Citrus Sinensis ID: 039096

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550----
WRATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINARPTPD
cccccEEEEEEcccccccccccccccccEEEcccccccccccccccccccccHHHHHHHHHcccccccccHHHHHcccccccEEEEEcccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHcccccccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHccccccEEEccccccccccHHHHHHHHHccccccccccccccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHcHHccEEEEccccccccHHHHHHHHHHHHccccEEEcccccccccccHHHHcccccHHHHHcccccccccccHHHcccccccHHHHcccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccEEcccHHHHHHHHHcccccc
cccccEEEEEccccccccccccccccEcEccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHcHcccccccccEEEcccccHHHHHHcHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHccccEEEEEEEccHHHHccccccccccccccHHHHcHHHHHHHHHHcHHHHHHEEEcccccccccHHHHHHHHcccccHEEEHHHHHHHHHHccccccccccHHHHHHHHcccHcccEEEEccccHHcHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccccccHHHHHHHccEEEcHHHHccHHHHcccccccccEEEEEEEEcccccccccccccEEccHHHccccHHcEEEEcccccEEEEcccccccccccHHHHHHHHcccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHcccccccccccccEEEccHHHHHHHHHHcccccc
wratrtsitlrgnacnlnivPLCFDAVtnlqlsnispwghsllfspssssmdPRLLADLLQMSFLCfgaefvpllkhckcltsvdlssfyhwtedlppvlkaypdksaILTCLNLLktsfsedyrpQEIIEIIAARPNLNKWAVSIatncprltLLHLAETSTlaamrgdpdddgftaedARISEEGLIQLFSGLPLLEELALDvgknvrdsgsasEALKSKCvnlkglklgQLHSWLESLsikncgdlsdmSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCenlgavasckaLKPIRDRIQKLHIDCVWDGIrsseakatgntstiFSKTRWKSLKELSFWIEVGelltplpvagldecpilenirikmegdtrekpllrddkawglscltryprlsklvldfgdtdghnqaapykaadlstwDRFVLNGIGNlilkeldywpakdpnasqRSLSRLAAALISNCITLRKVFVHCTAREHFMsmlisptpnpkkardaqikldyypppdaddssteirigshhrfedainarptpd
wratrtsitlrgnacnlNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIrsseakatgntstifsktrWKSLKELSFWIEVGELLTPLPVAGLDECPILENirikmegdtrekpllrddkawglscLTRYPRLSKLVLDFGDTDGHNQAApykaadlstwDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMsmlisptpnpKKARDAQIKLDYYPPPDADDSSTEIRigshhrfedainarptpd
WRATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHsllfspssssMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNasqrslsrlaaalisNCITLRKVFVHCTAREHFMSMLISPTPNPKKARDAQIKLdyypppdaddSSTEIRIGSHHRFEDAINARPTPD
*******ITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFS********RLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLA*****************ISEEGLIQLFSGLPLLEELALDVGKNV*********LKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAK********LSRLAAALISNCITLRKVFVHCTAREHFMSMLI**************************************************
*RATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPN****SLSRLAAALISNCITLRKVFVHCTAREHFMSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINAR****
********TLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGK**********ALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMSMLISP********DAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINARPTPD
*RATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIR************IFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINAR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WRATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPLLKHCKCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWAVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINARPTPD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query554 2.2.26 [Sep-21-2011]
Q9SIM9693 F-box protein ORE9 OS=Ara yes no 0.981 0.784 0.453 1e-142
Q5VMP0720 F-box/LRR-repeat MAX2 hom yes no 0.922 0.709 0.381 4e-95
Q9C5D2610 F-box/LRR-repeat protein no no 0.478 0.434 0.232 4e-05
Q5BJ29491 F-box/LRR-repeat protein yes no 0.296 0.334 0.264 0.0001
Q9UJT9491 F-box/LRR-repeat protein yes no 0.296 0.334 0.264 0.0001
Q9QZH7276 F-box/LRR-repeat protein no no 0.292 0.586 0.252 0.0002
Q9S9X4554 Putative F-box/LRR-repeat no no 0.272 0.272 0.295 0.0003
>sp|Q9SIM9|ORE9_ARATH F-box protein ORE9 OS=Arabidopsis thaliana GN=ORE9 PE=1 SV=2 Back     alignment and function desciption
 Score =  504 bits (1299), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 300/661 (45%), Positives = 397/661 (60%), Gaps = 117/661 (17%)

Query: 2   RATRTSITLRGNACNLNIVPLCFDAVTNLQLSNISPWGHSLL------------------ 43
           R+TR+ +T+RGNA +L++VP CF ++++L LS +SPWGH+LL                  
Sbjct: 42  RSTRSHLTIRGNARDLSLVPDCFRSISHLDLSFLSPWGHTLLASLPIDHQNLLALRLKFC 101

Query: 44  ---------FSPSSSSMD------PR-----LLADLLQMSFLCFGAEFVPLLKHCK-CLT 82
                    ++ S SS++      PR     LL    + S +  G +FVP+ +HC   L 
Sbjct: 102 FPFVESLNVYTRSPSSLELLLPQWPRIRHIKLLRWHQRASQIPTGGDFVPIFEHCGGFLE 161

Query: 83  SVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKW 142
           S+DLS+FYHWTEDLPPVL  Y D +A LT L+LL  SF+E Y+  EI+ I  + PNL  +
Sbjct: 162 SLDLSNFYHWTEDLPPVLLRYADVAARLTRLDLLTASFTEGYKSSEIVSITKSCPNLKTF 221

Query: 143 AVS------------------IATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARIS 184
            V+                  +AT+ P+LTLLH+ +T++LA  R  P   G  A D+ ++
Sbjct: 222 RVACTFDPRYFEFVGDETLSAVATSSPKLTLLHMVDTASLANPRAIP---GTEAGDSAVT 278

Query: 185 EEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHS------W- 237
              LI++FSGLP LEEL LDVGK+V+ SG A EAL SKC  L+ LKLGQ         W 
Sbjct: 279 AGTLIEVFSGLPNLEELVLDVGKDVKHSGVALEALNSKCKKLRVLKLGQFQGVCSATEWR 338

Query: 238 ----------LESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLL 287
                     L+SLSIKN GDL+DM LVAIGRGC KL  FE++GC+N+TVDGLRT+ SL 
Sbjct: 339 RLDGVALCGGLQSLSIKNSGDLTDMGLVAIGRGCCKLTTFEIQGCENVTVDGLRTMVSLR 398

Query: 288 RETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWDG---------IRSSEAK-- 336
            +TL  ++I CC+NL   AS KA++PI DRI++LHIDCVW G         + +SEA   
Sbjct: 399 SKTLTDVRISCCKNLDTAASLKAIEPICDRIKRLHIDCVWSGSEDEEVEGRVETSEADHE 458

Query: 337 ----------------------ATGNTSTIFSKTR-WKSLKELSFWIEVGELLTPLPVAG 373
                                 +T + +   S+ R W+ L+ LS WI VGE LTPLP+ G
Sbjct: 459 EEDDGYERSQKRCKYSFEEEHCSTSDVNGFCSEDRVWEKLEYLSLWINVGEFLTPLPMTG 518

Query: 374 LDECPILENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPY 433
           LD+CP LE IRIK+EGD R K    + + +GLSCL  YP+LSK+ LD GDT G    AP 
Sbjct: 519 LDDCPNLEEIRIKIEGDCRGKRRPAEPE-FGLSCLALYPKLSKMQLDCGDTIGFALTAPP 577

Query: 434 KAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHC 493
              DLS W+RF L GIG+L L ELDYWP +D + +QRSLS   A L+  C+TLRK+F+H 
Sbjct: 578 MQMDLSLWERFFLTGIGSLSLSELDYWPPQDRDVNQRSLSLPGAGLLQECLTLRKLFIHG 637

Query: 494 TAREHFMSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINARPTP 553
           TA EHFM+ L+   PN    RD Q++ DYYP P+ +D STE+R+GS  RFED +N+R   
Sbjct: 638 TAHEHFMNFLLR-IPN---LRDVQLRADYYPAPE-NDMSTEMRVGSCSRFEDQLNSRNII 692

Query: 554 D 554
           D
Sbjct: 693 D 693
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the senescence. Contributes to the selective repression of axillary shoots and moderates the branching by regulating negatively the auxin transport in primary stems, in an AXR1-independent manner.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5VMP0|MAX2_ORYSJ F-box/LRR-repeat MAX2 homolog OS=Oryza sativa subsp. japonica GN=D3 PE=2 SV=2 Back     alignment and function description
>sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 Back     alignment and function description
>sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9X4|FBL8_ARATH Putative F-box/LRR-repeat protein 8 OS=Arabidopsis thaliana GN=FBL8 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query554
302143426 696 unnamed protein product [Vitis vinifera] 0.969 0.771 0.486 1e-154
147810398 712 hypothetical protein VITISV_001981 [Viti 0.969 0.754 0.471 1e-152
255575295 695 F-box/leucine rich repeat protein, putat 0.983 0.784 0.470 1e-152
224128748 694 f-box family protein [Populus trichocarp 0.978 0.780 0.457 1e-149
449438510 715 PREDICTED: F-box protein ORE9-like [Cucu 0.974 0.755 0.436 1e-143
449479133 715 PREDICTED: F-box protein ORE9-like [Cucu 0.974 0.755 0.436 1e-143
329739343 708 MAX2A [Petunia x hybrida] 0.981 0.768 0.449 1e-143
312282253 701 unnamed protein product [Thellungiella h 0.978 0.773 0.446 1e-142
297824229 694 hypothetical protein ARALYDRAFT_903635 [ 0.981 0.783 0.457 1e-141
18406017 693 F-box protein ORE9 [Arabidopsis thaliana 0.981 0.784 0.453 1e-140
>gi|302143426|emb|CBI21987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 317/651 (48%), Positives = 403/651 (61%), Gaps = 114/651 (17%)

Query: 2   RATRTSITLRGNAC--NLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADL 59
           R TRTS+TLRGN    NL ++P CF AVT+L LS +SPWGHSL+ SPSS   DP LLA L
Sbjct: 54  RGTRTSLTLRGNVVHNNLYMIPTCFRAVTHLDLSLLSPWGHSLI-SPSS---DPMLLAHL 109

Query: 60  LQMSF---------------------------------------LCFGAEFVPLLKHCKC 80
           L+ +F                                          G++F P+L+HC  
Sbjct: 110 LRHAFPMVTSLTVYARTPATLQLLAPQWPNLTHIKLVKWHQRSPSALGSDFDPILRHCTS 169

Query: 81  LTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLN 140
           LTSVDLS+FY+WTEDLPP L+A+P  +A LT L+L+  SF+E ++  EI+ I AA PNL 
Sbjct: 170 LTSVDLSNFYYWTEDLPPALQAHPATAAALTRLDLMTLSFAEGFKSHEILAITAACPNLQ 229

Query: 141 KW------------------AVSIATNCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDAR 182
           +                    V+IA+NCP LT+LHLA+T++L+  RGDP+++GF++EDA 
Sbjct: 230 QLLIACTFDPRYIGFVGDEAIVAIASNCPGLTVLHLADTASLSNGRGDPEEEGFSSEDAG 289

Query: 183 ISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSW----- 237
           IS   L  LFSGLPLL+EL LDV KNVRDSG+  E L S+C  L+ LKLG  H       
Sbjct: 290 ISTTALSGLFSGLPLLQELVLDVCKNVRDSGATLEMLNSRCPKLRVLKLGHFHGLCLAIG 349

Query: 238 -----------LESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASL 286
                      LESLSIKN  DL+DM L+AI RGCSKL KFE+ GCK +T  G+ T+A L
Sbjct: 350 SQLDGVALCQGLESLSIKNSADLTDMGLIAIARGCSKLAKFEIHGCKKVTWKGISTMACL 409

Query: 287 LRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWD------------------ 328
            R TLV  KI CC+NL AV++ + L+PIRDRIQ+LHIDC+WD                  
Sbjct: 410 RRSTLVEFKISCCKNLDAVSALRGLEPIRDRIQRLHIDCIWDRSEHIPSQDDDRFWDHEA 469

Query: 329 GIRSSEAKAT---------GNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPI 379
            I+  + K T          N + I SKT W+ L+ LS WI VGELL PL  AGLD+CP 
Sbjct: 470 SIKKKKRKYTTDLDASYEQNNGNGICSKT-WERLRCLSLWIGVGELLPPLAKAGLDDCPC 528

Query: 380 LENIRIKMEGDTREKPLLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLS 439
           LE I+IK+EGD RE+   +  + +GLS L RYPRLSK+ LD GDT G+   AP    DLS
Sbjct: 529 LEEIQIKVEGDCRERS--KPSQPFGLSSLMRYPRLSKMKLDCGDTIGYALTAPSGQTDLS 586

Query: 440 TWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHF 499
           TW+RF LNGI NL L ELDYWP +D + + RSLS  +A L++ C+TLRK+F+H TA EHF
Sbjct: 587 TWERFYLNGIKNLTLNELDYWPPQDKDVNHRSLSLPSAGLLAECVTLRKLFIHGTAHEHF 646

Query: 500 MSMLISPTPNPKKARDAQIKLDYYPPPDADDSSTEIRIGSHHRFEDAINAR 550
           M+ L++  PN    RD Q++ DYYP P+ +D STE+RI S  RFEDA+N R
Sbjct: 647 MTFLLA-IPN---LRDVQLREDYYPAPE-NDMSTEMRIDSCSRFEDALNRR 692

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147810398|emb|CAN59822.1| hypothetical protein VITISV_001981 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575295|ref|XP_002528551.1| F-box/leucine rich repeat protein, putative [Ricinus communis] gi|223532053|gb|EEF33863.1| F-box/leucine rich repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224128748|ref|XP_002320412.1| f-box family protein [Populus trichocarpa] gi|222861185|gb|EEE98727.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438510|ref|XP_004137031.1| PREDICTED: F-box protein ORE9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449479133|ref|XP_004155515.1| PREDICTED: F-box protein ORE9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|329739343|gb|AEB97384.1| MAX2A [Petunia x hybrida] Back     alignment and taxonomy information
>gi|312282253|dbj|BAJ33992.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297824229|ref|XP_002879997.1| hypothetical protein ARALYDRAFT_903635 [Arabidopsis lyrata subsp. lyrata] gi|297325836|gb|EFH56256.1| hypothetical protein ARALYDRAFT_903635 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18406017|ref|NP_565979.1| F-box protein ORE9 [Arabidopsis thaliana] gi|75265894|sp|Q9SIM9.2|ORE9_ARATH RecName: Full=F-box protein ORE9; AltName: Full=F-box/LRR-repeat protein 7; AltName: Full=Protein MORE AXILLARY BRANCHING 2; AltName: Full=Protein ORESARA 9 gi|15420162|gb|AAK97303.1|AF305597_1 F-box containing protein ORE9 [Arabidopsis thaliana] gi|20198073|gb|AAD22992.2| F-box protein ORE9, AtFBL7 [Arabidopsis thaliana] gi|330255055|gb|AEC10149.1| F-box protein ORE9 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query554
TAIR|locus:2041499693 MAX2 "AT2G42620" [Arabidopsis 0.375 0.300 0.469 6.6e-93
UNIPROTKB|Q5VMP0720 D3 "F-box/LRR-repeat MAX2 homo 0.362 0.279 0.402 3.3e-70
TAIR|locus:2143320642 AT5G27920 "AT5G27920" [Arabido 0.375 0.323 0.285 3.6e-05
TAIR|locus:2166978405 AT5G23340 [Arabidopsis thalian 0.460 0.629 0.264 0.00017
TAIR|locus:2040105628 EBF1 "AT2G25490" [Arabidopsis 0.211 0.186 0.320 0.00026
TAIR|locus:2124372554 VFB3 "AT4G07400" [Arabidopsis 0.366 0.366 0.26 0.00046
TAIR|locus:2041499 MAX2 "AT2G42620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 6.6e-93, Sum P(3) = 6.6e-93
 Identities = 101/215 (46%), Positives = 130/215 (60%)

Query:   337 ATGNTSTIFSKTR-WKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKMEGDTREKP 395
             +T + +   S+ R W+ L+ LS WI VGE LTPLP+ GLD+CP LE IRIK+EGD R K 
Sbjct:   481 STSDVNGFCSEDRVWEKLEYLSLWINVGEFLTPLPMTGLDDCPNLEEIRIKIEGDCRGKR 540

Query:   396 LLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILK 455
                + + +GLSCL  YP+LSK+ LD GDT G    AP    DLS W+RF L GIG+L L 
Sbjct:   541 RPAEPE-FGLSCLALYPKLSKMQLDCGDTIGFALTAPPMQMDLSLWERFFLTGIGSLSLS 599

Query:   456 ELDYWPAKDPNXXXXXXXXXXXXXXXNCITLRKVFVHCTAREHFMSMLISPTPNPKKARD 515
             ELDYWP +D +                C+TLRK+F+H TA EHFM+ L+   PN    RD
Sbjct:   600 ELDYWPPQDRDVNQRSLSLPGAGLLQECLTLRKLFIHGTAHEHFMNFLLR-IPN---LRD 655

Query:   516 AQIKLXXXXXXXXXXSSTEIRIGSHHRFEDAINAR 550
              Q++            STE+R+GS  RFED +N+R
Sbjct:   656 VQLR-ADYYPAPENDMSTEMRVGSCSRFEDQLNSR 689
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0000151 "ubiquitin ligase complex" evidence=IPI
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0007568 "aging" evidence=IMP
GO:0009934 "regulation of meristem structural organization" evidence=IMP
GO:0016567 "protein ubiquitination" evidence=TAS
GO:0019005 "SCF ubiquitin ligase complex" evidence=ISS
GO:0009414 "response to water deprivation" evidence=IGI
GO:0009926 "auxin polar transport" evidence=IMP
GO:0010016 "shoot system morphogenesis" evidence=IMP
GO:0009416 "response to light stimulus" evidence=IMP
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
UNIPROTKB|Q5VMP0 D3 "F-box/LRR-repeat MAX2 homolog" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040105 EBF1 "AT2G25490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124372 VFB3 "AT4G07400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018739001
SubName- Full=Putative uncharacterized protein (Chromosome chr12 scaffold_18, whole genome shotgun sequence); (712 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00019146001
SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (626 aa)
      • 0.428
GSVIVG00032423001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (563 aa)
      • 0.424

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query554
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-07
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 0.004
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information 
 Score = 51.2 bits (123), Expect = 3e-07
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 183 ISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLHSWLESLS 242
           I +EGLI L    P L+ L L   +N+ DSG  + A    C  L+ + LG+         
Sbjct: 65  IDDEGLIALAQSCPNLQVLDLRACENITDSGIVALAT--NCPKLQTINLGRH-------- 114

Query: 243 IKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENL 302
            +N   ++D+SL A+G+ C+ L      GC ++T  G+  LAS   ++L  + +  C NL
Sbjct: 115 -RNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNNCRNL 172

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 554
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
KOG4341483 consensus F-box protein containing LRR [General fu 99.88
KOG4341483 consensus F-box protein containing LRR [General fu 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.56
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
PLN032101153 Resistant to P. syringae 6; Provisional 99.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.36
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.28
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.24
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.78
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.66
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.61
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.32
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.21
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.08
KOG4237498 consensus Extracellular matrix protein slit, conta 98.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.93
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 97.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.79
KOG4237498 consensus Extracellular matrix protein slit, conta 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.48
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.41
KOG0617264 consensus Ras suppressor protein (contains leucine 97.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.06
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.99
KOG0617264 consensus Ras suppressor protein (contains leucine 96.95
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.79
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.37
PLN03150623 hypothetical protein; Provisional 95.83
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.33
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.25
KOG4308478 consensus LRR-containing protein [Function unknown 95.23
PLN03150623 hypothetical protein; Provisional 94.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.75
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.73
PRK15386426 type III secretion protein GogB; Provisional 94.61
PRK15386426 type III secretion protein GogB; Provisional 94.37
KOG4308478 consensus LRR-containing protein [Function unknown 94.14
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.69
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 92.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 91.07
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.73
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 84.6
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 81.63
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.90  E-value=3.4e-23  Score=237.11  Aligned_cols=436  Identities=17%  Similarity=0.113  Sum_probs=218.8

Q ss_pred             eeEEEEecCC--CchhchhhcCCCCcEEeccCCcccccccccCCCccCCCcccceeecccccccCcccHHHH--HhcCCC
Q 039096            5 RTSITLRGNA--CNLNIVPLCFDAVTNLQLSNISPWGHSLLFSPSSSSMDPRLLADLLQMSFLCFGAEFVPL--LKHCKC   80 (554)
Q Consensus         5 r~~L~l~~~~--~~l~~l~~~~~~L~~L~Ls~~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~l~~~--~~~~~~   80 (554)
                      .+.|+++++.  +.+......+++|+.|+|+++ .+.+..+  ..+...+.+|++|+++++      .+.+.  .+.+++
T Consensus        71 v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n-~~~~~ip--~~~~~~l~~L~~L~Ls~n------~l~~~~p~~~l~~  141 (968)
T PLN00113         71 VVSIDLSGKNISGKISSAIFRLPYIQTINLSNN-QLSGPIP--DDIFTTSSSLRYLNLSNN------NFTGSIPRGSIPN  141 (968)
T ss_pred             EEEEEecCCCccccCChHHhCCCCCCEEECCCC-ccCCcCC--hHHhccCCCCCEEECcCC------ccccccCccccCC
Confidence            4667777663  222223346889999999887 4443333  333336788888888733      22111  235778


Q ss_pred             CcEEEecCCCCCCCChhHHHhhcCcCCCCccEEEcCCCCCCCCCCHHHHHHHHHhCCChHhhH----------HHHhccC
Q 039096           81 LTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPNLNKWA----------VSIATNC  150 (554)
Q Consensus        81 L~~L~L~~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~i~~~~l~~l~~~~~~L~~L~----------~~~~~~~  150 (554)
                      |++|++++| .+...+|..+..+    ++|++|++++|.....+.     ..+.++++|+.|.          ......+
T Consensus       142 L~~L~Ls~n-~~~~~~p~~~~~l----~~L~~L~L~~n~l~~~~p-----~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l  211 (968)
T PLN00113        142 LETLDLSNN-MLSGEIPNDIGSF----SSLKVLDLGGNVLVGKIP-----NSLTNLTSLEFLTLASNQLVGQIPRELGQM  211 (968)
T ss_pred             CCEEECcCC-cccccCChHHhcC----CCCCEEECccCcccccCC-----hhhhhCcCCCeeeccCCCCcCcCChHHcCc
Confidence            888888876 4455666666655    588888888775322111     1224456666654          1112356


Q ss_pred             CCCCEEEecccccccccCCCCCCCCCccccCCCCHHHHHHHHhCCCCCcEEEecCCCCCCCchhhHHHHHhcCCCCcEee
Q 039096          151 PRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLK  230 (554)
Q Consensus       151 ~~L~~L~l~~c~~l~~~~~~~~~~g~~~~~~~i~~~~l~~l~~~~~~L~~L~L~~c~~l~~~~~~l~~l~~~~~~L~~L~  230 (554)
                      ++|+.|++++|                    .++...... ...+++|++|++++|. +++..+  ..+ .++++|+.|+
T Consensus       212 ~~L~~L~L~~n--------------------~l~~~~p~~-l~~l~~L~~L~L~~n~-l~~~~p--~~l-~~l~~L~~L~  266 (968)
T PLN00113        212 KSLKWIYLGYN--------------------NLSGEIPYE-IGGLTSLNHLDLVYNN-LTGPIP--SSL-GNLKNLQYLF  266 (968)
T ss_pred             CCccEEECcCC--------------------ccCCcCChh-HhcCCCCCEEECcCce-eccccC--hhH-hCCCCCCEEE
Confidence            77777777654                    112111111 2456777777776653 443322  244 5677777777


Q ss_pred             cccccC------------cccEEEecCCCCCCHHHHHHHHhcCCCCcEEEecCCCCCCHHHHHHHHHHhcCCccEEEEec
Q 039096          231 LGQLHS------------WLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYC  298 (554)
Q Consensus       231 l~~~~~------------~L~~L~l~~~~~l~~~~l~~l~~~~~~L~~L~L~~c~~i~~~~~~~l~~~~~~~L~~L~l~~  298 (554)
                      +.++.-            +|++|++++|. +.......+ ..+++|+.|++++|. +++..... ...+ ++|+.|++.+
T Consensus       267 L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~-l~~~~p~~~-~~l~~L~~L~l~~n~-~~~~~~~~-~~~l-~~L~~L~L~~  341 (968)
T PLN00113        267 LYQNKLSGPIPPSIFSLQKLISLDLSDNS-LSGEIPELV-IQLQNLEILHLFSNN-FTGKIPVA-LTSL-PRLQVLQLWS  341 (968)
T ss_pred             CcCCeeeccCchhHhhccCcCEEECcCCe-eccCCChhH-cCCCCCcEEECCCCc-cCCcCChh-HhcC-CCCCEEECcC
Confidence            765431            67777777765 443322222 336777777777766 33222111 2233 6777777777


Q ss_pred             cCCCChhHHHHHHhhcCCCccEEEeeeeeccccchhhhccCCccchhhhhcCCCCceEEeecccCCccCccccccCcCCC
Q 039096          299 CENLGAVASCKALKPIRDRIQKLHIDCVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECP  378 (554)
Q Consensus       299 c~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~~~~t~l~~~~l~~~~  378 (554)
                      |...+.   ++.....+++|+.|+++.+.+....+..+           ..+++|+.|++..+.   +++..+..+..++
T Consensus       342 n~l~~~---~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~-----------~~~~~L~~L~l~~n~---l~~~~p~~~~~~~  404 (968)
T PLN00113        342 NKFSGE---IPKNLGKHNNLTVLDLSTNNLTGEIPEGL-----------CSSGNLFKLILFSNS---LEGEIPKSLGACR  404 (968)
T ss_pred             CCCcCc---CChHHhCCCCCcEEECCCCeeEeeCChhH-----------hCcCCCCEEECcCCE---ecccCCHHHhCCC
Confidence            653311   11222335667777775554433333333           334444444444333   2222223334444


Q ss_pred             CCCEEEEeeeCCCCCCC--------------------CCCccccchhhhhccCCCccceeeecCCcccccccccccCCCC
Q 039096          379 ILENIRIKMEGDTREKP--------------------LLRDDKAWGLSCLTRYPRLSKLVLDFGDTDGHNQAAPYKAADL  438 (554)
Q Consensus       379 ~L~~L~l~~~~~c~~~~--------------------~l~~~~~~~l~~l~~~~~L~~L~l~c~~~~~~~~~~~~~~~~L  438 (554)
                      +|+.|++.   +|....                    .+.   ......+..+++|+.|+++.|.+.+..... ....+|
T Consensus       405 ~L~~L~L~---~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~---~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~-~~~~~L  477 (968)
T PLN00113        405 SLRRVRLQ---DNSFSGELPSEFTKLPLVYFLDISNNNLQ---GRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKRL  477 (968)
T ss_pred             CCCEEECc---CCEeeeECChhHhcCCCCCEEECcCCccc---CccChhhccCCCCcEEECcCceeeeecCcc-cccccc
Confidence            44444444   331111                    111   111112233455555555533333221111 011222


Q ss_pred             chhhhHhhc-------ccccc-eecccccCCCCCcCCcchhhhhHHHHHHHhccccceeeeccchhhHHHHhhhcCCCCC
Q 039096          439 STWDRFVLN-------GIGNL-ILKELDYWPAKDPNASQRSLSRLAAALISNCITLRKVFVHCTAREHFMSMLISPTPNP  510 (554)
Q Consensus       439 ~~l~~~~l~-------~~~~l-~L~~l~~~~~~~~~~~~~~~~lp~~~~l~~~~~L~~L~i~~~~~~~~~~~~~~~~~~~  510 (554)
                      ..++.....       .+..+ +|..++      .+.|...+.+|..  +.++++|+.|+++++............+++ 
T Consensus       478 ~~L~ls~n~l~~~~~~~~~~l~~L~~L~------Ls~N~l~~~~p~~--~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~-  548 (968)
T PLN00113        478 ENLDLSRNQFSGAVPRKLGSLSELMQLK------LSENKLSGEIPDE--LSSCKKLVSLDLSHNQLSGQIPASFSEMPV-  548 (968)
T ss_pred             eEEECcCCccCCccChhhhhhhccCEEE------CcCCcceeeCChH--HcCccCCCEEECCCCcccccCChhHhCccc-
Confidence            222211100       01111 122221      1223333455666  788889999998865544322222233777 


Q ss_pred             cccccccccccCCC
Q 039096          511 KKARDAQIKLDYYP  524 (554)
Q Consensus       511 ~~L~~l~l~~~~~~  524 (554)
                        |+.|++.++.+.
T Consensus       549 --L~~L~Ls~N~l~  560 (968)
T PLN00113        549 --LSQLDLSQNQLS  560 (968)
T ss_pred             --CCEEECCCCccc
Confidence              999999988763

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query554
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score = 68.8 bits (168), Expect = 2e-12
 Identities = 51/293 (17%), Positives = 95/293 (32%), Gaps = 58/293 (19%)

Query: 79  KCLTSVDLSSFYHWTEDLPPVLKAYPDKSAILTCLNLLKTSFSEDYRPQEIIEIIAARPN 138
            C     LS F+         L A     + LT LNL   +        ++++++   P 
Sbjct: 263 GCKELRCLSGFWDAVPAY---LPAVYSVCSRLTTLNLSYATVQSY----DLVKLLCQCPK 315

Query: 139 L----------NKWAVSIATNCPRLTLLHLAETSTLAAMRGDP-DDDGFTA--------- 178
           L          +     +A+ C  L  L +  +            + G  +         
Sbjct: 316 LQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLE 375

Query: 179 ----EDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASE-------ALKSKCVNLK 227
                  +++   LI +    P +    L + +         E       A+   C +L+
Sbjct: 376 SVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLR 435

Query: 228 GL------------KLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNI 275
            L             +G     +E LS+   G  SD+ +  +  GC  L K E+  C   
Sbjct: 436 RLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAG-DSDLGMHHVLSGCDSLRKLEIRDCPFG 494

Query: 276 TVDGLRTLASLLRETLVVIKIYCCENLGAVASCKALKPIRDRIQKLHIDCVWD 328
               L   AS L  T+  + +  C       S  A K +  ++ KL+++ + +
Sbjct: 495 D-KALLANASKLE-TMRSLWMSSCS-----VSFGACKLLGQKMPKLNVEVIDE 540
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query554
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.77
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.76
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.74
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.67
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.67
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.63
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.62
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.61
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.57
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.57
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.55
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.53
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.52
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.49
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.47
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.41
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.37
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.3
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.29
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.29
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.22
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.98
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.98
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.88
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.36
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.35
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.24
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.2
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.15
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.01
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.33
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.37
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.61
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.3
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
Probab=99.95  E-value=9.7e-27  Score=251.25  Aligned_cols=280  Identities=19%  Similarity=0.125  Sum_probs=185.2

Q ss_pred             HHhCCCCCcEEEecCCCCCCCchhhHHHHHhcCCCCcEeeccccc-----------CcccEEEecCCCCCCHHHHHHHHh
Q 039096          191 LFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKGLKLGQLH-----------SWLESLSIKNCGDLSDMSLVAIGR  259 (554)
Q Consensus       191 l~~~~~~L~~L~L~~c~~l~~~~~~l~~l~~~~~~L~~L~l~~~~-----------~~L~~L~l~~~~~l~~~~l~~l~~  259 (554)
                      ....+++|++|+++.+............+ ..+++|+.|.+....           .+|++|++++|. +++..+..+..
T Consensus       238 ~~~~~~~L~~L~l~~~~~~~~~~~~~~~l-~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~Ls~~~-l~~~~~~~~~~  315 (592)
T 3ogk_B          238 FFKAAANLEEFCGGSLNEDIGMPEKYMNL-VFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYAL-LETEDHCTLIQ  315 (592)
T ss_dssp             HHHHCTTCCEEEECBCCCCTTCTTSSSCC-CCCTTCCEEEETTCCTTTGGGGGGGGGGCCEEEETTCC-CCHHHHHHHHT
T ss_pred             HHhhhhHHHhhcccccccccchHHHHHHh-hccccccccCccccchhHHHHHHhhcCCCcEEecCCCc-CCHHHHHHHHH
Confidence            34455666666665432211111101122 455666666665432           189999999998 89988888778


Q ss_pred             cCCCCcEEEecCCCCCCHHHHHHHHHHhcCCccEEEEec----------cCCCChhHHHHHHhhcCCCccEEEeeeeecc
Q 039096          260 GCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYC----------CENLGAVASCKALKPIRDRIQKLHIDCVWDG  329 (554)
Q Consensus       260 ~~~~L~~L~L~~c~~i~~~~~~~l~~~~~~~L~~L~l~~----------c~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~  329 (554)
                      .+++|++|++.+  .+++.++..+...+ ++|++|++++          |..+ +..++..+...|++|++|++.++.++
T Consensus       316 ~~~~L~~L~L~~--~~~~~~l~~~~~~~-~~L~~L~L~~g~~~~~~~~~~~~~-~~~~~~~l~~~~~~L~~L~l~~~~l~  391 (592)
T 3ogk_B          316 KCPNLEVLETRN--VIGDRGLEVLAQYC-KQLKRLRIERGADEQGMEDEEGLV-SQRGLIALAQGCQELEYMAVYVSDIT  391 (592)
T ss_dssp             TCTTCCEEEEEG--GGHHHHHHHHHHHC-TTCCEEEEECCCCSSTTSSTTCCC-CHHHHHHHHHHCTTCSEEEEEESCCC
T ss_pred             hCcCCCEEeccC--ccCHHHHHHHHHhC-CCCCEEEeecCccccccccccCcc-CHHHHHHHHhhCccCeEEEeecCCcc
Confidence            899999999993  37889999988888 8999999995          8777 45567777778999999999888877


Q ss_pred             ccchhhhccCCccchhhhhcCCCCceEEeeccc-CCccCccccc-----cCcCCCCCCEEEEeeeCCCCCCCCCCccccc
Q 039096          330 IRSSEAKATGNTSTIFSKTRWKSLKELSFWIEV-GELLTPLPVA-----GLDECPILENIRIKMEGDTREKPLLRDDKAW  403 (554)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~-~~~~t~l~~~-----~l~~~~~L~~L~l~~~~~c~~~~~l~~~~~~  403 (554)
                      ...+..+          ...+++|++|++.+|. .+.+++.+..     .+.+|++|+.|+++   .|.  +.++   +.
T Consensus       392 ~~~~~~l----------~~~~~~L~~L~l~~~~~~n~l~~~p~~~~~~~~~~~~~~L~~L~L~---~~~--~~l~---~~  453 (592)
T 3ogk_B          392 NESLESI----------GTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFY---LRQ--GGLT---DL  453 (592)
T ss_dssp             HHHHHHH----------HHHCCSCCEEEEEECSCCSCCSSCCCHHHHHHHHHHCTTCCEEEEE---CCG--GGCC---HH
T ss_pred             HHHHHHH----------HhhCCCCcEEEEeecCCCccccCchHHHHHHHHHHhCCCCCEEEEe---cCC--CCcc---HH
Confidence            7777666          2569999999998543 2226654221     13679999999998   662  2456   77


Q ss_pred             hhhhhcc-CCCccceeeecCCcccccccccccCCCCchhhhHhhcccccceecccccCCCCCcCCcchhhhhHHHHHHHh
Q 039096          404 GLSCLTR-YPRLSKLVLDFGDTDGHNQAAPYKAADLSTWDRFVLNGIGNLILKELDYWPAKDPNASQRSLSRLAAALISN  482 (554)
Q Consensus       404 ~l~~l~~-~~~L~~L~l~c~~~~~~~~~~~~~~~~L~~l~~~~l~~~~~l~L~~l~~~~~~~~~~~~~~~~lp~~~~l~~  482 (554)
                      ++..++. +++|+.|+++++.+++.++...             ..++.+  |+.++.....   +..  ..++..  .+.
T Consensus       454 ~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~-------------~~~~~~--L~~L~l~~n~---l~~--~~~~~~--~~~  511 (592)
T 3ogk_B          454 GLSYIGQYSPNVRWMLLGYVGESDEGLMEF-------------SRGCPN--LQKLEMRGCC---FSE--RAIAAA--VTK  511 (592)
T ss_dssp             HHHHHHHSCTTCCEEEECSCCSSHHHHHHH-------------HTCCTT--CCEEEEESCC---CBH--HHHHHH--HHH
T ss_pred             HHHHHHHhCccceEeeccCCCCCHHHHHHH-------------HhcCcc--cCeeeccCCC---CcH--HHHHHH--HHh
Confidence            7777777 8999999999777876554331             111122  3333322221   111  112222  678


Q ss_pred             ccccceeeeccchh--hHHHHhhhcCCCCCcccccccccc
Q 039096          483 CITLRKVFVHCTAR--EHFMSMLISPTPNPKKARDAQIKL  520 (554)
Q Consensus       483 ~~~L~~L~i~~~~~--~~~~~~~~~~~~~~~~L~~l~l~~  520 (554)
                      +++|+.|+++++..  ..+..+... +|.   ++...+..
T Consensus       512 l~~L~~L~ls~n~it~~~~~~l~~~-~p~---l~~~~~~~  547 (592)
T 3ogk_B          512 LPSLRYLWVQGYRASMTGQDLMQMA-RPY---WNIELIPS  547 (592)
T ss_dssp             CSSCCEEEEESCBCCTTCTTGGGGC-CTT---EEEEEECC
T ss_pred             cCccCeeECcCCcCCHHHHHHHHHh-CCC---cEEEEecC
Confidence            99999999995543  333444445 787   66555544
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query554
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.37
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.35
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.02
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.55
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.51
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.48
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.19
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.04
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.03
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.0
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=1.4e-20  Score=180.77  Aligned_cols=220  Identities=18%  Similarity=0.231  Sum_probs=175.8

Q ss_pred             cCCCCCEEEecccccccccCCCCCCCCCccccCCCCHHHHHHHHhCCCCCcEEEecCCCCCCCchhhHHHHHhcCCCCcE
Q 039096          149 NCPRLTLLHLAETSTLAAMRGDPDDDGFTAEDARISEEGLIQLFSGLPLLEELALDVGKNVRDSGSASEALKSKCVNLKG  228 (554)
Q Consensus       149 ~~~~L~~L~l~~c~~l~~~~~~~~~~g~~~~~~~i~~~~l~~l~~~~~~L~~L~L~~c~~l~~~~~~l~~l~~~~~~L~~  228 (554)
                      ...+|++|++++|                    .+++..+..+...|++|++|++++|. +++..  +..+ ..+++|+ 
T Consensus        44 ~~~~L~~LdLs~~--------------------~i~~~~l~~l~~~c~~L~~L~L~~~~-l~~~~--~~~l-~~~~~L~-   98 (284)
T d2astb2          44 SPFRVQHMDLSNS--------------------VIEVSTLHGILSQCSKLQNLSLEGLR-LSDPI--VNTL-AKNSNLV-   98 (284)
T ss_dssp             CCBCCCEEECTTC--------------------EECHHHHHHHHTTBCCCSEEECTTCB-CCHHH--HHHH-TTCTTCS-
T ss_pred             cCCCCCEEECCCC--------------------ccCHHHHHHHHHhCCCcccccccccC-CCcHH--HHHH-hcCCCCc-
Confidence            3568999999874                    46788888889999999999999985 76655  5577 5677666 


Q ss_pred             eecccccCcccEEEecCCCCCCHHHHHHHHhcCCCCcEEEecCCCCCCHHHHHHHHHHhcCCccEEEEeccCCCChhHHH
Q 039096          229 LKLGQLHSWLESLSIKNCGDLSDMSLVAIGRGCSKLVKFEVEGCKNITVDGLRTLASLLRETLVVIKIYCCENLGAVASC  308 (554)
Q Consensus       229 L~l~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~~L~~L~L~~c~~i~~~~~~~l~~~~~~~L~~L~l~~c~~~~~~~~l  308 (554)
                                 +|++++|..+++.++..++.+|++|++|++++|..+++.++........++|+.|++++|....+..++
T Consensus        99 -----------~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l  167 (284)
T d2astb2          99 -----------RLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDL  167 (284)
T ss_dssp             -----------EEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHH
T ss_pred             -----------CccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccc
Confidence                       566777777999999999988999999999999999999987766554479999999998543356678


Q ss_pred             HHHhhcCCCccEEEee-eeeccccchhhhccCCccchhhhhcCCCCceEEeecccCCccCccccccCcCCCCCCEEEEee
Q 039096          309 KALKPIRDRIQKLHID-CVWDGIRSSEAKATGNTSTIFSKTRWKSLKELSFWIEVGELLTPLPVAGLDECPILENIRIKM  387 (554)
Q Consensus       309 ~~l~~~~~~L~~L~l~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~~~~t~l~~~~l~~~~~L~~L~l~~  387 (554)
                      ..+...||+|++|+++ |..+++..+..+           ..+++|++|++++|..  +++.....+..+|+|+.|++. 
T Consensus       168 ~~l~~~~~~L~~L~L~~~~~itd~~~~~l-----------~~~~~L~~L~L~~C~~--i~~~~l~~L~~~~~L~~L~l~-  233 (284)
T d2astb2         168 STLVRRCPNLVHLDLSDSVMLKNDCFQEF-----------FQLNYLQHLSLSRCYD--IIPETLLELGEIPTLKTLQVF-  233 (284)
T ss_dssp             HHHHHHCTTCSEEECTTCTTCCGGGGGGG-----------GGCTTCCEEECTTCTT--CCGGGGGGGGGCTTCCEEECT-
T ss_pred             cccccccccccccccccccCCCchhhhhh-----------cccCcCCEEECCCCCC--CChHHHHHHhcCCCCCEEeee-
Confidence            8888889999999995 556777777777           6899999999999987  777777778889999999997 


Q ss_pred             eCCCCCCCCCCccccchhhhhcc-CCCccceeeecCCcccccccc
Q 039096          388 EGDTREKPLLRDDKAWGLSCLTR-YPRLSKLVLDFGDTDGHNQAA  431 (554)
Q Consensus       388 ~~~c~~~~~l~~~~~~~l~~l~~-~~~L~~L~l~c~~~~~~~~~~  431 (554)
                        +|     ++   +.++..+.+ +|+|+   +.|+.+++.+...
T Consensus       234 --~~-----~~---d~~l~~l~~~lp~L~---i~~~~ls~~~~~~  265 (284)
T d2astb2         234 --GI-----VP---DGTLQLLKEALPHLQ---INCSHFTTIARPT  265 (284)
T ss_dssp             --TS-----SC---TTCHHHHHHHSTTSE---ESCCCSCCTTCSS
T ss_pred             --CC-----CC---HHHHHHHHHhCcccc---ccCccCCCCCCCc
Confidence              55     34   666777665 77654   5777777655444
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure