Citrus Sinensis ID: 038606

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660------
MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
cHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHc
cHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHcc
MASILSRARRIAPLRVLAQDVvksrcfmspgaLGFLIRCLGSVGLVEEANMLFDQVKreglcvpnnysyNCLLEALCKSCSVDLVEMRLKEMQDygwgydkytltpllqvycnsgqfdKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMtksgfasdaAMYDVIIGGLCKNKQLEMALQLYSEMkgsgitpdFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMikgepiadVGVEMLMIFKgtvspntssfDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEesgfkpthftlNSMFRCLCRRQDVVGALNLVRKMRvqghepwvkHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDIcahgccpdvVAYNIIISGLCKAQRVAEAEDLFNEMitkglipsvATYNLLINGWCKSGNIDQAMLCLSRMlekesgspdvityTTLIDglciagrpdDAIMLWNEmeekgcapnrITFMALITGlckcdrprAALVHFRMMkekgmkpdMFVFVALISAFLSELNPPLAFEVLKEM
masilsrarriaplrvlaqdvvksrCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRvqghepwvkhNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCnsnrleesyellremeesGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
********RRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFE*****
MASILS*ARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query666 2.2.26 [Sep-21-2011]
P0C8Q6832 Putative pentatricopeptid yes no 0.996 0.798 0.542 0.0
Q9FIT7 974 Pentatricopeptide repeat- no no 0.918 0.628 0.288 1e-65
Q9SXD1630 Pentatricopeptide repeat- no no 0.795 0.841 0.290 2e-64
Q9CAN0630 Pentatricopeptide repeat- no no 0.785 0.830 0.273 3e-64
Q9LFF1754 Pentatricopeptide repeat- no no 0.884 0.781 0.278 1e-62
Q9CAN5614 Pentatricopeptide repeat- no no 0.822 0.892 0.290 3e-62
Q9FMF6730 Pentatricopeptide repeat- no no 0.807 0.736 0.267 3e-62
Q9CAN6590 Pentatricopeptide repeat- no no 0.752 0.849 0.282 4e-62
Q9LQ14629 Pentatricopeptide repeat- no no 0.728 0.771 0.287 1e-61
Q6NQ83619 Pentatricopeptide repeat- no no 0.780 0.840 0.276 3e-60
>sp|P0C8Q6|PP368_ARATH Putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial OS=Arabidopsis thaliana GN=At5g08310 PE=3 SV=1 Back     alignment and function desciption
 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/671 (54%), Positives = 499/671 (74%), Gaps = 7/671 (1%)

Query: 1   MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREG 60
           MASILSRAR+ A L+ L  DV+ SRCFMSPGA GF IRCLG+ GLV+EA+ +FD+V+  G
Sbjct: 112 MASILSRARQNASLKALVVDVLNSRCFMSPGAFGFFIRCLGNAGLVDEASSVFDRVREMG 171

Query: 61  LCVPNNYSYNCLLEALCKS--CSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFD 118
           LCVPN Y+YNCLLEA+ KS   SV+LVE RLKEM+D G+ +DK+TLTP+LQVYCN+G+ +
Sbjct: 172 LCVPNAYTYNCLLEAISKSNSSSVELVEARLKEMRDCGFHFDKFTLTPVLQVYCNTGKSE 231

Query: 119 KALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIH 178
           +ALSVFNEI+  GW+DEH+ +IL+V+F KWG+VDKA ELIE +++ +IRLN KT+CVLIH
Sbjct: 232 RALSVFNEILSRGWLDEHISTILVVSFCKWGQVDKAFELIEMLEERDIRLNYKTYCVLIH 291

Query: 179 GFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITP 238
           GFVK+SR+DKA QLF+KM + G  +D A+YDV+IGGLCK+K LEMAL LY E+K SGI P
Sbjct: 292 GFVKESRIDKAFQLFEKMRRMGMNADIALYDVLIGGLCKHKDLEMALSLYLEIKRSGIPP 351

Query: 239 DFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQA 298
           D  IL KL+ S S+E EL+ + + I  D D  ++ LL  S+    + N  + +AY+ +Q 
Sbjct: 352 DRGILGKLLCSFSEESELSRITEVIIGDIDKKSVMLLYKSLFEGFIRNDLVHEAYSFIQN 411

Query: 299 MI---KGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGC 355
           ++   + + ++++ V++L      + P++ S  I+IN L+K  K+D+A++L  ++ Q G 
Sbjct: 412 LMGNYESDGVSEI-VKLLKDHNKAILPDSDSLSIVINCLVKANKVDMAVTLLHDIVQNGL 470

Query: 356 MQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALN 415
           +    +YNN+I+G+C   R EES +LL EM+++G +P+ FTLN ++ CL  R D VGAL+
Sbjct: 471 IPGPMMYNNIIEGMCKEGRSEESLKLLGEMKDAGVEPSQFTLNCIYGCLAERCDFVGALD 530

Query: 416 LVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLI 475
           L++KMR  G EPW+KH T L+K+LC++G+A++A ++L D+  EGFL  +V  +AAI GLI
Sbjct: 531 LLKKMRFYGFEPWIKHTTFLVKKLCENGRAVDACKYLDDVAGEGFLGHMVASTAAIDGLI 590

Query: 476 DIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVA 535
             + VD  LELFRDICA+G CPDV+AY+++I  LCKA R  EA+ LFNEM++KGL P+VA
Sbjct: 591 KNEGVDRGLELFRDICANGHCPDVIAYHVLIKALCKACRTMEADILFNEMVSKGLKPTVA 650

Query: 536 TYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNE 595
           TYN +I+GWCK G ID+ + C+ RM E E  +PDVITYT+LI GLC +GRP +AI  WNE
Sbjct: 651 TYNSMIDGWCKEGEIDRGLSCIVRMYEDEK-NPDVITYTSLIHGLCASGRPSEAIFRWNE 709

Query: 596 MEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELN 655
           M+ K C PNRITFMALI GLCKC     ALV+FR M+EK M+PD  V+++L+S+FLS  N
Sbjct: 710 MKGKDCYPNRITFMALIQGLCKCGWSGEALVYFREMEEKEMEPDSAVYLSLVSSFLSSEN 769

Query: 656 PPLAFEVLKEM 666
               F + +EM
Sbjct: 770 INAGFGIFREM 780

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=1 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
225465635 854 PREDICTED: putative pentatricopeptide re 0.996 0.777 0.659 0.0
224083888726 predicted protein [Populus trichocarpa] 0.998 0.915 0.642 0.0
147797511 814 hypothetical protein VITISV_010168 [Viti 0.936 0.766 0.611 0.0
449449102 849 PREDICTED: putative pentatricopeptide re 0.995 0.780 0.577 0.0
356574119 942 PREDICTED: putative pentatricopeptide re 0.998 0.705 0.565 0.0
357444861 1430 Pentatricopeptide repeat protein-like pr 0.998 0.465 0.543 0.0
255586858634 pentatricopeptide repeat-containing prot 0.858 0.902 0.613 0.0
10178273 1280 putative protein [Arabidopsis thaliana] 0.996 0.518 0.542 0.0
297810935 1281 predicted protein [Arabidopsis lyrata su 0.996 0.518 0.542 0.0
334187522 832 pentatricopeptide repeat-containing prot 0.996 0.798 0.542 0.0
>gi|225465635|ref|XP_002270253.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Vitis vinifera] gi|296085293|emb|CBI29025.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/666 (65%), Positives = 522/666 (78%), Gaps = 2/666 (0%)

Query: 1   MASILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREG 60
           MAS LS AR+ APL +L+ D+V SRC MSPGALGF IRCLGS GLVEEAN+LFDQVK   
Sbjct: 134 MASCLSHARQNAPLSLLSMDIVNSRCAMSPGALGFFIRCLGSTGLVEEANLLFDQVKMMR 193

Query: 61  LCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKA 120
           LCVPN+YS+NCLLEA+ KS S+DLVEMRLKEM D GW  DKYTLT +LQ YCNS +FDKA
Sbjct: 194 LCVPNSYSFNCLLEAISKSGSIDLVEMRLKEMCDSGWEPDKYTLTSVLQAYCNSRKFDKA 253

Query: 121 LSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGF 180
           LSVFNEI   GWVD HV SIL++ FSK GEVDKA ELIERM+D  IRLNEKTFCVLIHGF
Sbjct: 254 LSVFNEIYGRGWVDGHVLSILVLTFSKCGEVDKAFELIERMEDLGIRLNEKTFCVLIHGF 313

Query: 181 VKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDF 240
           V++SRVDKALQLF KM KSGFA D ++YD +IGGLC  K++E AL L SEMK  GI PD 
Sbjct: 314 VRQSRVDKALQLFKKMQKSGFAPDVSVYDALIGGLCAKKEIEKALHLLSEMKELGIDPDI 373

Query: 241 EILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMI 300
           +ILSKLI  CS+E ++  L++E  ED D   M LL NS++  LV+  S+D+AY LL+AM 
Sbjct: 374 QILSKLIAYCSEEVDIYRLIEERLEDLDTEAMLLLYNSVLNGLVNGKSVDKAYYLLRAMT 433

Query: 301 KGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVF 360
                 +  V    + K  V P+T+SF I+I+ L   GKLDLALSLFR+M ++GC QNV 
Sbjct: 434 GDNYTDNFEVNKFFMVKEMVRPDTTSFSIVIDGLCNTGKLDLALSLFRDMVRVGCKQNVL 493

Query: 361 LYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKM 420
           LYNNLID L NSNRLEE Y LL+EM+ SGF+PT FT NS+F CLCRR+DV GAL++VR+M
Sbjct: 494 LYNNLIDKLSNSNRLEECYLLLKEMKGSGFRPTQFTHNSIFGCLCRREDVTGALDMVREM 553

Query: 421 RVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRV 480
           RV GHEPW+KH TLL+K+LCK  ++ EA  FL +MV+EGFLPDIV YSAAI G + IK V
Sbjct: 554 RVHGHEPWIKHYTLLVKQLCKRKRSAEACNFLAEMVREGFLPDIVAYSAAIDGFVKIKAV 613

Query: 481 DLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLIPSVATYNLL 540
           D ALE+FRDICA G CPDVVAYN +I+G CK +RV+EA D+ +EM+ KGL+PSV TYNLL
Sbjct: 614 DQALEIFRDICARGYCPDVVAYNTLINGFCKVKRVSEAHDILDEMVAKGLVPSVVTYNLL 673

Query: 541 INGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKG 600
           I+GWCK+G+IDQA  CLSRM+ KE   P+VITYTTLIDGLC AGRPDDAI LWNEM  KG
Sbjct: 674 IDGWCKNGDIDQAFHCLSRMVGKER-EPNVITYTTLIDGLCNAGRPDDAIHLWNEMRGKG 732

Query: 601 CAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAF 660
           C+PNRI+F+ALI GLCKC  P AAL++FR M E+   PD  V+VALI++F+S  NP LAF
Sbjct: 733 CSPNRISFIALIHGLCKCGWPDAALLYFREMGERET-PDTIVYVALITSFISNKNPTLAF 791

Query: 661 EVLKEM 666
           E+LKEM
Sbjct: 792 EILKEM 797

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083888|ref|XP_002307160.1| predicted protein [Populus trichocarpa] gi|222856609|gb|EEE94156.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147797511|emb|CAN71434.1| hypothetical protein VITISV_010168 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449102|ref|XP_004142304.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like [Cucumis sativus] gi|449510601|ref|XP_004163711.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356574119|ref|XP_003555199.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357444861|ref|XP_003592708.1| Pentatricopeptide repeat protein-like protein [Medicago truncatula] gi|355481756|gb|AES62959.1| Pentatricopeptide repeat protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255586858|ref|XP_002534039.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525946|gb|EEF28343.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|10178273|emb|CAC08331.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810935|ref|XP_002873351.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297319188|gb|EFH49610.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334187522|ref|NP_196448.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635617|sp|P0C8Q6.1|PP368_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial; Flags: Precursor gi|332003898|gb|AED91281.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
TAIR|locus:2174008 974 AT5G61990 "AT5G61990" [Arabido 0.966 0.661 0.279 5.2e-56
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.932 0.823 0.262 1.4e-55
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.801 0.869 0.274 9.9e-55
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.803 0.849 0.276 1.3e-54
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.807 0.853 0.267 5.5e-54
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.726 0.769 0.278 6.3e-53
TAIR|locus:2015218590 AT1G63070 [Arabidopsis thalian 0.714 0.806 0.283 2.1e-52
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.819 0.882 0.287 3.5e-52
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.800 0.836 0.289 5.6e-52
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.692 0.798 0.270 3.1e-51
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 584 (210.6 bits), Expect = 5.2e-56, P = 5.2e-56
 Identities = 194/695 (27%), Positives = 308/695 (44%)

Query:     3 SILSRA-RRIAPLRVLAQDVVK-SRCFMSPGALGFLIRCL--GSV--GLVEEANMLFDQV 56
             S++ R   R  P+  +   +V+ S+ F+     G L   L  G +  G +EEA  +F   
Sbjct:   118 SVVERMIERNWPVAEVWSSIVRCSQEFVGKSDDGVLFGILFDGYIAKGYIEEAVFVFSSS 177

Query:    57 KREGL-CVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSG 115
                GL  VP       LL+AL +   +DL     K M +    +D  T   L+  +C +G
Sbjct:   178 M--GLELVPRLSRCKVLLDALLRWNRLDLFWDVYKGMVERNVVFDVKTYHMLIIAHCRAG 235

Query:   116 --------------QF-------DKALSVFNEIIDHGWVD-EHVFSILLVAFSKWGEVDK 153
                           +F       D AL +   +I  G V  ++ + +L+    K   ++ 
Sbjct:   236 NVQLGKDVLFKTEKEFRTATLNVDGALKLKESMICKGLVPLKYTYDVLIDGLCKIKRLED 295

Query:   154 ACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIG 213
             A  L+  MD   + L+  T+ +LI G +K    D A  L  +M   G      MYD  I 
Sbjct:   296 AKSLLVEMDSLGVSLDNHTYSLLIDGLLKGRNADAAKGLVHEMVSHGINIKPYMYDCCIC 355

Query:   214 GLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWE--DRDVNT 271
              + K   +E A  L+  M  SG+ P  +  + LI     E  +    + + E   R++  
Sbjct:   356 VMSKEGVMEKAKALFDGMIASGLIPQAQAYASLIEGYCREKNVRQGYELLVEMKKRNIVI 415

Query:   272 MTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIII 331
                   ++++ + S+G +D AYN+++ MI        G            PN   +  +I
Sbjct:   416 SPYTYGTVVKGMCSSGDLDGAYNIVKEMIAS------GCR----------PNVVIYTTLI 459

Query:   332 NTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCXXXXXXXXXXXXXXXXXXGFK 391
              T L++ +   A+ + +EM + G   ++F YN+LI GL                   G K
Sbjct:   460 KTFLQNSRFGDAMRVLKEMKEQGIAPDIFCYNSLIIGLSKAKRMDEARSFLVEMVENGLK 519

Query:   392 PTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRF 451
             P  FT  +         +   A   V++MR  G  P     T LI E CK GK +EA   
Sbjct:   520 PNAFTYGAFISGYIEASEFASADKYVKEMRECGVLPNKVLCTGLINEYCKKGKVIEACSA 579

Query:   452 LTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCK 511
                MV +G L D   Y+  + GL    +VD A E+FR++   G  PDV +Y ++I+G  K
Sbjct:   580 YRSMVDQGILGDAKTYTVLMNGLFKNDKVDDAEEIFREMRGKGIAPDVFSYGVLINGFSK 639

Query:   512 AQRVAEAEDLFNEMITKGLIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVI 571
                + +A  +F+EM+ +GL P+V  YN+L+ G+C+SG I++A   L  M  K    P+ +
Sbjct:   640 LGNMQKASSIFDEMVEEGLTPNVIIYNMLLGGFCRSGEIEKAKELLDEMSVKGL-HPNAV 698

Query:   572 TYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMM 631
             TY T+IDG C +G   +A  L++EM+ KG  P+   +  L+ G C+ +    A+  F   
Sbjct:   699 TYCTIIDGYCKSGDLAEAFRLFDEMKLKGLVPDSFVYTTLVDGCCRLNDVERAITIFGTN 758

Query:   632 KEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM 666
             K KG       F ALI+         L  EVL  +
Sbjct:   759 K-KGCASSTAPFNALINWVFKFGKTELKTEVLNRL 792
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015218 AT1G63070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C8Q6PP368_ARATHNo assigned EC number0.54240.99690.7980yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-21
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-21
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-20
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-18
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-15
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-13
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-12
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-10
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-07
pfam0153531 pfam01535, PPR, PPR repeat 5e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 6e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 8e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information 
 Score = 98.8 bits (246), Expect = 3e-21
 Identities = 90/414 (21%), Positives = 168/414 (40%), Gaps = 53/414 (12%)

Query: 103 TLTPLLQVYCNSGQFDKALSVFNEIIDHGW-VDEHVFSILLVAFSKWGEVDKACELIERM 161
           T   L+ V  +S   D AL V   + + G   D  +++ L+   +K G+VD   E+   M
Sbjct: 439 TFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEM 498

Query: 162 DDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQL 221
            +  +  N  TF  LI G  +  +V KA   +  M       D  +++ +I    ++  +
Sbjct: 499 VNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAV 558

Query: 222 EMALQLYSEMKGSG--ITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSI 279
           + A  + +EMK     I PD   +  L+ +C++ G++         DR      ++    
Sbjct: 559 DRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQV---------DRAKEVYQMI---- 605

Query: 280 MRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGK 339
                        YN     IKG P                      + I +N+  + G 
Sbjct: 606 -----------HEYN-----IKGTP--------------------EVYTIAVNSCSQKGD 629

Query: 340 LDLALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNS 399
            D ALS++ +M + G   +   ++ L+D   ++  L++++E+L++  + G K    + +S
Sbjct: 630 WDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSS 689

Query: 400 MFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEG 459
           +       ++   AL L   ++     P V     LI  LC+  +  +A   L++M + G
Sbjct: 690 LMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLG 749

Query: 460 FLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQ 513
             P+ + YS  +         D+ L+L       G  P++V    I  GLC  +
Sbjct: 750 LCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCIT-GLCLRR 802

Length = 1060
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 666
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.95
KOG2076895 consensus RNA polymerase III transcription factor 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.92
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG2076895 consensus RNA polymerase III transcription factor 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.9
PRK14574 822 hmsH outer membrane protein; Provisional 99.89
KOG1915677 consensus Cell cycle control protein (crooked neck 99.84
KOG2003840 consensus TPR repeat-containing protein [General f 99.84
KOG2003 840 consensus TPR repeat-containing protein [General f 99.83
KOG1915677 consensus Cell cycle control protein (crooked neck 99.83
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
KOG1126638 consensus DNA-binding cell division cycle control 99.73
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.73
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.71
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
KOG0547606 consensus Translocase of outer mitochondrial membr 99.69
KOG1126638 consensus DNA-binding cell division cycle control 99.69
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.68
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.68
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.66
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.64
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.63
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.63
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.62
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.61
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.61
PRK12370553 invasion protein regulator; Provisional 99.61
PRK12370553 invasion protein regulator; Provisional 99.59
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.59
KOG2376652 consensus Signal recognition particle, subunit Srp 99.58
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.56
KOG1129478 consensus TPR repeat-containing protein [General f 99.55
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.55
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.52
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.51
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.51
KOG2376652 consensus Signal recognition particle, subunit Srp 99.5
KOG1129478 consensus TPR repeat-containing protein [General f 99.5
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.49
PRK11189296 lipoprotein NlpI; Provisional 99.47
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.47
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.45
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.43
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.43
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.4
PRK11189296 lipoprotein NlpI; Provisional 99.4
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.38
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.36
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.33
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.33
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.33
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.33
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.32
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.32
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.31
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.31
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.31
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.3
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.29
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.26
KOG1125579 consensus TPR repeat-containing protein [General f 99.22
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.19
KOG1125579 consensus TPR repeat-containing protein [General f 99.16
PF1304150 PPR_2: PPR repeat family 99.15
PRK10370198 formate-dependent nitrite reductase complex subuni 99.13
PF1304150 PPR_2: PPR repeat family 99.12
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.08
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.08
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.05
PRK15359144 type III secretion system chaperone protein SscB; 99.04
PLN02789320 farnesyltranstransferase 99.04
PLN02789320 farnesyltranstransferase 99.04
PRK04841903 transcriptional regulator MalT; Provisional 99.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.01
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.0
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.98
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.97
PRK04841 903 transcriptional regulator MalT; Provisional 98.97
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.94
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.93
PRK10370198 formate-dependent nitrite reductase complex subuni 98.9
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.87
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.84
PRK15359144 type III secretion system chaperone protein SscB; 98.84
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.83
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.83
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.75
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.75
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.74
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.7
KOG1128777 consensus Uncharacterized conserved protein, conta 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.62
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.57
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.49
PF1285434 PPR_1: PPR repeat 98.48
COG3898531 Uncharacterized membrane-bound protein [Function u 98.45
COG4700251 Uncharacterized protein conserved in bacteria cont 98.4
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.39
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.38
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.36
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.35
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.33
PF1285434 PPR_1: PPR repeat 98.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.33
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.31
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.27
KOG0553304 consensus TPR repeat-containing protein [General f 98.26
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.21
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.2
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.17
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.17
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.17
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.15
KOG0553304 consensus TPR repeat-containing protein [General f 98.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.11
KOG20411189 consensus WD40 repeat protein [General function pr 98.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.07
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.06
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.06
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.06
COG4700251 Uncharacterized protein conserved in bacteria cont 98.03
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.01
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.99
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.96
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.92
PF12688120 TPR_5: Tetratrico peptide repeat 97.92
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.92
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.89
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.89
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.88
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.87
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.87
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.86
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.85
KOG20411189 consensus WD40 repeat protein [General function pr 97.85
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.84
PRK10803263 tol-pal system protein YbgF; Provisional 97.83
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.8
COG3898531 Uncharacterized membrane-bound protein [Function u 97.78
PRK15331165 chaperone protein SicA; Provisional 97.76
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.73
PRK11906458 transcriptional regulator; Provisional 97.72
PF12688120 TPR_5: Tetratrico peptide repeat 97.72
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.69
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.66
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.65
KOG1258577 consensus mRNA processing protein [RNA processing 97.63
PF13512142 TPR_18: Tetratricopeptide repeat 97.63
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.62
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.62
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.61
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.61
PF1337173 TPR_9: Tetratricopeptide repeat 97.57
PRK10803263 tol-pal system protein YbgF; Provisional 97.54
PRK15331165 chaperone protein SicA; Provisional 97.52
PF1337173 TPR_9: Tetratricopeptide repeat 97.5
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.47
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.46
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.42
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.4
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.39
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.38
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.38
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.37
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.34
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.25
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.23
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.19
PF13512142 TPR_18: Tetratricopeptide repeat 97.19
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.14
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.13
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.13
PF1342844 TPR_14: Tetratricopeptide repeat 97.08
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.05
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.02
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.0
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.0
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.98
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.95
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.94
KOG1585308 consensus Protein required for fusion of vesicles 96.93
KOG4555175 consensus TPR repeat-containing protein [Function 96.93
KOG1258577 consensus mRNA processing protein [RNA processing 96.92
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.91
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.86
PF1342844 TPR_14: Tetratricopeptide repeat 96.79
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.78
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.76
PRK11906458 transcriptional regulator; Provisional 96.72
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.71
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.69
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.69
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.68
KOG4555175 consensus TPR repeat-containing protein [Function 96.67
KOG1585308 consensus Protein required for fusion of vesicles 96.63
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.6
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.55
KOG1941518 consensus Acetylcholine receptor-associated protei 96.25
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.25
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.2
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.18
KOG1941518 consensus Acetylcholine receptor-associated protei 96.14
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.1
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.06
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.96
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.88
PF1343134 TPR_17: Tetratricopeptide repeat 95.87
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.82
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.81
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.79
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.72
PF1343134 TPR_17: Tetratricopeptide repeat 95.31
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.3
KOG4648536 consensus Uncharacterized conserved protein, conta 95.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.05
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.04
smart00299140 CLH Clathrin heavy chain repeat homology. 94.91
COG3629280 DnrI DNA-binding transcriptional activator of the 94.79
PRK11619644 lytic murein transglycosylase; Provisional 94.75
KOG2062 929 consensus 26S proteasome regulatory complex, subun 94.74
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.67
KOG4234271 consensus TPR repeat-containing protein [General f 94.63
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.54
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.53
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.38
COG3629280 DnrI DNA-binding transcriptional activator of the 94.2
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.19
smart00299140 CLH Clathrin heavy chain repeat homology. 94.01
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.91
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.83
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.8
KOG4234271 consensus TPR repeat-containing protein [General f 93.76
PF06552186 TOM20_plant: Plant specific mitochondrial import r 93.62
KOG4648536 consensus Uncharacterized conserved protein, conta 93.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.55
KOG2062 929 consensus 26S proteasome regulatory complex, subun 93.45
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.44
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.39
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.18
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.15
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.11
KOG3941 406 consensus Intermediate in Toll signal transduction 93.03
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.01
KOG3941406 consensus Intermediate in Toll signal transduction 92.83
COG1747711 Uncharacterized N-terminal domain of the transcrip 92.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.62
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.59
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 92.35
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.26
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 92.2
PRK11619644 lytic murein transglycosylase; Provisional 91.96
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.86
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.84
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.63
KOG1550552 consensus Extracellular protein SEL-1 and related 91.38
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.12
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.99
KOG4507886 consensus Uncharacterized conserved protein, conta 90.92
KOG1586288 consensus Protein required for fusion of vesicles 90.84
PHA02537230 M terminase endonuclease subunit; Provisional 90.75
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.41
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.27
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.25
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 90.15
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.02
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.91
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.79
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.71
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 89.68
KOG4507886 consensus Uncharacterized conserved protein, conta 89.53
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 89.47
KOG1550552 consensus Extracellular protein SEL-1 and related 89.38
PF05944132 Phage_term_smal: Phage small terminase subunit; In 89.17
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.14
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 89.09
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 88.87
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.76
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.58
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.56
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.51
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.92
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 87.48
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.42
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 87.36
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.13
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.03
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.85
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.75
PRK09687280 putative lyase; Provisional 86.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.51
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 86.1
KOG4570 418 consensus Uncharacterized conserved protein [Funct 85.77
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.43
COG3947361 Response regulator containing CheY-like receiver a 85.04
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 84.75
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.52
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 84.28
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.92
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.86
KOG2422665 consensus Uncharacterized conserved protein [Funct 83.67
KOG3364149 consensus Membrane protein involved in organellar 83.07
COG4976287 Predicted methyltransferase (contains TPR repeat) 82.71
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 82.55
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 82.22
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.19
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 82.17
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 82.0
COG3947361 Response regulator containing CheY-like receiver a 81.91
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.59
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.28
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 81.27
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-74  Score=616.76  Aligned_cols=628  Identities=19%  Similarity=0.221  Sum_probs=406.2

Q ss_pred             hhhhHhhhhchHHHHHHHHhhhhcCCCcchHHHHHHHHhccCChHHHHHHHHHHHHcCCC--------------------
Q 038606            3 SILSRARRIAPLRVLAQDVVKSRCFMSPGALGFLIRCLGSVGLVEEANMLFDQVKREGLC--------------------   62 (666)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~--------------------   62 (666)
                      +.+.+.|++++|..+++++...|.+++..+|..+++.+...+..+.|.+++..+.+.+..                    
T Consensus        59 ~~l~~~g~~~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~  138 (857)
T PLN03077         59 RALCSHGQLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELV  138 (857)
T ss_pred             HHHHhCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChH
Confidence            456677777777777777777666666666655555555555555555555544444320                    


Q ss_pred             ----------CCChhhHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHcCC
Q 038606           63 ----------VPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKALSVFNEIIDHGW  132 (666)
Q Consensus        63 ----------~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~  132 (666)
                                +||..+|+.++.+|.+.|++++|..+|++|...|+.||..+|+.++.++...+++..+.+++..+.+.+.
T Consensus       139 ~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~  218 (857)
T PLN03077        139 HAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGF  218 (857)
T ss_pred             HHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCC
Confidence                      2444455555555555555555555555555555555555555555555555555555555555544443


Q ss_pred             -CCchHHHHHHHHHHhcCChhhHHHHHHHHhhCCCCcchhhHHHHHHhhhccCCHHHHHHHHHHHHhCCCCccHHHHHHH
Q 038606          133 -VDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVI  211 (666)
Q Consensus       133 -~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l  211 (666)
                       .+..+++.++.+|.+.|++++|.++|++|..    +|..+|+.++.+|.+.|++++|+++|++|.+.|+.||..+|+.+
T Consensus       219 ~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~----~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~l  294 (857)
T PLN03077        219 ELDVDVVNALITMYVKCGDVVSARLVFDRMPR----RDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSV  294 (857)
T ss_pred             CcccchHhHHHHHHhcCCCHHHHHHHHhcCCC----CCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHH
Confidence             2344555666666666666666666666543    35555666666666666666666666666666666666666666


Q ss_pred             HHhhhccCChhHHHHHHHHHHhCCCCCCHHHHHHHHHhhhccCcHHHHHHHHHhhCCCCCccchHHHHHHHHHhcCCHHH
Q 038606          212 IGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSNGSIDQ  291 (666)
Q Consensus       212 ~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  291 (666)
                      +.+|.+.|+.+.|.+++..|.+.|+.||..+++.++..|++.|+.+.+.+.+....  .++..+|+.++.+|.+.|++++
T Consensus       295 l~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~--~~d~~s~n~li~~~~~~g~~~~  372 (857)
T PLN03077        295 ISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME--TKDAVSWTAMISGYEKNGLPDK  372 (857)
T ss_pred             HHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCC--CCCeeeHHHHHHHHHhCCCHHH
Confidence            66666666666666666666666666666666666666666666654444444332  2344556666666666666666


Q ss_pred             HHHHHHHHHhCCCCCchhHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHh
Q 038606          292 AYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGCMQNVFLYNNLIDGLCN  371 (666)
Q Consensus       292 A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~  371 (666)
                      |.++|+.|...+                +.||..+|+.++.+|++.|+++.|.++++.+.+.|+.++..+|+.|+.+|++
T Consensus       373 A~~lf~~M~~~g----------------~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k  436 (857)
T PLN03077        373 ALETYALMEQDN----------------VSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSK  436 (857)
T ss_pred             HHHHHHHHHHhC----------------CCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHH
Confidence            666666665544                3566666666666666666666666666666666666666666666666666


