Citrus Sinensis ID: 038673


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
cccHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHcccccccEEHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHccccHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
cHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEEcccccEcccccc
mdsfprlvFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSmrregigpvsFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKcgflgcsrkvfdemperdvVSWTELIVAYAnngdmesagglfnelplkdkVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEiaegsgfgpinnvVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDmvktetkpngvTFIGVLTACshvglkcygvspstdhYACMVDLLGRAGCLEEALKMVEkmpvepnggvwGALLGACQIHRNPEIAQIAANHLfelepdkignyIILSNIYasagmwddVSRVRRLLKMtglkknpgyswlegdrgvihefragdlthpnsTEIQQALGDLLDRLqadgyqpnlrsVLYDVSDEEKKRILMTHSEKLALAFGllttspgatVRIMKNLRICEDCHLFMCgasqvigreivvrdnmrfhhfqdgkcscgnyw
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKmtglkknpgyswlegdRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMrfhhfqdgkcscgnyw
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
*****RLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGN**
*DSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query548 2.2.26 [Sep-21-2011]
Q9FFG8657 Pentatricopeptide repeat- yes no 0.998 0.832 0.602 0.0
O82380738 Pentatricopeptide repeat- no no 0.979 0.727 0.407 1e-130
Q9FG16622 Pentatricopeptide repeat- no no 0.979 0.863 0.400 1e-124
Q9FJY7620 Pentatricopeptide repeat- no no 0.987 0.872 0.396 1e-123
Q9LUJ2842 Pentatricopeptide repeat- no no 0.983 0.640 0.401 1e-122
P0C899686 Putative pentatricopeptid no no 0.983 0.785 0.386 1e-120
Q9FI80646 Pentatricopeptide repeat- no no 0.979 0.831 0.405 1e-119
Q9SZT8632 Pentatricopeptide repeat- no no 0.972 0.843 0.387 1e-116
Q9LW63715 Putative pentatricopeptid no no 0.927 0.710 0.374 1e-115
O23337722 Pentatricopeptide repeat- no no 0.989 0.750 0.372 1e-114
>sp|Q9FFG8|PP417_ARATH Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1 Back     alignment and function desciption
 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/561 (60%), Positives = 423/561 (75%), Gaps = 14/561 (2%)

Query: 1   MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFK 60
           MD + R V E V+++NPFLWTA+IRGY ++G   ++I++Y  MR+E I PVSFT SAL K
Sbjct: 98  MDPYARRVIEPVQFRNPFLWTAVIRGYAIEGKFDEAIAMYGCMRKEEITPVSFTFSALLK 157

Query: 61  ACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVV 120
           AC  + D++LG+Q HAQT  L GF   +YVGNTMI MYVKC  + C+RKVFDEMPERDV+
Sbjct: 158 ACGTMKDLNLGRQFHAQTFRLRGFCF-VYVGNTMIDMYVKCESIDCARKVFDEMPERDVI 216

Query: 121 SWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAG 180
           SWTELI AYA  G+ME A  LF  LP KD VAWTAMVTG+ QNAKP+EA+EYF+RM+ +G
Sbjct: 217 SWTELIAAYARVGNMECAAELFESLPTKDMVAWTAMVTGFAQNAKPQEALEYFDRMEKSG 276

Query: 181 VETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDD 240
           +  D VT+ G ISACAQLG  KYA+   +IA+ SG+ P ++VV+GSALIDMYSKCG++++
Sbjct: 277 IRADEVTVAGYISACAQLGASKYADRAVQIAQKSGYSPSDHVVIGSALIDMYSKCGNVEE 336

Query: 241 AYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMV-KTETKPNGVTFIGVLTACS 299
           A  +F+ M  +NVF+YSSMILG A HGRA  A+ LF  MV +TE KPN VTF+G L ACS
Sbjct: 337 AVNVFMSMNNKNVFTYSSMILGLATHGRAQEALHLFHYMVTQTEIKPNTVTFVGALMACS 396

Query: 300 HVGL------------KCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVW 347
           H GL            + +GV P+ DHY CMVDLLGR G L+EAL++++ M VEP+GGVW
Sbjct: 397 HSGLVDQGRQVFDSMYQTFGVQPTRDHYTCMVDLLGRTGRLQEALELIKTMSVEPHGGVW 456

Query: 348 GALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMT 407
           GALLGAC+IH NPEIA+IAA HLFELEPD IGNYI+LSN+YASAG W  V RVR+L+K  
Sbjct: 457 GALLGACRIHNNPEIAEIAAEHLFELEPDIIGNYILLSNVYASAGDWGGVLRVRKLIKEK 516

Query: 408 GLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYD 467
           GLKK P  SW+    G +H+F  G+L HP S +IQ  L +L++RL   GYQP+L SV YD
Sbjct: 517 GLKKTPAVSWVVDKNGQMHKFFPGNLNHPMSNKIQDKLEELVERLTVLGYQPDLSSVPYD 576

Query: 468 VSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIV 527
           VSD  K+ IL+ H+EKLALAF LLTT+  +T+ IMKNLR+C DCH FM  AS+V G+ I+
Sbjct: 577 VSDNAKRLILIQHTEKLALAFSLLTTNRDSTITIMKNLRMCLDCHKFMRLASEVTGKVII 636

Query: 528 VRDNMRFHHFQDGKCSCGNYW 548
           +RDNMRFHHF+ G CSCG++W
Sbjct: 637 MRDNMRFHHFRSGDCSCGDFW 657





Arabidopsis thaliana (taxid: 3702)
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function description
>sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing protein At3g49142 OS=Arabidopsis thaliana GN=PCMP-H77 PE=3 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein At4g37380, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H48 PE=3 SV=1 Back     alignment and function description
>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1 Back     alignment and function description
>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query548
225431281647 PREDICTED: pentatricopeptide repeat-cont 1.0 0.846 0.725 0.0
449457516 650 PREDICTED: pentatricopeptide repeat-cont 1.0 0.843 0.703 0.0
449525261 650 PREDICTED: pentatricopeptide repeat-cont 1.0 0.843 0.701 0.0
224133790 654 predicted protein [Populus trichocarpa] 1.0 0.837 0.678 0.0
356510957617 PREDICTED: pentatricopeptide repeat-cont 1.0 0.888 0.639 0.0
357518907616 Pentatricopeptide repeat-containing prot 0.989 0.879 0.616 0.0
297794983 658 pentatricopeptide repeat-containing prot 0.998 0.831 0.611 0.0
15241448 657 pentatricopeptide repeat-containing prot 0.998 0.832 0.602 0.0
115469684648 Os06g0694300 [Oryza sativa Japonica Grou 0.983 0.831 0.543 1e-172
242094040 653 hypothetical protein SORBIDRAFT_10g02837 0.983 0.825 0.538 1e-168
>gi|225431281|ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/560 (72%), Positives = 480/560 (85%), Gaps = 12/560 (2%)

Query: 1   MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFK 60
           MD +PRLVF+QV+Y NPFLWTALIRGY LQG   +S+ LY SMRR+GIGPVSFT +AL K
Sbjct: 88  MDPYPRLVFQQVEYPNPFLWTALIRGYALQGPFMESVLLYNSMRRQGIGPVSFTFTALLK 147

Query: 61  ACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVV 120
           AC+  LDV+LG+Q+H QTIL+GGF SDLYVGNT+I MYVKCG LGC  +VFDEM +RDV+
Sbjct: 148 ACSAALDVNLGRQVHTQTILIGGFGSDLYVGNTLIDMYVKCGCLGCGHRVFDEMLDRDVI 207

Query: 121 SWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAG 180
           SWT LIVAYA  G+ME+A  LF+ LP+KD VAWTAMVTGY QNA+PREA+E FERMQ AG
Sbjct: 208 SWTSLIVAYAKVGNMEAASELFDGLPMKDMVAWTAMVTGYAQNARPREALEVFERMQAAG 267

Query: 181 VETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDD 240
           V+TD VTLVGVISACAQLG  KYANWV ++AE SGFGP +NVVVGSALIDMY+KCGS++D
Sbjct: 268 VKTDEVTLVGVISACAQLGAAKYANWVRDVAEQSGFGPTSNVVVGSALIDMYAKCGSVED 327

Query: 241 AYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSH 300
           AY++F  M++RNV+SYSSMI+GFAMHG A AA++LF +M+KTE KPN VTFIGVLTACSH
Sbjct: 328 AYKVFERMEERNVYSYSSMIVGFAMHGLAGAAMELFDEMLKTEIKPNRVTFIGVLTACSH 387

Query: 301 VGL------------KCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWG 348
            G+            +C+GV+PS DHYACMVDLLGRAG LEEAL +V+ MP+ P+GGVWG
Sbjct: 388 AGMVEQGQQLFAMMEECHGVAPSEDHYACMVDLLGRAGRLEEALNLVKMMPMNPHGGVWG 447

Query: 349 ALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTG 408
           ALLGAC+IH NP++AQIAA+HLFELEP+ IGNYI+LSNIYASAG WDDVS+VR+L++  G
Sbjct: 448 ALLGACRIHGNPDMAQIAASHLFELEPNGIGNYILLSNIYASAGRWDDVSKVRKLMRAKG 507

Query: 409 LKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDV 468
           LKKNPG SW+EG +G+IHEF AGD++HP S EI+QAL DLLDRL+  GYQPNL SV YD+
Sbjct: 508 LKKNPGCSWVEGKKGIIHEFFAGDMSHPKSREIKQALEDLLDRLKYLGYQPNLSSVAYDI 567

Query: 469 SDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVV 528
           SDEEKKR+LM+HSEKLALAFGLLTT+ G T+RI+KNLRICEDCH  MCGASQ+ GREIVV
Sbjct: 568 SDEEKKRLLMSHSEKLALAFGLLTTNAGCTIRIVKNLRICEDCHSVMCGASQITGREIVV 627

Query: 529 RDNMRFHHFQDGKCSCGNYW 548
           RDNMRFHHF+DG+CSCGN+W
Sbjct: 628 RDNMRFHHFRDGRCSCGNFW 647




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449457516|ref|XP_004146494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525261|ref|XP_004169636.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224133790|ref|XP_002327681.1| predicted protein [Populus trichocarpa] gi|222836766|gb|EEE75159.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510957|ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like [Glycine max] Back     alignment and taxonomy information
>gi|357518907|ref|XP_003629742.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523764|gb|AET04218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297794983|ref|XP_002865376.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311211|gb|EFH41635.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15241448|ref|NP_199236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170229|sp|Q9FFG8.1|PP417_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g44230 gi|9759524|dbj|BAB10990.1| selenium-binding protein-like [Arabidopsis thaliana] gi|91806984|gb|ABE66219.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332007694|gb|AED95077.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115469684|ref|NP_001058441.1| Os06g0694300 [Oryza sativa Japonica Group] gi|53791823|dbj|BAD53889.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|53792844|dbj|BAD53877.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|113596481|dbj|BAF20355.1| Os06g0694300 [Oryza sativa Japonica Group] gi|125598347|gb|EAZ38127.1| hypothetical protein OsJ_22476 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242094040|ref|XP_002437510.1| hypothetical protein SORBIDRAFT_10g028370 [Sorghum bicolor] gi|241915733|gb|EER88877.1| hypothetical protein SORBIDRAFT_10g028370 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query548
TAIR|locus:2167593657 AT5G44230 [Arabidopsis thalian 0.998 0.832 0.602 9.7e-183
TAIR|locus:2060640738 OTP81 "ORGANELLE TRANSCRIPT PR 0.979 0.727 0.407 3.7e-119
TAIR|locus:4010713895595 AT4G21065 "AT4G21065" [Arabido 0.766 0.705 0.399 2e-117
TAIR|locus:2144143622 AT5G06540 [Arabidopsis thalian 0.979 0.863 0.400 1e-114
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.987 0.872 0.396 5.9e-112
TAIR|locus:2078653825 AT3G02010 [Arabidopsis thalian 0.768 0.510 0.400 3.9e-108
TAIR|locus:2126352632 AT4G37380 [Arabidopsis thalian 0.970 0.841 0.392 2.7e-107
TAIR|locus:2055919786 AT2G22070 "AT2G22070" [Arabido 0.978 0.681 0.386 3.5e-107
TAIR|locus:2130389684 LOI1 "lovastatin insensitive 1 0.784 0.628 0.402 2.2e-105
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.768 0.423 0.408 5.8e-105
TAIR|locus:2167593 AT5G44230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1773 (629.2 bits), Expect = 9.7e-183, P = 9.7e-183
 Identities = 338/561 (60%), Positives = 423/561 (75%)

Query:     1 MDSFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFK 60
             MD + R V E V+++NPFLWTA+IRGY ++G   ++I++Y  MR+E I PVSFT SAL K
Sbjct:    98 MDPYARRVIEPVQFRNPFLWTAVIRGYAIEGKFDEAIAMYGCMRKEEITPVSFTFSALLK 157

Query:    61 ACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVV 120
             AC  + D++LG+Q HAQT  L GF   +YVGNTMI MYVKC  + C+RKVFDEMPERDV+
Sbjct:   158 ACGTMKDLNLGRQFHAQTFRLRGFCF-VYVGNTMIDMYVKCESIDCARKVFDEMPERDVI 216

Query:   121 SWTELIVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAG 180
             SWTELI AYA  G+ME A  LF  LP KD VAWTAMVTG+ QNAKP+EA+EYF+RM+ +G
Sbjct:   217 SWTELIAAYARVGNMECAAELFESLPTKDMVAWTAMVTGFAQNAKPQEALEYFDRMEKSG 276

Query:   181 VETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDD 240
             +  D VT+ G ISACAQLG  KYA+   +IA+ SG+ P ++VV+GSALIDMYSKCG++++
Sbjct:   277 IRADEVTVAGYISACAQLGASKYADRAVQIAQKSGYSPSDHVVIGSALIDMYSKCGNVEE 336

Query:   241 AYRIFVGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMV-KTETKPNGVTFIGVLTACS 299
             A  +F+ M  +NVF+YSSMILG A HGRA  A+ LF  MV +TE KPN VTF+G L ACS
Sbjct:   337 AVNVFMSMNNKNVFTYSSMILGLATHGRAQEALHLFHYMVTQTEIKPNTVTFVGALMACS 396

Query:   300 HVGL------------KCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVW 347
             H GL            + +GV P+ DHY CMVDLLGR G L+EAL++++ M VEP+GGVW
Sbjct:   397 HSGLVDQGRQVFDSMYQTFGVQPTRDHYTCMVDLLGRTGRLQEALELIKTMSVEPHGGVW 456

Query:   348 GALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMT 407
             GALLGAC+IH NPEIA+IAA HLFELEPD IGNYI+LSN+YASAG W  V RVR+L+K  
Sbjct:   457 GALLGACRIHNNPEIAEIAAEHLFELEPDIIGNYILLSNVYASAGDWGGVLRVRKLIKEK 516

Query:   408 GLKKNPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYD 467
             GLKK P  SW+    G +H+F  G+L HP S +IQ  L +L++RL   GYQP+L SV YD
Sbjct:   517 GLKKTPAVSWVVDKNGQMHKFFPGNLNHPMSNKIQDKLEELVERLTVLGYQPDLSSVPYD 576

Query:   468 VSDEEKKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIV 527
             VSD  K+ IL+ H+EKLALAF LLTT+  +T+ IMKNLR+C DCH FM  AS+V G+ I+
Sbjct:   577 VSDNAKRLILIQHTEKLALAFSLLTTNRDSTITIMKNLRMCLDCHKFMRLASEVTGKVII 636

Query:   528 VRDNMRFHHFQDGKCSCGNYW 548
             +RDNMRFHHF+ G CSCG++W
Sbjct:   637 MRDNMRFHHFRSGDCSCGDFW 657




GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126352 AT4G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055919 AT2G22070 "AT2G22070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130389 LOI1 "lovastatin insensitive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FFG8PP417_ARATHNo assigned EC number0.60240.99810.8325yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query548
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-131
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-124
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-50
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-45
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-34
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 4e-28
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-25
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-14
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  397 bits (1022), Expect = e-131
 Identities = 190/556 (34%), Positives = 302/556 (54%), Gaps = 49/556 (8%)

Query: 6   RLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEV 65
           R +F+++  +N   W  +I G +  G+ +++ +L+  M  +G      T   + +A   +
Sbjct: 178 RRLFDEMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGL 237

Query: 66  LDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTEL 125
                GQQ+H   +L  G   D +V   +I MY KCG +  +R VFD MPE+  V+W  +
Sbjct: 238 GSARAGQQLHC-CVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSM 296

Query: 126 IVAYANNGDMESAGGLFNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDY 185
           +  YA +G  E                               EA+  +  M+ +GV  D 
Sbjct: 297 LAGYALHGYSE-------------------------------EALCLYYEMRDSGVSIDQ 325

Query: 186 VTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIF 245
            T   +I   ++L ++++A         +GF    ++V  +AL+D+YSK G ++DA  +F
Sbjct: 326 FTFSIMIRIFSRLALLEHAKQAHAGLIRTGFP--LDIVANTALVDLYSKWGRMEDARNVF 383

Query: 246 VGMKQRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGL-- 303
             M ++N+ S++++I G+  HGR   A+++F  M+     PN VTF+ VL+AC + GL  
Sbjct: 384 DRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSE 443

Query: 304 ----------KCYGVSPSTDHYACMVDLLGRAGCLEEALKMVEKMPVEPNGGVWGALLGA 353
                     + + + P   HYACM++LLGR G L+EA  M+ + P +P   +W ALL A
Sbjct: 444 QGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTA 503

Query: 354 CQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKKNP 413
           C+IH+N E+ ++AA  L+ + P+K+ NY++L N+Y S+G   + ++V   LK  GL  +P
Sbjct: 504 CRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHP 563

Query: 414 GYSWLE-GDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEE 472
             +W+E   +   H F +GD  HP S EI Q L +L+  +   GY      +L DV ++E
Sbjct: 564 ACTWIEVKKQD--HSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDE 621

Query: 473 KKRILMTHSEKLALAFGLLTTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNM 532
           +K     HSEKLA+AFGL+ TS    ++I ++ RIC+DCH  +   + V  REIVVRD  
Sbjct: 622 EKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDAS 681

Query: 533 RFHHFQDGKCSCGNYW 548
           RFHHF+ GKCSCG+YW
Sbjct: 682 RFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 548
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.85
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.73
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.69
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.64
PRK14574 822 hmsH outer membrane protein; Provisional 99.63
KOG2003840 consensus TPR repeat-containing protein [General f 99.57
KOG2076 895 consensus RNA polymerase III transcription factor 99.52
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.51
KOG0547606 consensus Translocase of outer mitochondrial membr 99.51
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
KOG2076 895 consensus RNA polymerase III transcription factor 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.47
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.47
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.47
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.43
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.43
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.43
KOG2003840 consensus TPR repeat-containing protein [General f 99.36
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.36
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.35
PF1304150 PPR_2: PPR repeat family 99.34
PF1304150 PPR_2: PPR repeat family 99.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.33
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.33
KOG1915677 consensus Cell cycle control protein (crooked neck 99.32
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.27
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.27
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.24
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.2
KOG1129478 consensus TPR repeat-containing protein [General f 99.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.17
PRK12370553 invasion protein regulator; Provisional 99.16
PRK12370553 invasion protein regulator; Provisional 99.16
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG1915677 consensus Cell cycle control protein (crooked neck 99.14
KOG1129478 consensus TPR repeat-containing protein [General f 99.07
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.07
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.06
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.06
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.03
PRK11189296 lipoprotein NlpI; Provisional 99.01
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.01
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.93
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.92
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.91
KOG0547606 consensus Translocase of outer mitochondrial membr 98.9
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.9
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.89
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.88
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.88
PRK11189296 lipoprotein NlpI; Provisional 98.84
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.82
KOG2376652 consensus Signal recognition particle, subunit Srp 98.76
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.74
KOG2376652 consensus Signal recognition particle, subunit Srp 98.74
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.69
KOG1125579 consensus TPR repeat-containing protein [General f 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.65
PF1285434 PPR_1: PPR repeat 98.63
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.61
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.59
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.59
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.57
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.57
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.54
PF1285434 PPR_1: PPR repeat 98.54
PLN02789320 farnesyltranstransferase 98.5
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.48
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
PRK04841903 transcriptional regulator MalT; Provisional 98.46
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.46
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.45
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.43
PRK15359144 type III secretion system chaperone protein SscB; 98.43
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.39
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.38
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.38
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.37
PLN02789320 farnesyltranstransferase 98.35
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.34
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.26
PRK15359144 type III secretion system chaperone protein SscB; 98.24
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.24
KOG1125579 consensus TPR repeat-containing protein [General f 98.23
PRK04841903 transcriptional regulator MalT; Provisional 98.23
PRK10370198 formate-dependent nitrite reductase complex subuni 98.23
KOG1128777 consensus Uncharacterized conserved protein, conta 98.22
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.2
KOG1128777 consensus Uncharacterized conserved protein, conta 98.19
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.16
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.15
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.15
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.14
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.11
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.09
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.08
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.07
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.06
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.02
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.99
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.98
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.96
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.96
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.94
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.93
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.9
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.87
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.85
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.71
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.67
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.61
KOG0553304 consensus TPR repeat-containing protein [General f 97.59
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.55
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.53
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.5
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.46
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.42
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.42
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.41
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.39
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.38
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.36
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.33
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.31
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.28
PF12688120 TPR_5: Tetratrico peptide repeat 97.24
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.22
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.18
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.17
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.17
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.15
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.15
PF1337173 TPR_9: Tetratricopeptide repeat 97.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.09
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.08
PRK15331165 chaperone protein SicA; Provisional 97.05
KOG0553304 consensus TPR repeat-containing protein [General f 97.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.02
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.93
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.91
PF1343134 TPR_17: Tetratricopeptide repeat 96.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.85
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.83
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.8
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.79
PF12688120 TPR_5: Tetratrico peptide repeat 96.77
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.77
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.76
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.74
COG4700251 Uncharacterized protein conserved in bacteria cont 96.7
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.69
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.63
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.52
PRK10803263 tol-pal system protein YbgF; Provisional 96.51
KOG20411189 consensus WD40 repeat protein [General function pr 96.39
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.38
PF1342844 TPR_14: Tetratricopeptide repeat 96.38
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.33
smart00299140 CLH Clathrin heavy chain repeat homology. 96.32
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.29
COG3898531 Uncharacterized membrane-bound protein [Function u 96.29
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.19
PF1337173 TPR_9: Tetratricopeptide repeat 96.14
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.09
COG4700251 Uncharacterized protein conserved in bacteria cont 96.04
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.96
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.92
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.79
PRK10803263 tol-pal system protein YbgF; Provisional 95.75
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.69
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.62
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.6
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.55
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.47
KOG20411189 consensus WD40 repeat protein [General function pr 95.41
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.27
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.11
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.04
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.99
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.98
PRK15331165 chaperone protein SicA; Provisional 94.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.76
COG3898531 Uncharacterized membrane-bound protein [Function u 94.73
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.68
KOG3941406 consensus Intermediate in Toll signal transduction 94.67
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.63
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.56
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.54
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.48
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.42
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.25
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.24
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.11
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.08
KOG3941406 consensus Intermediate in Toll signal transduction 94.05
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.01
KOG1585308 consensus Protein required for fusion of vesicles 93.97
PF13512142 TPR_18: Tetratricopeptide repeat 93.89
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.86
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.79
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.49
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.42
PRK11906458 transcriptional regulator; Provisional 93.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.26
smart00299140 CLH Clathrin heavy chain repeat homology. 93.16
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.15
PRK11906458 transcriptional regulator; Provisional 93.09
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.84
KOG4555175 consensus TPR repeat-containing protein [Function 92.79
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.39
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.98
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.95
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.88
COG0457291 NrfG FOG: TPR repeat [General function prediction 91.84
COG0457291 NrfG FOG: TPR repeat [General function prediction 91.82
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.65
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.49
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.34
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.19
COG3629280 DnrI DNA-binding transcriptional activator of the 91.12
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.79
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.76
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.69
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.67
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 90.67
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.31
PF1343134 TPR_17: Tetratricopeptide repeat 90.04
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.96
COG3947361 Response regulator containing CheY-like receiver a 89.73
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.7
PRK09687280 putative lyase; Provisional 89.64
KOG4234271 consensus TPR repeat-containing protein [General f 89.57
PF1342844 TPR_14: Tetratricopeptide repeat 89.36
KOG4555175 consensus TPR repeat-containing protein [Function 89.15
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.1
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.82
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.72
COG3629280 DnrI DNA-binding transcriptional activator of the 88.57
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.67
KOG2610491 consensus Uncharacterized conserved protein [Funct 87.51
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.4
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.34
KOG1941518 consensus Acetylcholine receptor-associated protei 87.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.68
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.67
PF13512142 TPR_18: Tetratricopeptide repeat 86.62
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.09
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 85.92
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 85.71
KOG1941518 consensus Acetylcholine receptor-associated protei 85.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.32
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 85.19
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.09
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.9
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.78
KOG1585308 consensus Protein required for fusion of vesicles 84.31
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 83.46
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.44
PF13170297 DUF4003: Protein of unknown function (DUF4003) 82.6
PRK09687280 putative lyase; Provisional 82.34
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.23
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.18
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 81.23
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 81.0
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.56
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 80.17
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.3e-111  Score=899.47  Aligned_cols=530  Identities=37%  Similarity=0.655  Sum_probs=495.7

Q ss_pred             CCcchHHHHHHHHHhCCCchHHHHHHHHHHHCC-CCCChhhHHHHHHHhhccCCcHHHHHHHHHHHHhCCCCCChhHHHH
Q 038673           15 KNPFLWTALIRGYILQGHLKDSISLYCSMRREG-IGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNT   93 (548)
Q Consensus        15 ~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g-~~p~~~~~~~ll~a~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~   93 (548)
                      ++..+|+.+|.+|.+.|++++|+++|+.|...+ +.||..+|+.++.+|++.++++.+.++|..|.+.| +.||..+||.
T Consensus        85 ~~~~~~~~~i~~l~~~g~~~~Al~~f~~m~~~~~~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g-~~~~~~~~n~  163 (697)
T PLN03081         85 KSGVSLCSQIEKLVACGRHREALELFEILEAGCPFTLPASTYDALVEACIALKSIRCVKAVYWHVESSG-FEPDQYMMNR  163 (697)
T ss_pred             CCceeHHHHHHHHHcCCCHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhC-CCcchHHHHH
Confidence            355678888888888888888888888887654 67888888888888888888888888888888887 8888888888


Q ss_pred             HHHHHHHcCChHHHHHHHccCCCCCeehHHHHHHHHHhCCChHHHHHH--------------------------------
Q 038673           94 MIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVAYANNGDMESAGGL--------------------------------  141 (548)
Q Consensus        94 li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~li~~~~~~g~~~~A~~~--------------------------------  141 (548)
                      |+++|+++|++++|.++|++|++||.++||++|.+|++.|++++|.++                                
T Consensus       164 Li~~y~k~g~~~~A~~lf~~m~~~~~~t~n~li~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~  243 (697)
T PLN03081        164 VLLMHVKCGMLIDARRLFDEMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAG  243 (697)
T ss_pred             HHHHHhcCCCHHHHHHHHhcCCCCCeeeHHHHHHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHH
Confidence            888888888888888888888887777777777777666666666555                                


Q ss_pred             --------------------------------------HccCCCCChhHHHHHHHHHHHCCChhHHHHHHHHHHHCCCCC
Q 038673          142 --------------------------------------FNELPLKDKVAWTAMVTGYVQNAKPREAIEYFERMQYAGVET  183 (548)
Q Consensus       142 --------------------------------------f~~m~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p  183 (548)
                                                            |++|.++|+++||+||.+|++.|++++|+++|++|.+.|+.|
T Consensus       244 ~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~p  323 (697)
T PLN03081        244 QQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSI  323 (697)
T ss_pred             HHHHHHHHHhCCCccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCC
Confidence                                                  555566789999999999999999999999999999999999


Q ss_pred             CHhhHHHHHHHHHccCChhHHHHHHHHHHHcCCCCCChHhHHHHHHHHHhcCCCHHHHHHHHhcCCCCChhhhHHHHHHH
Q 038673          184 DYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQRNVFSYSSMILGF  263 (548)
Q Consensus       184 ~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~  263 (548)
                      |..||++++.+|++.|++++|.++|+.|.+.|+.|  +..++++|+++|+++|++++|.++|++|.++|+.+||+||.+|
T Consensus       324 d~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~--d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y  401 (697)
T PLN03081        324 DQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPL--DIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGY  401 (697)
T ss_pred             CHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCC--CeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHH
Confidence            99999999999999999999999999999999995  9999999999999999999999999999999999999999999


Q ss_pred             HhcCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHhhcCC------------ccCCCCcCHHHHHHHHHHHHHcCCHHHH
Q 038673          264 AMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGL------------KCYGVSPSTDHYACMVDLLGRAGCLEEA  331 (548)
Q Consensus       264 ~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~------------~~~~~~p~~~~~~~li~~~~~~g~~~~A  331 (548)
                      +++|+.++|+++|++|.+.|+.||..||+++|.+|++.|.            .++|+.|+..+|++|+++|++.|++++|
T Consensus       402 ~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA  481 (697)
T PLN03081        402 GNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEA  481 (697)
T ss_pred             HHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHH
Confidence            9999999999999999999999999999999999999996            4579999999999999999999999999


Q ss_pred             HHHHHhCCCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHhhcCCCCchhHHHHHHHHHHcCCchHHHHHHHHHHhCCCcc
Q 038673          332 LKMVEKMPVEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMTGLKK  411 (548)
Q Consensus       332 ~~~~~~m~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~g~~~  411 (548)
                      .+++++|+.+|+..+|++|+.+|..+|+++.|+.+++++.++.|++..+|..|+++|++.|+|++|.++++.|+++|+++
T Consensus       482 ~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k  561 (697)
T PLN03081        482 YAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSM  561 (697)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeEEEccCCeEEEEEeCCCCCCChHHHHHHHHHHHHHHHHCCcccCCccccccCChHHHhhhhhhhhHHHHHHHhcc
Q 038673          412 NPGYSWLEGDRGVIHEFRAGDLTHPNSTEIQQALGDLLDRLQADGYQPNLRSVLYDVSDEEKKRILMTHSEKLALAFGLL  491 (548)
Q Consensus       412 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~m~~~g~~pd~~~~~~~~~~~~~~~~~~~~~e~la~~~~~~  491 (548)
                      .|++|||+++ +++|.|++|+..||+.++|++.+.++..+|++.||.||+.++++++++++|+..+.+||||||++||++
T Consensus       562 ~~g~s~i~~~-~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l~  640 (697)
T PLN03081        562 HPACTWIEVK-KQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLI  640 (697)
T ss_pred             CCCeeEEEEC-CeEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhCc
Confidence            9999999999 999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcEEEEecccccCCCcchhhhhhhhcCceEEEecCCcccccccccccCCCCC
Q 038673          492 TTSPGATVRIMKNLRICEDCHLFMCGASQVIGREIVVRDNMRFHHFQDGKCSCGNYW  548 (548)
Q Consensus       492 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~g~~s~~~~w  548 (548)
                      ++|+|.||||+||||+|+|||+|+|+||++.+|+|||||.+|||||+||+|||+|||
T Consensus       641 ~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        641 NTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             cCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            999999999999999999999999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query548
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 49.0 bits (115), Expect = 4e-06
 Identities = 15/121 (12%), Positives = 37/121 (30%), Gaps = 32/121 (26%)

Query: 227 ALIDMYSKCGSIDDAYRIFVGMKQR-------NVFSYSSMILGFAMHGRAHAAIQLFGDM 279
           A          +  A+ + V    +        +  Y++++LG+A  G     + +   +
Sbjct: 132 AFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMV 191

Query: 280 VKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEAL-KMVEKM 338
                 P+ ++                        YA  +  +GR       + + +E+M
Sbjct: 192 KDAGLTPDLLS------------------------YAAALQCMGRQDQDAGTIERCLEQM 227

Query: 339 P 339
            
Sbjct: 228 S 228


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query548
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.6
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.57
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.53
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.45
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.45
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.45
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.41
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.4
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.37
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.37
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.27
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.15
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.04
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.02
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.0
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.0
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.97
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.92
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.88
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.87
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.85
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.82
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.8
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.69
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.67
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.65
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.61
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.59
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.56
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.56
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.54
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.53
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.47
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.46
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.42
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.42
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.42
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.38
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.37
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.33
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.33
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.32
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.28
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.28
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.27
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.26
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.26
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.25
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.25
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.23
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.22
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.2
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.18
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.12
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.1
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.08
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.07
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.03
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.01
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.01
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.0
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.98
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.96
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.92
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.91
3k9i_A117 BH0479 protein; putative protein binding protein, 97.91
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.9
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.9
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.88
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.83
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.82
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.81
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.8
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.74
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.73
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.72
3k9i_A117 BH0479 protein; putative protein binding protein, 97.7
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.66
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.65
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.62
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.61
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.6
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.48
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.38
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.32
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.28
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.27
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.24
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.22
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.92
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.88
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.88
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.72
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.64
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.4
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.26
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.22
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.18
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.91
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.51
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.33
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.25
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.63
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.21
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.68
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.1
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.87
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.72
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.26
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.12
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.55
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.23
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 90.14
2uwj_G115 Type III export protein PSCG; virulence, chaperone 90.06
2p58_C116 Putative type III secretion protein YSCG; type III 89.9
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 89.42
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 89.37
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.8
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.66
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.48
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 87.61
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 86.5
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.81
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 84.78
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 82.83
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 82.76
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 82.01
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.57
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.64
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 80.43
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.02
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6.1e-36  Score=316.90  Aligned_cols=395  Identities=10%  Similarity=-0.028  Sum_probs=339.3

Q ss_pred             cchHHHhccCCCCCcchHHHHHHHHHhCCCchHHHHHHHHHHHCCCCCChhhHHHHHHHhhccCCcHHHHHHHHHHHHhC
Q 038673            3 SFPRLVFEQVKYKNPFLWTALIRGYILQGHLKDSISLYCSMRREGIGPVSFTLSALFKACTEVLDVSLGQQIHAQTILLG   82 (548)
Q Consensus         3 ~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~a~~~~~~~~~a~~~~~~~~~~~   82 (548)
                      ..++..|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..|+..++..++.+|...|++++|..+++.+..  
T Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~--  145 (597)
T 2xpi_A           70 LKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDL--  145 (597)
T ss_dssp             ------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCG--
T ss_pred             CCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhc--
Confidence            4567888999989999999999999999999999999999985  568889999999999999999999999998765  


Q ss_pred             CCCCChhHHHHHHHHHHHcCChHHHHHHHccCCCC-------------------CeehHHHHHHHHHhCCChHHHHHHHc
Q 038673           83 GFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPER-------------------DVVSWTELIVAYANNGDMESAGGLFN  143 (548)
Q Consensus        83 ~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~-------------------~~~~~~~li~~~~~~g~~~~A~~~f~  143 (548)
                       .+++..+++.++.+|.++|++++|.++|+++...                   +..+|+.++.+|.+.|++++|.++|+
T Consensus       146 -~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~  224 (597)
T 2xpi_A          146 -YNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYK  224 (597)
T ss_dssp             -GGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             -cccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence             4688999999999999999999999999965433                   47899999999999999999988876


Q ss_pred             cCC------------------------------------------------------------------------C--CC
Q 038673          144 ELP------------------------------------------------------------------------L--KD  149 (548)
Q Consensus       144 ~m~------------------------------------------------------------------------~--~~  149 (548)
                      +|.                                                                        .  ++
T Consensus       225 ~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~  304 (597)
T 2xpi_A          225 EALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKS  304 (597)
T ss_dssp             HHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGC
T ss_pred             HHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCch
Confidence            652                                                                        1  46


Q ss_pred             hhHHHHHHHHHHHCCChhHHHHHHHHHHHCCCCCCHhhHHHHHHHHHccCChhHHHHHHHHHHHcCCCCCChHhHHHHHH
Q 038673          150 KVAWTAMVTGYVQNAKPREAIEYFERMQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALI  229 (548)
Q Consensus       150 ~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~~~li  229 (548)
                      ..+|+.++.+|.+.|++++|+.+|+++.+.+ +.+..++..++.++...|++++|.++++.+.+...   .+..+++.++
T Consensus       305 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~---~~~~~~~~l~  380 (597)
T 2xpi_A          305 SDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHP---EKAVTWLAVG  380 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCT---TSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCc---ccHHHHHHHH
Confidence            6788889999999999999999999998765 44677889999999999999999999999987654   3889999999


Q ss_pred             HHHhcCCCHHHHHHHHhcCC---CCChhhhHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHhhcCC---
Q 038673          230 DMYSKCGSIDDAYRIFVGMK---QRNVFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGL---  303 (548)
Q Consensus       230 ~~y~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~---  303 (548)
                      .+|.++|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|++|.+. .+++..++..+..+|.+.|.   
T Consensus       381 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~g~~~~  459 (597)
T 2xpi_A          381 IYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARL-FQGTHLPYLFLGMQHMQLGNILL  459 (597)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHT-TTTCSHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh-CccchHHHHHHHHHHHHcCCHHH
Confidence            99999999999999999876   356789999999999999999999999999985 34477899999999999987   


Q ss_pred             ------ccC-CCCcCHHHHHHHHHHHHHcCCHHHHHHHHHhC-------CCCCC--hhHHHHHHHHHHhcCCHHHHHHHH
Q 038673          304 ------KCY-GVSPSTDHYACMVDLLGRAGCLEEALKMVEKM-------PVEPN--GGVWGALLGACQIHRNPEIAQIAA  367 (548)
Q Consensus       304 ------~~~-~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m-------~~~p~--~~~~~~ll~~~~~~~~~~~a~~~~  367 (548)
                            ... ..+.+..+|+.++.+|.+.|++++|.++|+++       +..|+  ..+|..+..+|.+.|++++|...+
T Consensus       460 A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~  539 (597)
T 2xpi_A          460 ANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDAL  539 (597)
T ss_dssp             HHHHHHHHHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHH
Confidence                  111 12346889999999999999999999999988       34677  789999999999999999999999


Q ss_pred             HHHhhcCCCCchhHHHHHHHHHHcCCchHHHHHHHHHHhC
Q 038673          368 NHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKMT  407 (548)
Q Consensus       368 ~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~  407 (548)
                      +++.+..|+++.+|..++.+|.+.|++++|.++++++.+.
T Consensus       540 ~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          540 NQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             HHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence            9999999999999999999999999999999999999764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query548
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.05
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.91
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.84
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.81
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.42
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.37
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.3
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.3
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.28
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.2
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.0
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.92
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.82
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.76
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.73
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.7
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.68
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.66
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.6
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.37
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.01
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.89
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.88
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.85
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.79
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.29
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.59
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.53
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.84
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.07
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.43
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 90.03
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.91
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.24
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 84.0
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 81.23
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=5e-20  Score=180.29  Aligned_cols=351  Identities=13%  Similarity=0.055  Sum_probs=279.5

Q ss_pred             HHHHHHhCCCchHHHHHHHHHHHCCCCC-ChhhHHHHHHHhhccCCcHHHHHHHHHHHHhCCCCCChhHHHHHHHHHHHc
Q 038673           23 LIRGYILQGHLKDSISLYCSMRREGIGP-VSFTLSALFKACTEVLDVSLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKC  101 (548)
Q Consensus        23 li~~~~~~g~~~~A~~~~~~m~~~g~~p-~~~~~~~ll~a~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~li~~~~~~  101 (548)
                      +...+.+.|++++|++.|+++.+.  .| +...+..+...+...|++++|...++.+++..  |.+..++..+..+|.+.
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~--~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~--p~~~~a~~~l~~~~~~~   80 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQ--EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN--PLLAEAYSNLGNVYKER   80 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHhhhh
Confidence            345577889999999999999875  35 56778888889999999999999999999986  67788999999999999


Q ss_pred             CChHHHHHHHccCCC---CCeehHHHHHHHHHhCCChHHHHHHHccC---CCCChhHHHHHHHHHHHCCChhHHHHHHHH
Q 038673          102 GFLGCSRKVFDEMPE---RDVVSWTELIVAYANNGDMESAGGLFNEL---PLKDKVAWTAMVTGYVQNAKPREAIEYFER  175 (548)
Q Consensus       102 g~~~~A~~~~~~m~~---~~~~~~~~li~~~~~~g~~~~A~~~f~~m---~~~~~~~~~~li~~~~~~g~~~~A~~l~~~  175 (548)
                      |++++|...+....+   .+...+..........+....+.......   ..................+....+...+.+
T Consensus        81 g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          81 GQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHH
Confidence            999999999988765   23333444444444444444444433322   233455666667777788888888888887


Q ss_pred             HHHCCCCCCHhhHHHHHHHHHccCChhHHHHHHHHHHHcCCCCCChHhHHHHHHHHHhcCCCHHHHHHHHhcCCC---CC
Q 038673          176 MQYAGVETDYVTLVGVISACAQLGVIKYANWVCEIAEGSGFGPINNVVVGSALIDMYSKCGSIDDAYRIFVGMKQ---RN  252 (548)
Q Consensus       176 m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~---~~  252 (548)
                      ..... +-+...+..+...+...|+++.|...+..+.+..+.   +..++..+...|...|++++|...|++...   .+
T Consensus       161 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~---~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~  236 (388)
T d1w3ba_         161 AIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN---FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH  236 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTC
T ss_pred             hhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc---cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhH
Confidence            76653 335566777788888999999999999998887644   788899999999999999999999987653   45


Q ss_pred             hhhhHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHhhcCCccCCCCcCHHHHHHHHHHHHHcCCHHHHH
Q 038673          253 VFSYSSMILGFAMHGRAHAAIQLFGDMVKTETKPNGVTFIGVLTACSHVGLKCYGVSPSTDHYACMVDLLGRAGCLEEAL  332 (548)
Q Consensus       253 ~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~  332 (548)
                      ...|..+...+...|++++|+..|++..+  +.|+                       +..++..+...+...|++++|.
T Consensus       237 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~-----------------------~~~~~~~l~~~~~~~~~~~~A~  291 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPH-----------------------FPDAYCNLANALKEKGSVAEAE  291 (388)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSS-----------------------CHHHHHHHHHHHHHHSCHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCC-----------------------CHHHHHHHHHHHHHcCCHHHHH
Confidence            66788888899999999999999999887  4454                       3456788888999999999999


Q ss_pred             HHHHhCC--CCCChhHHHHHHHHHHhcCCHHHHHHHHHHHhhcCCCCchhHHHHHHHHHHcCCchHHHHHHHHHHh
Q 038673          333 KMVEKMP--VEPNGGVWGALLGACQIHRNPEIAQIAANHLFELEPDKIGNYIILSNIYASAGMWDDVSRVRRLLKM  406 (548)
Q Consensus       333 ~~~~~m~--~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~  406 (548)
                      +.++...  ...+...+..+...+...|++++|...++++++..|+++.++..++.+|.+.|++++|.+.+++..+
T Consensus       292 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         292 DCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9988764  3345777888888899999999999999999999999999999999999999999999999988764



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure