Score = 120 (47.3 bits), Expect = 1.4e-07, P = 1.4e-07
Identities = 31/100 (31%), Positives = 46/100 (46%)
Query: 1 MHQSLVFLCLLAAIFFHHSRGDVGTAARYGPPFLPTACNGNDQSQFPSGNLFAAAGEGIW 60
M +S+VF + F S G A Y + P C Q G + AAA + +W
Sbjct: 1 MSKSIVFFSTVLVFLFSFSYATPGIATFY-TSYTP--CYRGTQE----GVMIAAASDTLW 53
Query: 61 DNGASCGRQYKLRCISA--AVSGTCINNTIQIKIVDRAQS 98
DNG CG+ + ++C AV C ++++KIVD S
Sbjct: 54 DNGRVCGKMFTVKCSGPRNAVPHPCTGKSVKVKIVDHCPS 93
Score = 92 (37.4 bits), Expect = 0.00050, P = 0.00050
Identities = 31/93 (33%), Positives = 43/93 (46%)
Query: 1 MHQSLVFLCLLAAIF-----FHHSRGDVGTAARYGPP----FLPTACNGNDQSQFPSGNL 51
M +SL L +LAA+F F S G A YG + AC D G +
Sbjct: 1 MSKSLAGLAVLAALFIAVDAFRPSGLTNGHATFYGGSDASGTMGGACGYGDLYSAGYGTM 60
Query: 52 FAAAGEGIWDNGASCGRQYKLRCISAAVSGTCI 84
AA ++++GASCG Y++ C AA S C+
Sbjct: 61 TAALSTALFNDGASCGECYRITCDHAADSRWCL 93
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.322 0.135 0.425 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 110 110 0.00091 102 3 11 22 0.41 30
29 0.42 32
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 3
No. of states in DFA: 561 (60 KB)
Total size of DFA: 125 KB (2080 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 10.91u 0.14s 11.05t Elapsed: 00:00:00
Total cpu time: 10.91u 0.14s 11.05t Elapsed: 00:00:00
Start: Sat May 11 03:26:07 2013 End: Sat May 11 03:26:07 2013
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. Length = 77
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
>PF03330 DPBB_1: Rare lipoprotein A (RlpA)-like double-psi beta-barrel; InterPro: IPR009009 Beta barrels are commonly observed in protein structures
They are classified in terms of two integral parameters: the number of strands in the sheet, n, and the shear number, S, a measure of the stagger of the strands in the beta-sheet. These two parameters have been shown to determine the major geometrical features of beta-barrels. Six-stranded beta-barrels with a pseudo-twofold axis are found in several proteins. One involving parallel strands forming two psi structures is known as the double-psi barrel. The first psi structure consists of the loop connecting strands beta1 and beta2 (a 'psi loop') and the strand beta5, whereas the second psi structure consists of the loop connecting strands beta4 and beta5 and the strand beta2. All the psi structures in double-psi barrels have a unique handedness, in that beta1 (beta4), beta2 (beta5) and the loop following beta5 (beta2) form a right-handed helix. The unique handedness may be related to the fact that the twisting angle between the parallel pair of strands is always larger than that between the antiparallel pair [].; PDB: 1N10_B 3D30_A 2BH0_A 2HCZ_X.
>PF00967 Barwin: Barwin family; InterPro: IPR001153 Barwin is a basic protein isolated from aqueous extracts of barley seeds
It is 125 amino acids in length, and contains six cysteine residues that combine to form three disulphide bridges [, ]. Comparative analysis shows the sequence to be highly similar to a 122 amino acid stretch in the C-terminal of the products of two wound-induced genes (win1 and win2) from potato, the product of the hevein gene of rubber trees, and pathogenesis-related protein 4 from tobacco. The high levels of similarity to these proteins, and their ability to bind saccharides, suggest that the barwin domain may be involved in a common defence mechanism in plants.; GO: 0042742 defense response to bacterium, 0050832 defense response to fungus; PDB: 1BW3_A 1BW4_A.
This is a family of prokaryotic proteins with unknown function. Lipoprotein annotation based on the presence of consensus lipoprotein signal sequence. Included in this family is the E. coli putative lipoprotein rlpA.
>PF07249 Cerato-platanin: Cerato-platanin; InterPro: IPR010829 Cerato-platanin (CP) is the first member of the cerato-platanin family
It is produced by the Ascomycete Ceratocystis fimbriata f. sp. platani and causes the severe plant disease: canker stain. This protein occurs in the cell wall of the fungus and is involved in the host-plane interaction and induces both cell necrosis and phytoalexin synthesis which is one of the first plant defense-related events. CP, like other fungal surface proteins, is able to self assemble in vitro []. CP is a 120 amino acid protein, containing 40% hydrophobic residues and two S-S bridges. It contains four cysteine residues that form two disulphide bonds []. The N-terminal region of CP is very similar to cerato-ulmin, a phytotoxic protein produced by the Ophiostoma species belonging to the hydrophobin family, which also self-assembles []. This entry also includes other precursor proteins.; PDB: 2KQA_A 3M3G_A.
>2hcz_X Beta-expansin 1A; domain 1 is A beta barrel and domain 2 is A immunoglobulin L sandwich, allergen; HET: NAG MAN FCA; 2.75A {Zea mays} Length = 245