Q ss_pred             cCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCchhhHHHHHHHHHhcCCHHHHHHH
Q 038606          372 SNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRF  451 (666)
Q Consensus       372 ~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~  451 (666)
                      .|++++|.++|++|.+    +|..+|+.++.+|.+.|+.++|..+|++|.. +..|+..++..++.+|++.|..+.+.++
T Consensus       437 ~g~~~~A~~vf~~m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i  511 (857)
T PLN03077        437 CKCIDKALEVFHNIPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEI  511 (857)
T ss_pred             cCCHHHHHHHHHhCCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHH
Confidence            6666666666666543    3555666666666666666666666666654 3566666666666666666666666666


Q ss_pred             HHHHHHcCCCCChhhHHHHHHHHHccCChHHHHHHHHHHHhcCCCccHHHHHHHHHHHHccCCHHHHHHHHHHHHHCCCC
Q 038606          452 LTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKGLI  531 (666)
Q Consensus       452 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~  531 (666)
                      +..+.+.|+.++..+++.++.+|.+.|++++|.++|+.+     .||..+|+.++.+|++.|+.++|.++|++|.+.|+.
T Consensus       512 ~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~  586 (857)
T PLN03077        512 HAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVN  586 (857)
T ss_pred             HHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCC
Confidence            666666666666666667777777777777777777665     467777888888888888888888888888877888


Q ss_pred             CCHHHHHHHHHHHHccCChhHHHHHHHHHHhcCCCCCCHHhHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCCHHHHHHH
Q 038606          532 PSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMAL  611 (666)
Q Consensus       532 p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l  611 (666)
                      ||..||+.++.+|.+.|++++|.++|+.|.+..+..|+..+|+.++++|++.|++++|.+++++|.   ++||..+|++|
T Consensus       587 Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~---~~pd~~~~~aL  663 (857)
T PLN03077        587 PDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMP---ITPDPAVWGAL  663 (857)
T ss_pred             CCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCC---CCCCHHHHHHH
Confidence            888888888888888888888888888887555557787888888888888888888888877773   57788888888


Q ss_pred             HHHHHccCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhhHHHHHhhC
Q 038606          612 ITGLCKCDRPRAALVHFRMMKEKGMKPDMFVFVALISAFLSELNPPLAFEVLKEM  666 (666)
Q Consensus       612 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m  666 (666)
                      +.+|..+|+.+.+....+++.+.. |.+...|..+.+.|...|+|++|.++.+.|
T Consensus       664 l~ac~~~~~~e~~e~~a~~l~~l~-p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M  717 (857)
T PLN03077        664 LNACRIHRHVELGELAAQHIFELD-PNSVGYYILLCNLYADAGKWDEVARVRKTM  717 (857)
T ss_pred             HHHHHHcCChHHHHHHHHHHHhhC-CCCcchHHHHHHHHHHCCChHHHHHHHHHH
Confidence            888877777777777777777653 445677777778888888888888887765

>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF05944 Phage_term_smal: Phage small terminase subunit; InterPro: IPR010270 This entry is represented by Bacteriophage P2, GpM Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 84.1 bits (206), Expect = 7e-17
 Identities = 27/231 (11%), Positives = 56/231 (24%), Gaps = 3/231 (1%)

Query: 413 ALNLVRKMRVQGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIG 472
           A  L    R     PW +    L++E                  Q           A   
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 473 GLIDIKRVDLA---LELFRDICAHGCCPDVVAYNIIISGLCKAQRVAEAEDLFNEMITKG 529
             +   ++ LA   L +            +  YN ++ G  +     E   +   +   G
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAG 195

Query: 530 LIPSVATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTLIDGLCIAGRPDDA 589
           L P + +Y   +    +       +      + +E      +    L+     A      
Sbjct: 196 LTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAV 255

Query: 590 IMLWNEMEEKGCAPNRITFMALITGLCKCDRPRAALVHFRMMKEKGMKPDM 640
             +          P  +    L+  +   D   +       +K      + 
Sbjct: 256 HKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEK 306
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.81
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
3u4t_A272 TPR repeat-containing protein; structural genomics 99.76
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.76
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.73
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.71
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.7
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.7
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.69
3u4t_A272 TPR repeat-containing protein; structural genomics 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.67
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.65
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.65
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.63
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.63
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.63
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.63
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.6
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.6
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.6
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.57
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.55
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.54
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.47
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.45
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.43
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.41
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.41
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.41
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.4
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.38
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.38
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.36
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.35
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.32
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.32
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.31
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.3
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.28
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.28
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.28
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.27
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.25
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.22
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.21
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.2
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.19
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.18
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.18
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.18
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.18
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.17
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.17
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.1
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.06
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.03
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.03
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.02
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.01
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.99
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.99
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.99
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.99
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.96
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.92
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.91
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.91
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.91
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.9
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.9
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.9
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.88
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.88
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.87
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.87
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.87
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.85
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.85
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.85
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.83
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.82
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.81
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.79
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.77
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.76
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.75
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.73
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.71
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.71
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.69
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.67
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.65
3k9i_A117 BH0479 protein; putative protein binding protein, 98.63
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.61
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.58
3k9i_A117 BH0479 protein; putative protein binding protein, 98.57
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.57
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.57
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.56
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.52
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.48
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.45
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.41
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.4
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.33
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.27
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.25
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.17
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.11
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.07
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.93
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.86
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.84
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.76
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.68
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.58
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.52
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.49
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.45
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.34
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.33
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.24
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.15
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.99
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.98
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.96
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.81
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.76
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.6
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.35
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.33
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.14
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.07
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.02
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.0
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.59
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.7
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.03
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.58
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 93.35
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.34
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.27
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.69
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.35
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.16
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.37
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.29
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 90.95
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.82
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.81
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 89.17
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.84
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.76
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.79
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 86.57
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.86
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.74
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.6
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.5e-40  Score=346.51  Aligned_cols=507  Identities=13%  Similarity=0.035  Sum_probs=383.0

Q ss_pred             hccCChHHHHHHHHHHHHcCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCCcccHHHHHHHHHhcCChhHH
Q 038606           41 GSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSGQFDKA  120 (666)
Q Consensus        41 ~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A  120 (666)
                      ...|....+...+....     .++...|..++..+.+.|++++|..+|+++.+.  .|+..++..++.+|.+.|++++|
T Consensus        64 ~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A  136 (597)
T 2xpi_A           64 STDGSFLKERNAQNTDS-----LSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARA  136 (597)
T ss_dssp             -----------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHH
T ss_pred             cccCccCCCCCccccch-----HHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHH
Confidence            34455555555554333     356777888888888888888888888888754  34667777788888888888888


Q ss_pred             HHHHHHHHHcCCCCchHHHHHHHHHHhcCChhhHHHHHHHHhhC---------------CCCcchhhHHHHHHhhhccCC
Q 038606          121 LSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDC---------------NIRLNEKTFCVLIHGFVKKSR  185 (666)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~---------------~~~~~~~~~~~l~~~~~~~~~  185 (666)
                      +.+|+++... +.++.++..++.+|.+.|++++|.++|+++...               +.+.+..+|+.++.+|.+.|+
T Consensus       137 ~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  215 (597)
T 2xpi_A          137 KCLLTKEDLY-NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSN  215 (597)
T ss_dssp             HHHHHHTCGG-GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHhcc-ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCC
Confidence            8888877543 346778888888888888888888888753322               223467889999999999999


Q ss_pred             HHHHHHHHHHHHhCCCCccHHHHHHHHHhhhccCChhHHHH--H-HHHHHhCCCCCCHHHHHHHHHhhhccCcHHHHHHH
Q 038606          186 VDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQ--L-YSEMKGSGITPDFEILSKLITSCSDEGELTLLVKE  262 (666)
Q Consensus       186 ~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~--~-~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~  262 (666)
                      +++|+++|+++.+.+ +.+...+..++..+...+..+.+..  + +..+...+..+..                      
T Consensus       216 ~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~----------------------  272 (597)
T 2xpi_A          216 FDRAKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLR----------------------  272 (597)
T ss_dssp             HHHHHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHH----------------------
T ss_pred             HHHHHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHH----------------------
Confidence            999999999988765 4566677777766655444333222  1 4555443322222                      


Q ss_pred             HHhhCCCCCccchHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCchhHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChHH
Q 038606          263 IWEDRDVNTMTLLCNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDL  342 (666)
Q Consensus       263 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  342 (666)
                                 ..+..++..|.+.|++++|.++|+++...                  +++..++..++..|.+.|++++
T Consensus       273 -----------~~~~~~~~~~~~~g~~~~A~~~~~~~~~~------------------~~~~~~~~~l~~~~~~~g~~~~  323 (597)
T 2xpi_A          273 -----------SLYMLKLNKTSHEDELRRAEDYLSSINGL------------------EKSSDLLLCKADTLFVRSRFID  323 (597)
T ss_dssp             -----------HHHHTTSCTTTTHHHHHHHHHHHHTSTTG------------------GGCHHHHHHHHHHHHHTTCHHH
T ss_pred             -----------HHHHHHHHHHcCcchHHHHHHHHHHhhcC------------------CchHHHHHHHHHHHHHhcCHHH
Confidence                       33444556677778888888888877642                  4778888888888888888888


Q ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHH
Q 038606          343 ALSLFREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRV  422 (666)
Q Consensus       343 a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~  422 (666)
                      |.++|+++.+.+ +.+..++..++.++.+.|++++|.++++++.+.. +.+..++..++..|.+.|++++|.++|+++.+
T Consensus       324 A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  401 (597)
T 2xpi_A          324 VLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSST  401 (597)
T ss_dssp             HHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHH
Confidence            888888888766 4567778888888888888888888888887653 55777888888888888888888888888877


Q ss_pred             cCCCCchhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHccCChHHHHHHHHHHHhcCCCccHHHH
Q 038606          423 QGHEPWVKHNTLLIKELCKHGKAMEAFRFLTDMVQEGFLPDIVCYSAAIGGLIDIKRVDLALELFRDICAHGCCPDVVAY  502 (666)
Q Consensus       423 ~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  502 (666)
                      .. +.+..++..++..+.+.|++++|+.+|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.. +.+..+|
T Consensus       402 ~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~  478 (597)
T 2xpi_A          402 MD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLL  478 (597)
T ss_dssp             HC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHH
T ss_pred             hC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHH
Confidence            54 4567788888888899999999999998888764 4477888889999999999999999999988763 5578889


Q ss_pred             HHHHHHHHccCCHHHHHHHHHHHHHC----CCCCC--HHHHHHHHHHHHccCChhHHHHHHHHHHhcCCCCCCHHhHHHH
Q 038606          503 NIIISGLCKAQRVAEAEDLFNEMITK----GLIPS--VATYNLLINGWCKSGNIDQAMLCLSRMLEKESGSPDVITYTTL  576 (666)
Q Consensus       503 ~~l~~~~~~~~~~~~a~~~~~~~~~~----~~~p~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l  576 (666)
                      +.++..|.+.|++++|..+|+++.+.    +..|+  ..+|..++.+|.+.|++++|.++|+++.+..+  .+..+|..+
T Consensus       479 ~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p--~~~~~~~~l  556 (597)
T 2xpi_A          479 NELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLST--NDANVHTAI  556 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSS--CCHHHHHHH
T ss_pred             HHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCC--CChHHHHHH
Confidence            99999999999999999999998876    56777  67899999999999999999999999988865  578889999


Q ss_pred             HHHHHHcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Q 038606          577 IDGLCIAGRPDDAIMLWNEMEEKGCAPNRITFMALITGL  615 (666)
Q Consensus       577 ~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~  615 (666)
                      +.+|...|++++|.+.++++.+.. +.+...+..+..+|
T Consensus       557 ~~~~~~~g~~~~A~~~~~~~l~~~-p~~~~~~~~l~~~~  594 (597)
T 2xpi_A          557 ALVYLHKKIPGLAITHLHESLAIS-PNEIMASDLLKRAL  594 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHTT
T ss_pred             HHHHHHhCCHHHHHHHHHHHHhcC-CCChHHHHHHHHHH
Confidence            999999999999999999998863 33567776666655
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 666
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.9 bits (102), Expect = 4e-05
 Identities = 39/386 (10%), Positives = 110/386 (28%), Gaps = 31/386 (8%)

Query: 107 LLQVYCNSGQFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNI 166
           L      +G F+ A     ++      +  V  +L     +   +D++          N 
Sbjct: 5   LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP 64

Query: 167 RLNEKTFCVLIHGFVKKSRVDKALQLFDKMTKSGFASDAAMYDVIIGGLCKNKQLEMALQ 226
               + +  L + + ++ ++ +A++ +    +          ++    +           
Sbjct: 65  L-LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQA 123

Query: 227 LYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLLCNSIMRILVSN 286
             S ++ +            +       E          +   N      N +  +  + 
Sbjct: 124 YVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSN-LGCVFNAQ 182

Query: 287 GSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSL 346
           G I  A +  +  +  +P                     ++  + N L +    D A++ 
Sbjct: 183 GEIWLAIHHFEKAVTLDP-----------------NFLDAYINLGNVLKEARIFDRAVAA 225

Query: 347 FREMTQIGCMQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHF-TLNSMFRCLC 405
           +     +       ++ NL         ++ + +  R   E   +P       ++   L 
Sbjct: 226 YLRALSLSPNH-AVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALK 282

Query: 406 RRQDVVGALNLVRKMRVQGHEPWVKHNTL--LIKELCKHGKAMEAFRFLTDMVQEGFLPD 463
            +  V  A +                N L  + +E     +A+  +R   ++      P+
Sbjct: 283 EKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV-----FPE 337

Query: 464 IVCYSAAIGG-LIDIKRVDLALELFR 488
                + +   L    ++  AL  ++
Sbjct: 338 FAAAHSNLASVLQQQGKLQEALMHYK 363
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.71
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.51
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.46
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.45
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.34
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.31
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.31
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.3
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.06
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.98
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.85
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.79
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.79
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.77
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.75
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.75
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.7
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.68
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.64
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.47
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.45
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.35
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.33
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.3
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.28
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.27
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.26
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.04
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.96
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.92
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.87
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.6
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.59
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.58
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.22
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.01
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.2
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.1
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.86
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.24
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.56
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.99
d1bpoa1157 Clathrin heavy-chain linker domain {Rat (Rattus no 83.81
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=9e-24  Score=205.78  Aligned_cols=363  Identities=15%  Similarity=0.065  Sum_probs=195.4

Q ss_pred             HHHHHhccCChHHHHHHHHHHHHcCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCCcccHHHHHHHHHhcC
Q 038606           36 LIRCLGSVGLVEEANMLFDQVKREGLCVPNNYSYNCLLEALCKSCSVDLVEMRLKEMQDYGWGYDKYTLTPLLQVYCNSG  115 (666)
Q Consensus        36 l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  115 (666)
                      ++..+.+.|++++|.+.|+++++..  |.+..++..++.+|.+.|++++|...|+++++.++. +..++..++.+|.+.|
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhc
Confidence            4556666677777777777776665  456666667777777777777777777777665543 5556666666777777


Q ss_pred             ChhHHHHHHHHHHHcCCCCchHHHHHHHHHHhcCChhhHHHHHHHHhhCCCCcchhhHHHHHHhhhccCCHHHHHHHHHH
Q 038606          116 QFDKALSVFNEIIDHGWVDEHVFSILLVAFSKWGEVDKACELIERMDDCNIRLNEKTFCVLIHGFVKKSRVDKALQLFDK  195 (666)
Q Consensus       116 ~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~  195 (666)
                      ++++|++.+..+....+................+....+............ ................+....+...+..
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-DLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-TCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccchhhhhHHHHHH
Confidence            777777777777666665555555555555555555555555554444322 2233333334444455556666666555


Q ss_pred             HHhCCCCccHHHHHHHHHhhhccCChhHHHHHHHHHHhCCCCCCHHHHHHHHHhhhccCcHHHHHHHHHhhCCCCCccch
Q 038606          196 MTKSGFASDAAMYDVIIGGLCKNKQLEMALQLYSEMKGSGITPDFEILSKLITSCSDEGELTLLVKEIWEDRDVNTMTLL  275 (666)
Q Consensus       196 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~  275 (666)
                      ..... +.+...+..+...+...|++++|...+++..+.  .|+.                                ...
T Consensus       161 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~--------------------------------~~~  205 (388)
T d1w3ba_         161 AIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--DPNF--------------------------------LDA  205 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--CTTC--------------------------------HHH
T ss_pred             hhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHh--Cccc--------------------------------HHH
Confidence            55443 334555555566666666666666666665542  2221                                133


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCchhHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCC
Q 038606          276 CNSIMRILVSNGSIDQAYNLLQAMIKGEPIADVGVEMLMIFKGTVSPNTSSFDIIINTLLKDGKLDLALSLFREMTQIGC  355 (666)
Q Consensus       276 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~  355 (666)
                      +..+...+...|++++|...++......                 +.+...+..+...+.+.|++++|...|+++.+.. 
T Consensus       206 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~-----------------~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-  267 (388)
T d1w3ba_         206 YINLGNVLKEARIFDRAVAAYLRALSLS-----------------PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-  267 (388)
T ss_dssp             HHHHHHHHHTTTCTTHHHHHHHHHHHHC-----------------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-
T ss_pred             HHHHhhhhhccccHHHHHHHHHHhHHHh-----------------hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-
Confidence            4444455555555555555555555443                 3444445555555555555555555555555433 


Q ss_pred             CCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCchhhHHHH
Q 038606          356 MQNVFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVRKMRVQGHEPWVKHNTLL  435 (666)
Q Consensus       356 ~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  435 (666)
                      +.+..++..+...+...|++++|.+.++...... +.+...+..+...+...|++++|+..+++..+.. |.+..++..+
T Consensus       268 p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l  345 (388)
T d1w3ba_         268 PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNL  345 (388)
T ss_dssp             SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHH
Confidence            2334445555555555555555555555544432 3344444444444445555555555544444332 2223333333


Q ss_pred             HHHHHhcCCHHHHHHHHHHHHH
Q 038606          436 IKELCKHGKAMEAFRFLTDMVQ  457 (666)
Q Consensus       436 ~~~~~~~~~~~~a~~~~~~~~~  457 (666)
                      ..++...|++++|...|+++.+
T Consensus       346 a~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         346 ASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHHcCCHHHHHHHHHHHHH
Confidence            4444444444444444444433
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure