Citrus Sinensis ID: 039213

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
ARESKVPRRRTGRTEGPRKSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
cccccccccccccccccccccHHHHHHHHHHHHccccccccEEEEcccccccccEEEEEccccEEEEEEccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHcccEEEEEcccEEEcccccccEEEcccHHHcccccccccc
ccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccccHccccEEEEccccEEEEEEcccccccEEEEEEEEEEEcccccEEEEccccccccHEcHHHHHHHHcccEEEEEEcccEccccccccccEccccHHHccHHHHHHcc
areskvprrrtgrtegprksmEDSVQRKMEQFyegsngpplrvlpigglgeigmncmlvgnydryilidagdpgfgfqytNICIFIYngefniqqidespldgkvfDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
areskvprrrtgrtegprksmedsVQRKMEQfyegsngpplRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELskegvtlvikngemlgvshlrnrrvlsngfislgkenlqvil
ARESKVprrrtgrtegprKSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
****************************************LRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGK*******
************************************NGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVS***********FISLGKENLQVIL
**************************RKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
**********************DSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARESKVPRRRTGRTEGPRKSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGFQYTNICIFIYNGEFNIQQIDESPLDGKVFDREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSNGFISLGKENLQVIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
147856240 1616 hypothetical protein VITISV_026006 [Viti 0.435 0.042 0.897 3e-30
297734394 1659 unnamed protein product [Vitis vinifera] 0.416 0.039 0.897 5e-30
255540285 880 conserved hypothetical protein [Ricinus 0.416 0.073 0.882 7e-30
356507349 888 PREDICTED: ribonuclease J-like [Glycine 0.397 0.069 0.923 1e-29
356516571 874 PREDICTED: ribonuclease J-like [Glycine 0.442 0.078 0.873 1e-29
225456284 886 PREDICTED: ribonuclease J-like [Vitis vi 0.416 0.073 0.897 2e-29
9758283 528 unnamed protein product [Arabidopsis tha 0.455 0.134 0.830 2e-29
449501401 909 PREDICTED: LOW QUALITY PROTEIN: ribonucl 0.525 0.090 0.698 2e-29
449440566 909 PREDICTED: ribonuclease J-like [Cucumis 0.525 0.090 0.698 3e-29
297793923 927 EMB2746 [Arabidopsis lyrata subsp. lyrat 0.416 0.070 0.882 3e-29
>gi|147856240|emb|CAN81787.1| hypothetical protein VITISV_026006 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 61/68 (89%), Positives = 64/68 (94%)

Query: 4   SKVPRRRTGRTEGPRKSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYD 63
           SKVPR+R+ R EG +KSMEDSVQRKMEQFYEGS GPPLRVLPIGGLGEIGMNCMLVGNYD
Sbjct: 803 SKVPRKRSRRMEGVKKSMEDSVQRKMEQFYEGSEGPPLRVLPIGGLGEIGMNCMLVGNYD 862

Query: 64  RYILIDAG 71
           RYILIDAG
Sbjct: 863 RYILIDAG 870

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734394|emb|CBI15641.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540285|ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis] gi|223550322|gb|EEF51809.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356507349|ref|XP_003522430.1| PREDICTED: ribonuclease J-like [Glycine max] Back     alignment and taxonomy information
>gi|356516571|ref|XP_003526967.1| PREDICTED: ribonuclease J-like [Glycine max] Back     alignment and taxonomy information
>gi|225456284|ref|XP_002279798.1| PREDICTED: ribonuclease J-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|9758283|dbj|BAB08807.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449501401|ref|XP_004161356.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease J-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440566|ref|XP_004138055.1| PREDICTED: ribonuclease J-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297793923|ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata] gi|297310681|gb|EFH41105.1| EMB2746 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2167336 911 emb2746 "embryo defective 2746 0.339 0.058 0.924 2.1e-36
TIGR_CMR|CHY_1157 554 CHY_1157 "metallo-beta-lactama 0.198 0.055 0.548 2.7e-06
TIGR_CMR|NSE_0829 542 NSE_0829 "metallo-beta-lactama 0.198 0.057 0.593 9.8e-06
TIGR_CMR|DET_0438 551 DET_0438 "metallo-beta-lactama 0.211 0.059 0.545 2.4e-05
UNIPROTKB|Q748A2 561 GSU3113 "Metal-dependent hydro 0.217 0.060 0.485 0.00089
TIGR_CMR|GSU_3113 561 GSU_3113 "metallo-beta-lactama 0.217 0.060 0.485 0.00089
TAIR|locus:2167336 emb2746 "embryo defective 2746" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 2.1e-36, Sum P(2) = 2.1e-36
 Identities = 49/53 (92%), Positives = 53/53 (100%)

Query:    19 KSMEDSVQRKMEQFYEGSNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAG 71
             KSMEDSV+RKMEQFYEG++GPPLR+LPIGGLGEIGMNCMLVGNYDRYILIDAG
Sbjct:    88 KSMEDSVKRKMEQFYEGTDGPPLRILPIGGLGEIGMNCMLVGNYDRYILIDAG 140
GO:0003677 "DNA binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=ISS
GO:0008152 "metabolic process" evidence=ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0015979 "photosynthesis" evidence=RCA
GO:0045333 "cellular respiration" evidence=RCA
TIGR_CMR|CHY_1157 CHY_1157 "metallo-beta-lactamase family protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0829 NSE_0829 "metallo-beta-lactamase family, beta-CASP subfamily" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0438 DET_0438 "metallo-beta-lactamase family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q748A2 GSU3113 "Metal-dependent hydrolase, beta-lactamase superfamily" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3113 GSU_3113 "metallo-beta-lactamase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
COG0595 555 COG0595, COG0595, mRNA degradation ribonucleases J 2e-04
TIGR00649 422 TIGR00649, MG423, conserved hypothetical protein 0.004
>gnl|CDD|223668 COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information 
 Score = 39.9 bits (94), Expect = 2e-04
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 39 PPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAG 71
            +++  +GG+GEIG N  +V   D  I++DAG
Sbjct: 7  AKIKIFALGGVGEIGKNMYVVEYGDDIIILDAG 39

Length = 555
>gnl|CDD|233071 TIGR00649, MG423, conserved hypothetical protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.79
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.69
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.69
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.68
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.3
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.04
KOG1136 501 consensus Predicted cleavage and polyadenylation s 98.97
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 98.93
PRK00055 270 ribonuclease Z; Reviewed 98.91
PLN02962 251 hydroxyacylglutathione hydrolase 98.91
PRK00685 228 metal-dependent hydrolase; Provisional 98.89
PLN02469 258 hydroxyacylglutathione hydrolase 98.88
PRK02113252 putative hydrolase; Provisional 98.88
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 98.88
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 98.86
PRK04286 298 hypothetical protein; Provisional 98.78
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 98.73
PLN02398 329 hydroxyacylglutathione hydrolase 98.71
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 98.68
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 98.66
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 98.62
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 98.59
PRK02126 334 ribonuclease Z; Provisional 98.54
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 98.53
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 98.52
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 98.51
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.39
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.23
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 98.14
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.07
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 97.96
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 97.9
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 97.82
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 97.77
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 97.71
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 97.65
KOG0813 265 consensus Glyoxylase [General function prediction 97.61
PRK11539 755 ComEC family competence protein; Provisional 97.28
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 97.17
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 97.1
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 96.99
KOG0814 237 consensus Glyoxylase [General function prediction 96.65
KOG1135 764 consensus mRNA cleavage and polyadenylation factor 96.64
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 96.3
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 95.89
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 94.79
KOG1361 481 consensus Predicted hydrolase involved in interstr 90.32
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 90.24
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 87.14
PF1369163 Lactamase_B_4: tRNase Z endonuclease 86.47
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 83.54
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 81.97
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information 
Probab=99.79  E-value=4.7e-19  Score=162.47  Aligned_cols=103  Identities=24%  Similarity=0.391  Sum_probs=85.0

Q ss_pred             CCCeEEEEccccCcccceEEEEEeCCeEEEEecCCC-------CCCCCcCe-----------eEEEcccCccc-cc----
Q 039213           38 GPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDP-------GFGFQYTN-----------ICIFIYNGEFN-IQ----   94 (156)
Q Consensus        38 ~~~i~~~~LGg~geig~Ncy~v~~~~~~iIID~G~~-------~~~i~~~~-----------~aI~LTHgH~D-IG----   94 (156)
                      +.++++++|||.+|+|+|||+++.+++++|+|||+.       +.++.+|+           .||||||||+| ||    
T Consensus         6 ~~~i~i~~lGG~~EiGkN~~vve~~~~i~i~D~G~~fp~~~~~gvDliIPd~~yl~~n~~kvkgI~lTHgHeDHIGaip~   85 (555)
T COG0595           6 KAKIKIFALGGVGEIGKNMYVVEYGDDIIILDAGLKFPEDDLLGVDLIIPDFSYLEENKDKVKGIFLTHGHEDHIGALPY   85 (555)
T ss_pred             CCceEEEEecChhhhccceEEEEECCcEEEEECccccCccccccccEEecChHHhhhccccceEEEecCCchhhccchHH
Confidence            468999999999999999999999999999999982       11112221           19999999999 99    


Q ss_pred             --------ccccCcchHHHH-HHHhhhh-hcccceEEEecCCCeEEeeceEEeeee
Q 039213           95 --------QIDESPLDGKVF-DREALEE-LSKEGVTLVIKNGEMLGVSHLRNRRVL  140 (156)
Q Consensus        95 --------pVY~t~~t~~ll-~~~~~~~-~~~~~~~~~l~~Gd~i~ig~~~v~~~~  140 (156)
                              |||++++|++++ .+..++. .......+++++|+++++++++++|..
T Consensus        86 ll~~~~~~piy~s~lt~~Li~~k~~~~~~~~~~~~~~ev~~~~~i~~~~~~v~f~~  141 (555)
T COG0595          86 LLKQVLFAPIYASPLTAALIKEKLKEHGLFKNENELHEVKPGSEIKFGSFEVEFFP  141 (555)
T ss_pred             HHhcCCcCceecCHhhHHHHHHHHHHhccccccCceEEeCCCCeEEeCcEEEEEEe
Confidence                    999999999999 5443433 333356799999999999999999976

>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>KOG0813 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0814 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
2az4_A 429 Hypothetical protein EF2904; structural genomics, 8e-10
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 7e-09
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 4e-08
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 6e-04
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
 Score = 55.0 bits (133), Expect = 8e-10
 Identities = 9/36 (25%), Positives = 13/36 (36%)

Query: 36 SNGPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAG 71
           +     V    G+  IG   + V   D +I  D G
Sbjct: 2  ESKAKTTVTFHSGILTIGGTVIEVAYKDAHIFFDFG 37
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Length = 562 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Length = 555 Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.68
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.64
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.63
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.57
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.54
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.53
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.5
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.49
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.35
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.33
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.31
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.31
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.28
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 99.28
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.27
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.26
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.26
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.24
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.21
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.2
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.19
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.18
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.16
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.13
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.09
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.09
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.09
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.08
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 99.07
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.07
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.07
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.07
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.04
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.04
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.04
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.02
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.01
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.01
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.0
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 98.98
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 98.97
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 98.96
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 98.95
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 98.94
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 98.93
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 98.93
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 98.88
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 98.88
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 98.85
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 98.84
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 98.83
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 98.81
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 98.81
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 98.8
3esh_A280 Protein similar to metal-dependent hydrolase; stru 98.79
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 98.77
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 98.73
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 98.72
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 98.72
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 98.71
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 98.67
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 98.67
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.5
1ztc_A221 Hypothetical protein TM0894; structural genomics, 98.48
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.33
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 98.26
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 97.48
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.15
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 97.99
2p97_A201 Hypothetical protein; putative metal-dependent hyd 97.98
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 97.61
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
Probab=99.68  E-value=1.1e-16  Score=144.13  Aligned_cols=105  Identities=23%  Similarity=0.287  Sum_probs=83.9

Q ss_pred             CCCeEEEEccccCcccceEEEEEeCCeEEEEecCCC--CCC-C--------------CcCee-EEEcccCccc-cc----
Q 039213           38 GPPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDP--GFG-F--------------QYTNI-CIFIYNGEFN-IQ----   94 (156)
Q Consensus        38 ~~~i~~~~LGg~geig~Ncy~v~~~~~~iIID~G~~--~~~-i--------------~~~~~-aI~LTHgH~D-IG----   94 (156)
                      .++|++++|||++|+|+|||+++.++.++|||||..  ... .              ....+ +|||||+|.| +|    
T Consensus         6 ~~~i~i~~lGg~~eiG~n~~li~~~~~~iLID~G~~~~~~~~~g~d~iip~~~~l~~~~~~Id~I~lTH~H~DHiggl~~   85 (555)
T 3zq4_A            6 NDQTAVFALGGLGEIGKNTYAVQFQDEIVLIDAGIKFPEDELLGIDYVIPDYTYLVKNEDKIKGLFITHGHEDHIGGIPY   85 (555)
T ss_dssp             CCSEEEEEEESBSSSSCCEEEEEETTEEEEEEECCBCCCTTSTTCSEEEECCHHHHTTTTTEEEEEESCCCHHHHTTHHH
T ss_pred             CCcEEEEEcCCCCccCCEEEEEEECCeEEEEeCCCCCCccccccccccccCHHHHhcCccCCCEEEECCCchhhhCCHHH
Confidence            458999999999999999999999999999999973  211 1              01112 9999999999 88    


Q ss_pred             -------ccccCcchHHHH-HHHhhhhhcccceEEEecCCCeEEeeceEEeeeeec
Q 039213           95 -------QIDESPLDGKVF-DREALEELSKEGVTLVIKNGEMLGVSHLRNRRVLSN  142 (156)
Q Consensus        95 -------pVY~t~~t~~ll-~~~~~~~~~~~~~~~~l~~Gd~i~ig~~~v~~~~~~  142 (156)
                             |||+++.+.+++ .+............+.+++|+.+++|+++++++...
T Consensus        86 l~~~~~~pIy~t~~t~~ll~~~l~~~~~~~~~~~~~v~~g~~~~ig~~~v~~~~~~  141 (555)
T 3zq4_A           86 LLRQVNIPVYGGKLAIGLLRNKLEEHGLLRQTKLNIIGEDDIVKFRKTAVSFFRTT  141 (555)
T ss_dssp             HHTTCCCCEEECHHHHHHHHHHHHHHSTTTTCCEEECCTTCCEEETTEEEEEEEEB
T ss_pred             HHHhcCceEEECHHHHHHHHHHHHHcCccCCCceEEeCCCCEEEECCEEEEEEeCC
Confidence                   899999999999 444333332334568899999999999999998754
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d2i7ta1 451 d.157.1.10 (A:9-459) Cleavage and polyadenylation 2e-08
d2dkfa1 431 d.157.1.10 (A:1-431) Putative RNA-degradation prot 1e-07
d2gmna1 264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br 0.001
d2aioa1 266 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xa 0.004
d1k07a_ 262 d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoriba 0.004
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.8 bits (117), Expect = 2e-08
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 41 LRVLPIGGLGEIGMNCMLVGNYDRYILIDAG-DPGF 75
          L + P+G   E+G +C+++    R I++D G  PG 
Sbjct: 4  LLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGL 39
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Length = 431 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Length = 266 Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.73
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.68
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.25
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.24
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.23
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.23
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.12
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.02
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 98.91
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 98.91
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 98.91
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 98.87
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.85
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 98.83
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 98.83
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 98.83
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 98.82
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 98.8
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.71
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 98.69
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.63
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.6
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 98.59
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 98.46
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 98.42
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.4
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 98.37
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 98.29
d1vjna_ 209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.0
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 97.6
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 97.46
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage and polyadenylation specificity factor subunit 3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.73  E-value=5e-18  Score=140.18  Aligned_cols=103  Identities=15%  Similarity=0.100  Sum_probs=77.5

Q ss_pred             CCeEEEEccccCcccceEEEEEeCCeEEEEecCCCCCCC-----------CcCee-EEEcccCccc-cc-----------
Q 039213           39 PPLRVLPIGGLGEIGMNCMLVGNYDRYILIDAGDPGFGF-----------QYTNI-CIFIYNGEFN-IQ-----------   94 (156)
Q Consensus        39 ~~i~~~~LGg~geig~Ncy~v~~~~~~iIID~G~~~~~i-----------~~~~~-aI~LTHgH~D-IG-----------   94 (156)
                      ++|.+.+|||++|||+|||+|+.++..||||||+.....           ...++ ||||||+|.| +|           
T Consensus         2 ~~~~~~plGG~~eIG~n~~lv~~~~~~il~D~G~~~~~~~~~~~p~~~~~~~~~id~i~lTH~H~DH~ggLp~l~~~~~~   81 (451)
T d2i7ta1           2 DQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSF   81 (451)
T ss_dssp             EEEEEEEEESSSSSSSCEEEEEETTEEEEECCCCCTTSCGGGGSCCGGGSCGGGCCEEECCCSSHHHHTTHHHHHHHSSC
T ss_pred             CcEEEEEccCCCcccccEEEEEECCeEEEEeCCCCCCccccccCCCccCCCHhhCCEEEECCCcHHHhCchHHHHHhcCC
Confidence            478999999999999999999999999999999843111           11122 9999999999 88           


Q ss_pred             --ccccCcchHHHH-HHHhh-----------------hhhcccceEEEecCCCeEEeeceEEeeeee
Q 039213           95 --QIDESPLDGKVF-DREAL-----------------EELSKEGVTLVIKNGEMLGVSHLRNRRVLS  141 (156)
Q Consensus        95 --pVY~t~~t~~ll-~~~~~-----------------~~~~~~~~~~~l~~Gd~i~ig~~~v~~~~~  141 (156)
                        |||||+.|++++ .....                 ...........++-++...++++.+.++..
T Consensus        82 ~~pIy~s~~T~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~  148 (451)
T d2i7ta1          82 KGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA  148 (451)
T ss_dssp             CSEEEEEHHHHHHHHHHHHHHCC---------CCCHHHHHHHGGGEEEECTTCCEEETTEEEEEEEC
T ss_pred             CCCEEechhHhhhhhhhhhhhhhhhhcccccccCcHHHHHHhhhhcceecCCceEeeCCEEEEEecc
Confidence              899999999998 32110                 000011244677778888889988887653
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure