWSPEVVQRGDDDMEGFPLEDVDKAVKRRRKLKCSLCKKKGACIGCCVKNCRRAF 60
Query: 422 HVPCALEISECRWDTEN----FLVLCPVHS 447
HV CA E + C + + F CP H
Sbjct: 61 HVTCARE-AGCLFQFDGDNGKFKSYCPKHR 89
|
The members of this family are annotated as containing PHD domain, but the zinc-binding region here is not typical of PHD domains. The conformation here is a well-conserved cysteine-histidine rich region spanning 90 residues, where the Cys and His are arranged as HxxC(31)CxxC(6)CxxCxxxxCxxxxHxxC (21)CxxH. Length = 89 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 691 | |||
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 100.0 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 99.77 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 99.7 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 99.68 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 99.58 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 99.47 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 99.46 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 99.37 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.16 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.15 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 99.11 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.1 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.05 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 99.03 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.99 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.96 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.93 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 98.92 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 98.9 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.81 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 98.74 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.67 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.63 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.55 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.44 | |
| KOG1084 | 375 | consensus Transcription factor TCF20 [Transcriptio | 98.42 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.37 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.33 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.3 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.29 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.27 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 98.23 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.21 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.2 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.16 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.11 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.03 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.95 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.9 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.87 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.79 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.7 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 97.62 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.61 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 97.59 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.58 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 97.56 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.55 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.4 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 97.36 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.28 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.28 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.98 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.89 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 96.86 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.79 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.72 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.65 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.47 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.41 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.38 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.38 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 96.32 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.27 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 95.97 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 95.77 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 95.54 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 95.28 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.2 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 94.89 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.7 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 94.68 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.56 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 94.53 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.18 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 94.05 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 93.81 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 93.71 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 92.92 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 92.57 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 92.56 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 92.51 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.43 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 92.39 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 92.33 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 92.09 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.52 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 91.5 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.11 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 90.96 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 90.93 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 90.81 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 90.33 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 90.3 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.54 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 89.32 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 88.06 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 87.87 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 87.79 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 87.31 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 87.14 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 86.11 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.66 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 85.04 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 84.82 | |
| KOG1084 | 375 | consensus Transcription factor TCF20 [Transcriptio | 83.46 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.38 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.25 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 82.82 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 82.6 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 82.29 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 81.72 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.76 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 80.56 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 80.54 |
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-44 Score=403.20 Aligned_cols=349 Identities=38% Similarity=0.566 Sum_probs=298.4
Q ss_pred CcccccccccCcCCcccce-------eeeecCCCccccccccCCCCeEEEccccccCCCcEEcCCcccCHHHHHHhcccc
Q 038256 326 NNYICGFCQSSRISEVTGL-------MLHYANGKPVVGEEADRSHVIHVHSKCIEWAPQVYYAGDTVKNLKAELARGSKL 398 (691)
Q Consensus 326 ~~~~C~lC~~~~~~~~~G~-------l~~~~~g~~v~g~~~~~~~~~wvH~~CalWsp~v~~~~~~l~~l~~~~~r~~~l 398 (691)
..-.|.+|.+.......+. ++.+..|....|+.....+..-+|+.|.+|.++|+.....+.. ..++.|+...
T Consensus 286 ~~~~~~~~~s~~~~~~~pe~~~k~~~~~~~sa~~~~s~Dk~~~~~~~~~~v~~~~d~~~v~d~cs~~~~-~~~l~r~~~~ 364 (684)
T KOG4362|consen 286 LASSPAQLSSRSPSKKTPESITKTVDKFEVSAGLISSGDKTDNGNVRKPSVAVSDDDEQVLDECSTSGK-ECELGRSFPI 364 (684)
T ss_pred ccchhhhhhcccccccCCccccccccceeecccccCCCccCCCccccccccccccchHHHHHhcccccc-ccccccCCcc
Confidence 3345666666544443444 7778888888888888999999999999999999876443322 1577889999
Q ss_pred ccCcCCCCCceeccCccCcccceecccccccCccccc---------------cCC---ceEeccccCCCCCCCCcccccc
Q 038256 399 KCSRCGLKGAALGCYVRSCRRSYHVPCALEISECRWD---------------TEN---FLVLCPVHSSVKFPIEKSGHRS 460 (691)
Q Consensus 399 ~C~~C~~~GA~I~C~~~~C~~~fH~~CA~~~~g~~~~---------------~~~---~~~~C~~H~~~~~~~e~~~~~~ 460 (691)
.|..|+..||..+|..++|...||++||+....|.|+ ..+ |.+.|+.|+..++|.++.....
T Consensus 365 ~~~~c~l~~~h~~~~~~s~~~~~~~~~a~~~~~~~~~~~t~~i~~~~~~~~r~~~~~~f~~~cp~~ss~kep~~K~~~~a 444 (684)
T KOG4362|consen 365 TCEDCKLKGAHLGCLEKSCGSSEHVKCARGIKSCRNDGTTSKISNSSEGEARSEHEPCFIVLCPMESSTKEPEEKPGGYA 444 (684)
T ss_pred eeeeccccchhhhhhhcccccceeeeeccccccccCccchhccccCCcccccccccchhhcccccccccccccccccccc
Confidence 9999999999999999999999999999998788887 323 7899999999999999999877
Q ss_pred cccccCCCCCCCCCCCC-------CCCCCCCCccEEEEEcCCCHHHHHHHHHHHhhcCccEeeccCCCceEEEecCCCCC
Q 038256 461 IRNRAAPLQLTPQEPSF-------WGSSPNKAKEWVFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKG 533 (691)
Q Consensus 461 krkk~~sk~l~~~~~s~-------~~~s~~~~~~~vi~~Sgls~~ek~~l~~~~~~lG~~v~~~~~~~vTHlI~~~~~~~ 533 (691)
.+....+..-...++.+ .....+..++++++.+|+++++++.|.+++.. ++...|.+.+||||+.+++.|
T Consensus 445 ~~~~~~p~~~~~~qp~q~~~~~n~~~s~~~~~kk~~~~~s~l~p~ek~~v~~~a~~---t~~k~~~~~~thvi~~~~~~g 521 (684)
T KOG4362|consen 445 GSVKPRPKRHDVLQPAQDGSKDNETKSTHRFKKKLVLLVSGLTPSEKQLVEKFAVD---TISKFWIEPVTHVIASTDLEG 521 (684)
T ss_pred ccccccccccccCCcccchhHhhhhhcccCcccceeeeeccCCcchHHHHHHHHHH---HHhhccCCCceeeeeeccccc
Confidence 77766665443333332 23367778899999999999999999999988 888999999999999999999
Q ss_pred cccchHHHHHHHHcCCeEeehhHHHHHHHhCCCCCCCCcccccCCCCCCCCchhhhhhhhccCCCCCCCceEEEecCcCc
Q 038256 534 SCTRTLKVLMAILNGNWVLKIDWIKACMEAMNPVGEEPYEINLDNHGCEEGPKTGRLRALNKAPKLFDGLSFYFSGNFML 613 (691)
Q Consensus 534 ~~~RT~K~L~Aia~G~wIVs~~Wl~~c~~~g~~vdEe~yei~~d~~~~~~gp~~~R~~~~~~~~~LF~G~~f~l~g~~~~ 613 (691)
+|.||+|||+||++|+|||++.|+.+|++.++|++|++|||++|..+..++|...|+++..+.++||.|+.|||.|+|..
T Consensus 522 ~c~rTlk~~~gil~gkwi~~~~w~~~s~k~~~~~~eepfEl~~d~~~~~~~~~~~~~~a~s~~~kLf~gl~~~~~g~fs~ 601 (684)
T KOG4362|consen 522 ACLRTLKVLMGILRGKWILSYDWVLASLKLRKWVSEEPFELQIDVPGAREGPKEKRLRAESYKPKLFEGLKFYFVGDFSN 601 (684)
T ss_pred chhhhHHHHHHhhcCceeeeHHHHHHHHHhcCCCCCCCeeEeecccCcccCcccccccccccCcchhcCCcceeeccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHHHHHhCCCEEEecCchhhhhhcCCCCCCCceEEEEeCCCCCCCCcccchhhHHhhHHHHHHHHHhhcCccC
Q 038256 614 GYKEDLQSLVITAGGTIWKSEGELLAQCRNDETAPSKVLVVYNLDFPEGSLIGEEVSTIWNRLNEAEELASKIGCRVI 691 (691)
Q Consensus 614 ~~k~~L~~LI~~~GG~Vl~~~~~~~~~~~~~~~~~~~~~IV~~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~g~~~i 691 (691)
+++++|++||.++||+|+...+.+.. ......+++++..++.. .++|+|.++||+||.+.+|+++
T Consensus 602 ~p~~~l~~l~~~~gg~~l~~~~~~~~------~~k~s~~~~~~~~~~~~-------~~~~~k~~~~ea~~~s~~a~~~ 666 (684)
T KOG4362|consen 602 PPKEQLQELVHLAGGTILQVPRVAYS------DKKKSTIVVLSEKPVLD-------SILWQKVNDAEALALSQRARAV 666 (684)
T ss_pred CcHHHHHHHHhhcCcceeeccCcccc------cccccceeEeecccCCC-------chhhhhhccHHHHHHhcCCCcc
Confidence 99999999999999999999877633 45566788888665553 4459999999999999999864
|
|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1084 consensus Transcription factor TCF20 [Transcription] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1084 consensus Transcription factor TCF20 [Transcription] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 691 | ||||
| 2r1z_A | 209 | Crystal Structure Of The Bard1 Brct Repeat Length = | 3e-18 | ||
| 2nte_A | 210 | Crystal Structure Of The Bard1 Brct Domains Length | 3e-18 | ||
| 3fa2_A | 218 | Crystal Structure Of The Brca1 Associated Ring Doma | 3e-18 | ||
| 2ing_X | 213 | X-Ray Structure Of The Brca1 Brct Mutant M1775k Len | 6e-10 | ||
| 1n5o_X | 214 | Structural Consequences Of A Cancer-Causing Brca1-B | 8e-10 | ||
| 1l0b_A | 229 | Crystal Structure Of Rat Brca1 Tandem-Brct Region L | 9e-10 | ||
| 1t2u_A | 214 | Structural Basis Of Phosphopeptide Recognition By T | 9e-10 | ||
| 1jnx_X | 214 | Crystal Structure Of The Brct Repeat Region From Th | 9e-10 | ||
| 3pxe_A | 214 | Impact Of Brca1 Brct Domain Missense Substitutions | 9e-10 | ||
| 3pxd_A | 214 | Impact Of Brca1 Brct Domain Missense Substitutions | 9e-10 | ||
| 3k15_A | 215 | Crystal Structure Of Brca1 Brct D1840t In Complex W | 9e-10 | ||
| 3k0h_A | 215 | The Crystal Structure Of Brca1 Brct In Complex With | 9e-10 | ||
| 3pxa_A | 214 | Impact Of Brca1 Brct Domain Missense Substitutions | 2e-09 | ||
| 3coj_X | 235 | Crystal Structure Of The Brct Domains Of Human Brca | 2e-09 | ||
| 3pxc_X | 214 | Impact Of Brca1 Brct Domain Missense Substitutions | 3e-09 | ||
| 3pxb_A | 214 | Impact Of Brca1 Brct Domain Missense Substitutions | 3e-09 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 5e-05 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 8e-05 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 1e-04 | ||
| 2ecv_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 2e-04 | ||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 3e-04 | ||
| 2egp_A | 79 | Solution Structure Of The Ring-Finger Domain From H | 4e-04 | ||
| 3sht_A | 206 | Crystal Structure Of Human Mcph1 Tandem Brct Domain | 5e-04 | ||
| 3szm_A | 199 | Structure Of Human Microcephalin (Mcph1) Tandem Brc | 5e-04 |
| >pdb|2R1Z|A Chain A, Crystal Structure Of The Bard1 Brct Repeat Length = 209 | Back alignment and structure |
|
| >pdb|2NTE|A Chain A, Crystal Structure Of The Bard1 Brct Domains Length = 210 | Back alignment and structure |
| >pdb|3FA2|A Chain A, Crystal Structure Of The Brca1 Associated Ring Domain (Bard1) Tandem Brct Domains Length = 218 | Back alignment and structure |
| >pdb|2ING|X Chain X, X-Ray Structure Of The Brca1 Brct Mutant M1775k Length = 213 | Back alignment and structure |
| >pdb|1N5O|X Chain X, Structural Consequences Of A Cancer-Causing Brca1-Brct Missense Mutation Length = 214 | Back alignment and structure |
| >pdb|1L0B|A Chain A, Crystal Structure Of Rat Brca1 Tandem-Brct Region Length = 229 | Back alignment and structure |
| >pdb|1T2U|A Chain A, Structural Basis Of Phosphopeptide Recognition By The Brct Domain Of Brca1: Structure Of Brca1 Missense Variant V1809f Length = 214 | Back alignment and structure |
| >pdb|1JNX|X Chain X, Crystal Structure Of The Brct Repeat Region From The Breast Cancer Associated Protein, Brca1 Length = 214 | Back alignment and structure |
| >pdb|3PXE|A Chain A, Impact Of Brca1 Brct Domain Missense Substitutions On Phospho-Peptide Recognition: E1836k Length = 214 | Back alignment and structure |
| >pdb|3PXD|A Chain A, Impact Of Brca1 Brct Domain Missense Substitutions On Phospho-Peptide Recognition: R1835p Length = 214 | Back alignment and structure |
| >pdb|3K15|A Chain A, Crystal Structure Of Brca1 Brct D1840t In Complex With A Minimal Recognition Tetrapeptide With An Amidated C-Terminus Length = 215 | Back alignment and structure |
| >pdb|3K0H|A Chain A, The Crystal Structure Of Brca1 Brct In Complex With A Minimal Recognition Tetrapeptide With An Amidated C-terminus Length = 215 | Back alignment and structure |
| >pdb|3PXA|A Chain A, Impact Of Brca1 Brct Domain Missense Substitutions On Phospho-Peptide Recognition: G1656d Length = 214 | Back alignment and structure |
| >pdb|3COJ|X Chain X, Crystal Structure Of The Brct Domains Of Human Brca1 In Complex With A Phosphorylated Peptide From Human Acetyl-Coa Carboxylase 1 Length = 235 | Back alignment and structure |
| >pdb|3PXC|X Chain X, Impact Of Brca1 Brct Domain Missense Substitutions On Phospho-Peptide Recognition: R1699q Length = 214 | Back alignment and structure |
| >pdb|3PXB|A Chain A, Impact Of Brca1 Brct Domain Missense Substitutions On Phospho-Peptide Recognition: T1700a Length = 214 | Back alignment and structure |
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85 | Back alignment and structure |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
| >pdb|2EGP|A Chain A, Solution Structure Of The Ring-Finger Domain From Human Tripartite Motif Protein 34 Length = 79 | Back alignment and structure |
| >pdb|3SHT|A Chain A, Crystal Structure Of Human Mcph1 Tandem Brct Domains Length = 206 | Back alignment and structure |
| >pdb|3SZM|A Chain A, Structure Of Human Microcephalin (Mcph1) Tandem Brct Domains In Complex With A Gamma-H2ax Phosphopeptide Length = 199 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
Score = 128 bits (322), Expect = 5e-34
Identities = 58/203 (28%), Positives = 83/203 (40%), Gaps = 15/203 (7%)
Query: 489 VFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNG 548
V GS LS E++ +L ++ + VTHV+ DA TLK ++ ILNG
Sbjct: 4 VLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDA---VQSTLKCMLGILNG 60
Query: 549 NWVLKIDWIKACMEAMNPVGEEPYEINLDNHGCEEGPKTGRLRALNKAPKLFDGLSFYFS 608
W+LK +W+KAC+ EE YEI EGP+ RL PKLFDG FY
Sbjct: 61 CWILKFEWVKACLRRKVCEQEEKYEIP-------EGPRRSRLNREQLLPKLFDGCYFYLW 113
Query: 609 GNFMLGYKEDLQSLVITAGGTIWKSEGELLAQCRNDETAPSKVLVVYNLDFPEGSLIGEE 668
G F K++L LV GG I + + + + + V Y+ +
Sbjct: 114 GTFKHHPKDNLIKLVTAGGGQILSRKPKP-----DSDVTQTINTVAYHARPDSDQRFCTQ 168
Query: 669 VSTIWNRLNEAEELASKIGCRVI 691
+ N E +
Sbjct: 169 YIIYEDLCNYHPERVRQGKVWKA 191
|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Length = 209 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Length = 259 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Length = 325 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Length = 133 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Length = 264 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 691 | |||
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.95 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.95 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.95 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.93 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.93 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.92 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.89 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.88 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.78 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.68 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.57 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.57 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.5 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.5 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.46 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.43 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.37 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.35 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.35 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.34 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.33 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.33 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.33 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.32 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.32 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.3 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.3 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.29 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.27 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.25 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.22 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.22 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.21 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.19 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.19 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 99.18 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.18 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.17 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.17 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.16 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.12 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.12 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.11 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 99.09 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.08 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.07 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.06 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.06 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.03 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 99.02 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.01 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.99 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.98 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.98 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.96 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.95 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.94 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.92 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.92 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.91 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.9 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 98.89 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.89 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.88 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.87 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.87 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.87 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.84 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.84 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.83 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.76 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.73 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.7 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.7 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 98.68 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.66 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.66 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.64 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.62 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.62 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.6 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.54 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.5 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 98.44 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.39 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.39 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 98.37 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.36 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.28 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.28 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.27 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.23 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.21 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.19 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.18 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 98.16 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.15 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 98.15 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 97.99 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 97.97 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 97.84 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.84 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 97.75 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 97.68 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 97.6 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 97.57 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.5 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 97.22 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 97.21 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 96.99 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 96.21 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.1 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 96.04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 95.95 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 95.89 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 95.78 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 95.54 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 95.31 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 95.08 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 95.02 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 94.93 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 94.89 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 94.79 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 94.6 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 94.6 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 94.51 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 94.33 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 94.23 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 94.09 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 93.92 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 93.81 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 93.78 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 93.56 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 93.38 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 93.06 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 92.86 | |
| 1fre_A | 42 | Nuclear factor XNF7; zinc-binding protein, BBOX, d | 92.84 | |
| 2d8u_A | 64 | Ubiquitin ligase TRIM63; tripartite motif-containi | 92.43 | |
| 2dja_A | 84 | Midline-2; tripartite motif protein 1, ZF-B_BOX, s | 91.68 | |
| 2did_A | 53 | Tripartite motif protein 39; ZF-B-box domian, Zn b | 91.49 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 90.42 | |
| 2yrg_A | 59 | Tripartite motif-containing protein 5; B-box domai | 90.08 | |
| 3ddt_A | 48 | E3 ubiquitin-protein ligase TRIM63; zinc-binding m | 89.55 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 88.75 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 87.47 | |
| 2egm_A | 57 | Tripartite motif-containing protein 41; ZF-B_BOX d | 85.08 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 84.85 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 84.6 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 84.23 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 83.99 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 83.73 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 83.71 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 83.67 | |
| 2csv_A | 72 | Tripartite motif protein 29; ZF-B_BOX domain, TRIM | 83.65 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 83.24 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 82.56 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 81.45 | |
| 2yvr_A | 50 | Transcription intermediary factor 1-beta; ZF-B_BOX | 81.4 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 81.32 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 80.86 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 80.74 |
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
Probab=99.95 E-value=6.4e-28 Score=244.99 Aligned_cols=151 Identities=25% Similarity=0.456 Sum_probs=134.2
Q ss_pred CCCccEEEEEcCCCHHHHHHHHHHHhhcCccEeeccCCCceEEEecCCCCCcccchHHHHHHHHcCCeEeehhHHHHHHH
Q 038256 483 NKAKEWVFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNGNWVLKIDWIKACME 562 (691)
Q Consensus 483 ~~~~~~vi~~Sgls~~ek~~l~~~~~~lG~~v~~~~~~~vTHlI~~~~~~~~~~RT~K~L~Aia~G~wIVs~~Wl~~c~~ 562 (691)
...++++|++|||++++++.|.++++.+||.+..+|++.|||||+.+++++.++||+||+.|++.|+|||+++||.+|++
T Consensus 3 ~~~~~~~i~~sg~~~~~~~~l~~~~~~~G~~~~~~~~~~~THlI~~~~~~~~~~rt~K~~~a~~~g~~IV~~~Wl~~~~~ 82 (229)
T 1l0b_A 3 RAERDISMVVSGLTPKEVMIVQKFAEKYRLALTDVITEETTHVIIKTDAEFVCERTLKYFLGIAGGKWIVSYSWVIKSIQ 82 (229)
T ss_dssp CCCCCCEEEEESCCHHHHHHHHHHHHHTTCEECSSCCSSCCEEEECBCTTSEECCCHHHHHHHHTTCEEEETHHHHHHHT
T ss_pred CCCCCeEEEEcCCCHHHHHHHHHHHHHcCCEEeCCcCCCCCEEEEcCCccccccccHHHHHHHHCCCcEecHHHHHHHHH
Confidence 34578999999999999999999999999999999999999999999877777999999999999999999999999999
Q ss_pred hCCCCCCCCcccccCCCCC--CCCchhhhhhhhccCCCCCCCceEEEecCcCcccHHHHHHHHHhCCCEEEecCchh
Q 038256 563 AMNPVGEEPYEINLDNHGC--EEGPKTGRLRALNKAPKLFDGLSFYFSGNFMLGYKEDLQSLVITAGGTIWKSEGEL 637 (691)
Q Consensus 563 ~g~~vdEe~yei~~d~~~~--~~gp~~~R~~~~~~~~~LF~G~~f~l~g~~~~~~k~~L~~LI~~~GG~Vl~~~~~~ 637 (691)
+|+++||++|++.++.... ..+|+++|... .+||.|+.|||+|.+..+.++.|++||+++||+|+...+..
T Consensus 83 ~~~~~~e~~y~~~~~~~~~~~~~~~~~~r~~~----~~lF~g~~~~~~~~~~~~~~~~l~~li~~~GG~v~~~~~~~ 155 (229)
T 1l0b_A 83 ERKLLSVHEFEVKGDVVTGSNHQGPRRSRESQ----EKLFEGLQIYCCEPFTNMPKDELERMLQLCGASVVKELPLL 155 (229)
T ss_dssp TTSCCCSGGGBCCEETTTCSSSCHHHHHHHHC------CCTTCEEEECSCCSSSCHHHHHHHHHHTTCEEECSSSCG
T ss_pred CCCcCChHHeEeccccccccccccchhhhhhh----hhhhcCceEEEEecCCCCCHHHHHHHHHHCCCEEeCCcccc
Confidence 9999999999998765432 35677777643 57999999999998888888999999999999999998765
|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A | Back alignment and structure |
|---|
| >2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2egm_A Tripartite motif-containing protein 41; ZF-B_BOX domain, tripartite motif protein 41, TRIM41, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 691 | ||||
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 4e-23 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-12 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 7e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-08 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-07 | |
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 4e-07 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 4e-07 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 9e-07 | |
| d1kzyc1 | 153 | c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) | 2e-06 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 5e-06 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 3e-05 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 5e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-04 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 2e-04 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 2e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 2e-04 |
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: BRCT domain superfamily: BRCT domain family: BRCT domain domain: Breast cancer associated protein, BRCA1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 92.5 bits (229), Expect = 4e-23
Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
Query: 489 VFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNG 548
S L+ EE +L+ +F + ++ THV+ TDA+ C RTLK + I G
Sbjct: 3 SMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGG 62
Query: 549 NWVLKIDWIKACMEAMNPVGEEPYEINLDNHGC--EEGPKTGRL 590
WV+ W+ ++ + E +E+ D +GPK R
Sbjct: 63 KWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARE 106
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 691 | |||
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.88 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.54 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.42 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.39 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.38 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.37 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.33 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.24 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.14 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.01 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 98.99 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.92 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.73 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.73 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.72 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.58 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 98.5 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 98.15 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.05 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.99 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.87 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 97.79 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 97.74 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.21 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 96.92 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 96.13 | |
| d1frea_ | 39 | Nuclear factor XNF7 {African clawed frog (Xenopus | 95.7 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 95.54 | |
| d2dida1 | 40 | Tripartite motif-containing protein 39 {Human (Hom | 95.43 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 95.11 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 94.43 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 92.12 | |
| d2d8ua1 | 51 | Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax | 91.13 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 90.67 | |
| d2csva1 | 59 | Tripartite motif-containing protein 29 {Human (Hom | 90.39 | |
| d2dq5a1 | 47 | Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | 90.01 | |
| d2djaa1 | 71 | Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | 89.01 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 82.06 |
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: BRCT domain superfamily: BRCT domain family: BRCT domain domain: Breast cancer associated protein, BRCA1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=4e-23 Score=184.37 Aligned_cols=106 Identities=27% Similarity=0.481 Sum_probs=98.1
Q ss_pred cEEEEEcCCCHHHHHHHHHHHhhcCccEeeccCCCceEEEecCCCCCcccchHHHHHHHHcCCeEeehhHHHHHHHhCCC
Q 038256 487 EWVFCGSALSVEEKLLLVRFGNMIGVPVSKFWKPNVTHVIAATDAKGSCTRTLKVLMAILNGNWVLKIDWIKACMEAMNP 566 (691)
Q Consensus 487 ~~vi~~Sgls~~ek~~l~~~~~~lG~~v~~~~~~~vTHlI~~~~~~~~~~RT~K~L~Aia~G~wIVs~~Wl~~c~~~g~~ 566 (691)
+++|+.|||++++++.|.++++.+||++.++|+++|||||+.++.++.+.||+|||.|++.|+|||+++||.+|++++++
T Consensus 1 ~~~i~~SGl~~~e~~~l~~~i~~~Gg~~~~~~~~~~THlI~~~~~~~~~~rt~K~l~a~~~g~~IV~~~Wl~~c~~~~~~ 80 (109)
T d1t15a1 1 RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKM 80 (109)
T ss_dssp CCEEEEESCCHHHHHHHHHHHHHHTCEECSSCCTTCCEEEECBCTTSEECCBHHHHHHHHTTCEEEETHHHHHHHHTTSC
T ss_pred CEEEEECCCCHHHHHHHHHHHHHcCCEEEeEecCCccEEEEecCcchhhHhhHHHHHHHHCCCccccHHHHHHHHHhCCc
Confidence 46899999999999999999999999999999999999999988888889999999999999999999999999999999
Q ss_pred CCCCCcccccCCCC--CCCCchhhhhhh
Q 038256 567 VGEEPYEINLDNHG--CEEGPKTGRLRA 592 (691)
Q Consensus 567 vdEe~yei~~d~~~--~~~gp~~~R~~~ 592 (691)
+||++|++.+|..+ ...||+++|+++
T Consensus 81 l~e~~y~v~~~~~~~~~~~gp~r~R~~~ 108 (109)
T d1t15a1 81 LNEHDFEVRGDVVNGRNHQGPKRARESQ 108 (109)
T ss_dssp CCGGGGBCCEETTTBTTCCHHHHHHTCT
T ss_pred CCchheEEecccCCCcCcccchHHHhcc
Confidence 99999999887654 345899999754
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|