Citrus Sinensis ID: 039716
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1002 | ||||||
| 359476452 | 1012 | PREDICTED: histidine kinase 5-like [Viti | 0.987 | 0.977 | 0.726 | 0.0 | |
| 224143389 | 945 | histidine kinase cytokinin receptor [Pop | 0.920 | 0.975 | 0.704 | 0.0 | |
| 147778679 | 979 | hypothetical protein VITISV_033090 [Viti | 0.953 | 0.975 | 0.697 | 0.0 | |
| 356552435 | 937 | PREDICTED: histidine kinase 5-like [Glyc | 0.922 | 0.986 | 0.693 | 0.0 | |
| 255548630 | 930 | sensor histidine kinase, putative [Ricin | 0.898 | 0.967 | 0.713 | 0.0 | |
| 224092694 | 923 | histidine kinase cytokinin receptor [Pop | 0.907 | 0.984 | 0.693 | 0.0 | |
| 356509864 | 933 | PREDICTED: histidine kinase 5-like [Glyc | 0.919 | 0.987 | 0.683 | 0.0 | |
| 357437045 | 1077 | Histidine kinase cytokinin receptor [Med | 0.983 | 0.914 | 0.646 | 0.0 | |
| 449447373 | 941 | PREDICTED: histidine kinase 5-like [Cucu | 0.917 | 0.976 | 0.649 | 0.0 | |
| 449486822 | 941 | PREDICTED: LOW QUALITY PROTEIN: histidin | 0.917 | 0.976 | 0.648 | 0.0 |
| >gi|359476452|ref|XP_002271743.2| PREDICTED: histidine kinase 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1448 bits (3749), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 743/1023 (72%), Positives = 846/1023 (82%), Gaps = 34/1023 (3%)
Query: 1 MVCNMETDLIEDMDIEGLPSMWPEDIGSD--KQFNVERPGGGQDMLEEVTIPEDQTIVDF 58
MVC ME D IE+MD+E L SMWPEDIG+D QFN++RPG QDMLEEV I E+ +IVDF
Sbjct: 1 MVCEMENDNIEEMDVEVLHSMWPEDIGNDAGNQFNMDRPGADQDMLEEVNIVEEPSIVDF 60
Query: 59 KRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEH 118
KRLLELTNY++KGSSQ+AYLVK+WEY+Q+NAVRLL+EELDNLSRQRQE ELKKLEILEEH
Sbjct: 61 KRLLELTNYSEKGSSQLAYLVKNWEYKQANAVRLLKEELDNLSRQRQEVELKKLEILEEH 120
Query: 119 RFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL 178
RF EE YGGDKRPISI+D + D+W++V R+N VV Q+KR+E+DAEYDTV YWKQRA+ L
Sbjct: 121 RFVEERYGGDKRPISILDGIYDIWQEVPRRRNSVVVQNKRLEIDAEYDTVIYWKQRAVHL 180
Query: 179 EKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQ 238
EK+LEAS QRE LMEK+ ES+ +LE+QSSPVEELSQILKRADNFLHFVLQNAPVV+GHQ
Sbjct: 181 EKLLEASVQREHMLMEKVQESIKSLERQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQ 240
Query: 239 DKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFET 298
DKELRYRFIYNHFPSL EEDI+GKTDVEIF+GAGVKESQ+FK+EVLE+GLPAKREITFET
Sbjct: 241 DKELRYRFIYNHFPSLQEEDIIGKTDVEIFTGAGVKESQEFKKEVLERGLPAKREITFET 300
Query: 299 ELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELN 358
ELFGSKTFLIYVEPVFSK+G+TIGVNYMGMDVTDQVRKREKM K+REEIAVQKAKETELN
Sbjct: 301 ELFGSKTFLIYVEPVFSKAGDTIGVNYMGMDVTDQVRKREKMMKIREEIAVQKAKETELN 360
Query: 359 KTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLV 418
KTIHITEETMRAKQMLATMSHEIRSPL+GVVS+AEIL+ T LDR QRQLL VM+SSGDLV
Sbjct: 361 KTIHITEETMRAKQMLATMSHEIRSPLSGVVSIAEILATTNLDRHQRQLLNVMLSSGDLV 420
Query: 419 LQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEV 478
LQLINDILDLSKVESGVMKLEA KFRPREVVKHVLQTAAASLQKIL LEG +ADDVP+EV
Sbjct: 421 LQLINDILDLSKVESGVMKLEATKFRPREVVKHVLQTAAASLQKILTLEGHVADDVPLEV 480
Query: 479 IGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAK-EGLKQKSKAYQSATDA-- 535
GDVLRIRQILTNLISNA+KFT EGKVGI LYV+PEP EG Q QS A
Sbjct: 481 TGDVLRIRQILTNLISNAVKFTHEGKVGINLYVIPEPSSGNGEGGPQMFIDDQSTVSANI 540
Query: 536 VKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDED------LEAT 589
KEEK SQ++ G H Q+H +D+P P++H +S ED LE T
Sbjct: 541 PKEEKCLSPSQSSCTSKGSH-------TQNHALNDEPIDPINHDDSKQEDKENSHPLETT 593
Query: 590 VWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTV 649
VWIRCDVYDTGIGIPE+ALPTLF+KYMQVSADHARKYGGTGLGLAICKQLVELMGG +TV
Sbjct: 594 VWIRCDVYDTGIGIPEHALPTLFKKYMQVSADHARKYGGTGLGLAICKQLVELMGGHMTV 653
Query: 650 TSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLF 709
+S+ H GSTFTFILPY+VS I ++SDDPD+LSDMAD D+ TDD AGFFQF PRTLGSLF
Sbjct: 654 SSREHSGSTFTFILPYKVSLISDHSDDPDELSDMADDDASTDDKNAGFFQFHPRTLGSLF 713
Query: 710 SSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNN-RQKETAPLEDACSVAEVAETL 768
SS G+ R++KL PN+IG+ S HK+NG S+ SYSFP N KE LED CSV + AETL
Sbjct: 714 SSGGSGRTQKLPPNNIGYDSLHKLNGLSDDSYSFPFNKVTSKEMTSLEDTCSVVDAAETL 773
Query: 769 SEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQ 828
SEPES H+ EP+N+ VSRGK+C E N +T ST HS+ ++E+ + KT+E
Sbjct: 774 SEPESLLRHNAEPDNDNAVSRGKKCQDEANGQVHNHSTGSTHHSKVSKEVDEMGKTSEAP 833
Query: 829 KICEMQEKPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDV 888
++C E +R SQ SSSS E E K KPKILLVED+KINVMV +SMMKQLGH+IDV
Sbjct: 834 EMCLRLEISERSSQCTSSSSPE--EPKSTLKPKILLVEDSKINVMVTQSMMKQLGHTIDV 891
Query: 889 VNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPS 948
VNNG+EAV AVQC++YDLILMDVCMPVMDGL+ATR+IRSFE+TGNWDAA +AGIE PS
Sbjct: 892 VNNGIEAVRAVQCRSYDLILMDVCMPVMDGLQATRIIRSFEETGNWDAAVKAGIE---PS 948
Query: 949 SGSSNHF----------KRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLE 998
+ SS+ KR+PIIAMTANALSESA+EC+ANGMDSFVSKPVTFQKL +CL+
Sbjct: 949 TCSSDSLPNGHDSMTVTKRVPIIAMTANALSESADECYANGMDSFVSKPVTFQKLTQCLQ 1008
Query: 999 QYF 1001
QY
Sbjct: 1009 QYL 1011
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224143389|ref|XP_002324940.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222866374|gb|EEF03505.1| histidine kinase cytokinin receptor [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147778679|emb|CAN76109.1| hypothetical protein VITISV_033090 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552435|ref|XP_003544573.1| PREDICTED: histidine kinase 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255548630|ref|XP_002515371.1| sensor histidine kinase, putative [Ricinus communis] gi|223545315|gb|EEF46820.1| sensor histidine kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224092694|ref|XP_002309700.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222855676|gb|EEE93223.1| histidine kinase cytokinin receptor [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356509864|ref|XP_003523664.1| PREDICTED: histidine kinase 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357437045|ref|XP_003588798.1| Histidine kinase cytokinin receptor [Medicago truncatula] gi|355477846|gb|AES59049.1| Histidine kinase cytokinin receptor [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449447373|ref|XP_004141443.1| PREDICTED: histidine kinase 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449486822|ref|XP_004157413.1| PREDICTED: LOW QUALITY PROTEIN: histidine kinase 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1002 | ||||||
| TAIR|locus:2159669 | 922 | HK5 "histidine kinase 5" [Arab | 0.513 | 0.558 | 0.701 | 2.1e-286 | |
| TIGR_CMR|SPO_0094 | 743 | SPO_0094 "sensory box sensor h | 0.201 | 0.271 | 0.401 | 2.4e-54 | |
| DICTYBASE|DDB_G0277883 | 2062 | dhkJ "histidine kinase J" [Dic | 0.162 | 0.079 | 0.425 | 3.7e-53 | |
| TIGR_CMR|GSU_1285 | 772 | GSU_1285 "sensory box sensor h | 0.291 | 0.378 | 0.288 | 2.8e-52 | |
| TIGR_CMR|GSU_2314 | 1025 | GSU_2314 "sensory box histidin | 0.176 | 0.172 | 0.346 | 3e-51 | |
| CGD|CAL0002691 | 1081 | NIK1 [Candida albicans (taxid: | 0.137 | 0.127 | 0.402 | 3.1e-50 | |
| UNIPROTKB|Q5A599 | 1081 | NIK1 "Putative uncharacterized | 0.137 | 0.127 | 0.402 | 3.1e-50 | |
| TIGR_CMR|GSU_1928 | 810 | GSU_1928 "sensor histidine kin | 0.173 | 0.214 | 0.366 | 3.7e-50 | |
| TIGR_CMR|GSU_0718 | 589 | GSU_0718 "sensory box histidin | 0.168 | 0.286 | 0.392 | 2.5e-49 | |
| TAIR|locus:2015964 | 1036 | HK3 "histidine kinase 3" [Arab | 0.142 | 0.138 | 0.430 | 9.9e-49 |
| TAIR|locus:2159669 HK5 "histidine kinase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1819 (645.4 bits), Expect = 2.1e-286, Sum P(3) = 2.1e-286
Identities = 366/522 (70%), Positives = 425/522 (81%)
Query: 1 MVCNMETDLIEDMDIEGLPSMWPEDIGS--DKQFNVERPGGGQDMLEEVTIPEDQTIVDF 58
MVC METD IE+MD+E L SMWPED+G+ DKQFNVE+P G D L+EVTI E +TI D
Sbjct: 1 MVCEMETDQIEEMDVEVLSSMWPEDVGTEADKQFNVEKPAGDLDTLKEVTI-ETRTIADM 59
Query: 59 KRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQXXXXXXXXXXXXX 118
RL L N T +GSSQ+ LVK WEY Q NAVRLL+EEL NL RQR+
Sbjct: 60 TRLPNLLNSTHQGSSQLTNLVKQWEYMQDNAVRLLKEELKNLDRQREEAEAKELKIIEEY 119
Query: 119 XXXXXGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL 178
+ + ++DE SD+++ +K D + SK++E+ E+DTV YWKQ+AL L
Sbjct: 120 KFES----NEPENVPVLDETSDLFRRFRQKKRDALVDSKKIEIYEEFDTVAYWKQKALSL 175
Query: 179 EKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQ 238
EKMLEAS +RE+ LMEKL+ES+ +E QS+PV+EL+Q LKRA+ FLHF+LQNAP+VMGHQ
Sbjct: 176 EKMLEASTERERRLMEKLSESLKTMESQSAPVQELTQNLKRAEGFLHFILQNAPIVMGHQ 235
Query: 239 DKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFET 298
DK+LRY FIYN +PSL E+DILGKTDVEIF G GVKES+DFKREVLEKG +KREITF T
Sbjct: 236 DKDLRYLFIYNKYPSLREQDILGKTDVEIFHGGGVKESEDFKREVLEKGKASKREITFTT 295
Query: 299 ELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELN 358
+LFGSKTFLIYVEPV++K+GE IG+NYMGM+VTDQV KREKMAKLRE+ AV+KA E+ELN
Sbjct: 296 DLFGSKTFLIYVEPVYNKAGEKIGINYMGMEVTDQVVKREKMAKLREDNAVRKAMESELN 355
Query: 359 KTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLV 418
KTIHITEETMRAKQMLATMSHEIRSPL+GVV MAEILS TKLD+EQRQLL VMISSGDLV
Sbjct: 356 KTIHITEETMRAKQMLATMSHEIRSPLSGVVGMAEILSTTKLDKEQRQLLNVMISSGDLV 415
Query: 419 LQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEV 478
LQLINDILDLSKVESGVM+LEA KFRPREVVKHVLQTAAASL+K L LEG+IADDVPIEV
Sbjct: 416 LQLINDILDLSKVESGVMRLEATKFRPREVVKHVLQTAAASLKKSLTLEGNIADDVPIEV 475
Query: 479 IGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKE 520
+GDVLRIRQILTNLISNAIKFT EG VGIKL V+ EP F ++
Sbjct: 476 VGDVLRIRQILTNLISNAIKFTHEGNVGIKLQVISEPSFVRD 517
|
|
| TIGR_CMR|SPO_0094 SPO_0094 "sensory box sensor histidine kinase/response regulator" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0277883 dhkJ "histidine kinase J" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1285 GSU_1285 "sensory box sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002691 NIK1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A599 NIK1 "Putative uncharacterized protein NIK1" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1928 GSU_1928 "sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0718 GSU_0718 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015964 HK3 "histidine kinase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1002 | |||
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 5e-32 | |
| COG0642 | 336 | COG0642, BaeS, Signal transduction histidine kinas | 1e-29 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 5e-28 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 8e-28 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 3e-27 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 5e-27 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 3e-25 | |
| smart00387 | 111 | smart00387, HATPase_c, Histidine kinase-like ATPas | 1e-23 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 3e-23 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 4e-23 | |
| pfam02518 | 111 | pfam02518, HATPase_c, Histidine kinase-, DNA gyras | 3e-22 | |
| cd00075 | 103 | cd00075, HATPase_c, Histidine kinase-like ATPases; | 5e-22 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 1e-21 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 2e-21 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 7e-20 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 1e-19 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 5e-19 | |
| pfam00512 | 66 | pfam00512, HisKA, His Kinase A (phospho-acceptor) | 1e-18 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 2e-18 | |
| COG0642 | 336 | COG0642, BaeS, Signal transduction histidine kinas | 2e-18 | |
| smart00388 | 66 | smart00388, HisKA, His Kinase A (phosphoacceptor) | 2e-18 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 1e-17 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 1e-17 | |
| COG2205 | 890 | COG2205, KdpD, Osmosensitive K+ channel histidine | 8e-17 | |
| TIGR02966 | 333 | TIGR02966, phoR_proteo, phosphate regulon sensor k | 2e-16 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 4e-16 | |
| COG5002 | 459 | COG5002, VicK, Signal transduction histidine kinas | 4e-15 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 2e-14 | |
| TIGR02966 | 333 | TIGR02966, phoR_proteo, phosphate regulon sensor k | 5e-14 | |
| COG2205 | 890 | COG2205, KdpD, Osmosensitive K+ channel histidine | 8e-14 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 2e-13 | |
| cd00082 | 65 | cd00082, HisKA, Histidine Kinase A (dimerization/p | 2e-13 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 6e-13 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 6e-13 | |
| PRK09303 | 380 | PRK09303, PRK09303, adaptive-response sensory kina | 6e-13 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 8e-13 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 9e-13 | |
| PRK11100 | 475 | PRK11100, PRK11100, sensory histidine kinase CreC; | 2e-12 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 3e-11 | |
| PRK10490 | 895 | PRK10490, PRK10490, sensor protein KdpD; Provision | 1e-10 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 1e-10 | |
| COG3706 | 435 | COG3706, PleD, Response regulator containing a Che | 1e-10 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 2e-10 | |
| PRK10618 | 894 | PRK10618, PRK10618, phosphotransfer intermediate p | 3e-10 | |
| PRK11360 | 607 | PRK11360, PRK11360, sensory histidine kinase AtoS; | 8e-10 | |
| COG4251 | 750 | COG4251, COG4251, Bacteriophytochrome (light-regul | 1e-09 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 2e-09 | |
| PRK10365 | 441 | PRK10365, PRK10365, transcriptional regulatory pro | 2e-09 | |
| COG3290 | 537 | COG3290, CitA, Signal transduction histidine kinas | 2e-09 | |
| PRK11006 | 430 | PRK11006, phoR, phosphate regulon sensor protein; | 4e-09 | |
| PRK09835 | 482 | PRK09835, PRK09835, sensor kinase CusS; Provisiona | 4e-09 | |
| COG4251 | 750 | COG4251, COG4251, Bacteriophytochrome (light-regul | 7e-09 | |
| COG2197 | 211 | COG2197, CitB, Response regulator containing a Che | 1e-08 | |
| PRK13837 | 828 | PRK13837, PRK13837, two-component VirA-like sensor | 1e-08 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 2e-08 | |
| COG4191 | 603 | COG4191, COG4191, Signal transduction histidine ki | 3e-08 | |
| TIGR01386 | 457 | TIGR01386, cztS_silS_copS, heavy metal sensor kina | 5e-08 | |
| PRK11086 | 542 | PRK11086, PRK11086, sensory histidine kinase DcuS; | 6e-08 | |
| PRK10610 | 129 | PRK10610, PRK10610, chemotaxis regulatory protein | 6e-08 | |
| PRK09303 | 380 | PRK09303, PRK09303, adaptive-response sensory kina | 9e-08 | |
| PRK10490 | 895 | PRK10490, PRK10490, sensor protein KdpD; Provision | 1e-07 | |
| PRK12555 | 337 | PRK12555, PRK12555, chemotaxis-specific methyleste | 1e-07 | |
| PRK10364 | 457 | PRK10364, PRK10364, sensor protein ZraS; Provision | 1e-07 | |
| PRK10364 | 457 | PRK10364, PRK10364, sensor protein ZraS; Provision | 2e-07 | |
| PRK11360 | 607 | PRK11360, PRK11360, sensory histidine kinase AtoS; | 4e-07 | |
| TIGR01386 | 457 | TIGR01386, cztS_silS_copS, heavy metal sensor kina | 5e-07 | |
| COG2201 | 350 | COG2201, CheB, Chemotaxis response regulator conta | 6e-07 | |
| COG5002 | 459 | COG5002, VicK, Signal transduction histidine kinas | 1e-06 | |
| PRK13837 | 828 | PRK13837, PRK13837, two-component VirA-like sensor | 1e-06 | |
| PRK11517 | 223 | PRK11517, PRK11517, transcriptional regulatory pro | 1e-06 | |
| TIGR01387 | 218 | TIGR01387, cztR_silR_copR, heavy metal response re | 2e-06 | |
| TIGR02875 | 262 | TIGR02875, spore_0_A, sporulation transcription fa | 2e-06 | |
| COG3947 | 361 | COG3947, COG3947, Response regulator containing Ch | 2e-06 | |
| PRK11100 | 475 | PRK11100, PRK11100, sensory histidine kinase CreC; | 3e-06 | |
| PRK11006 | 430 | PRK11006, phoR, phosphate regulon sensor protein; | 3e-06 | |
| PRK10604 | 433 | PRK10604, PRK10604, sensor protein RstB; Provision | 3e-06 | |
| PRK09467 | 435 | PRK09467, envZ, osmolarity sensor protein; Provisi | 3e-06 | |
| COG3852 | 363 | COG3852, NtrB, Signal transduction histidine kinas | 4e-06 | |
| COG4191 | 603 | COG4191, COG4191, Signal transduction histidine ki | 5e-06 | |
| PRK00742 | 354 | PRK00742, PRK00742, chemotaxis-specific methyleste | 8e-06 | |
| PRK15479 | 221 | PRK15479, PRK15479, transcriptional regulatory pro | 8e-06 | |
| TIGR02916 | 679 | TIGR02916, PEP_his_kin, putative PEP-CTERM system | 9e-06 | |
| PRK09835 | 482 | PRK09835, PRK09835, sensor kinase CusS; Provisiona | 1e-05 | |
| COG3852 | 363 | COG3852, NtrB, Signal transduction histidine kinas | 1e-05 | |
| PRK09836 | 227 | PRK09836, PRK09836, DNA-binding transcriptional ac | 1e-05 | |
| PRK11073 | 348 | PRK11073, glnL, nitrogen regulation protein NR(II) | 1e-05 | |
| smart00387 | 111 | smart00387, HATPase_c, Histidine kinase-like ATPas | 2e-05 | |
| PRK10766 | 221 | PRK10766, PRK10766, DNA-binding transcriptional re | 2e-05 | |
| CHL00148 | 240 | CHL00148, orf27, Ycf27; Reviewed | 2e-05 | |
| PRK10336 | 219 | PRK10336, PRK10336, DNA-binding transcriptional re | 2e-05 | |
| COG5000 | 712 | COG5000, NtrY, Signal transduction histidine kinas | 3e-05 | |
| PRK10618 | 894 | PRK10618, PRK10618, phosphotransfer intermediate p | 5e-05 | |
| TIGR02154 | 226 | TIGR02154, PhoB, phosphate regulon transcriptional | 5e-05 | |
| pfam02518 | 111 | pfam02518, HATPase_c, Histidine kinase-, DNA gyras | 1e-04 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 1e-04 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 2e-04 | |
| PRK10710 | 240 | PRK10710, PRK10710, DNA-binding transcriptional re | 3e-04 | |
| PRK09470 | 461 | PRK09470, cpxA, two-component sensor protein; Prov | 3e-04 | |
| PRK10549 | 466 | PRK10549, PRK10549, signal transduction histidine- | 3e-04 | |
| cd00075 | 103 | cd00075, HATPase_c, Histidine kinase-like ATPases; | 4e-04 | |
| TIGR03785 | 703 | TIGR03785, marine_sort_HK, proteobacterial dedicat | 4e-04 | |
| PRK10816 | 223 | PRK10816, PRK10816, DNA-binding transcriptional re | 4e-04 | |
| COG4565 | 224 | COG4565, CitB, Response regulator of citrate/malat | 5e-04 | |
| PRK10643 | 222 | PRK10643, PRK10643, DNA-binding transcriptional re | 8e-04 | |
| COG4192 | 673 | COG4192, COG4192, Signal transduction histidine ki | 0.001 | |
| PRK11083 | 228 | PRK11083, PRK11083, DNA-binding response regulator | 0.002 | |
| pfam08448 | 110 | pfam08448, PAS_4, PAS fold | 0.003 | |
| TIGR01818 | 463 | TIGR01818, ntrC, nitrogen regulation protein NR(I) | 0.004 |
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
Score = 134 bits (339), Expect = 5e-32
Identities = 68/206 (33%), Positives = 109/206 (52%), Gaps = 17/206 (8%)
Query: 332 DQVRKREKMAKLREEIAVQKAKET-ELNKTIH--------------ITEETMRAK-QMLA 375
D+ + +++ + +E + A+ T EL +T EE RAK LA
Sbjct: 410 DERQVAQELQEHKESLEQLVAQRTQELAETNERLNAEVKNHAKARAEAEEANRAKSAFLA 469
Query: 376 TMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGV 435
TMSHEIR+PL G++ E+L +T L +Q+Q L V+ SG+ +L ++NDILD SK+E+G
Sbjct: 470 TMSHEIRTPLNGILGTLELLGDTGLTSQQQQYLQVINRSGESLLDILNDILDYSKIEAGH 529
Query: 436 MKLEAAKFRPREVVKHVLQ-TAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLIS 494
+ + F ++ V + + K + L +I + +P GD RIRQ+L NL+
Sbjct: 530 LSISPRPFDLNALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNWWQGDGPRIRQVLINLVG 589
Query: 495 NAIKFTPEGKVGIKLYVVPEPPFAKE 520
NAIKFT G V +++ + + E
Sbjct: 590 NAIKFTDRGSVVLRVSLNDDSSLLFE 615
|
This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems]. Length = 968 |
| >gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236839 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator | Back alignment and domain information |
|---|
| >gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227333 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226655 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219845 pfam08448, PAS_4, PAS fold | Back alignment and domain information |
|---|
| >gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1002 | |||
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 100.0 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 100.0 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 100.0 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 100.0 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 100.0 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 100.0 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 100.0 | |
| PRK13557 | 540 | histidine kinase; Provisional | 100.0 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 100.0 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 100.0 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 100.0 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 100.0 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 100.0 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 100.0 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 100.0 | |
| COG3852 | 363 | NtrB Signal transduction histidine kinase, nitroge | 100.0 | |
| TIGR02966 | 333 | phoR_proteo phosphate regulon sensor kinase PhoR. | 100.0 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 100.0 | |
| PRK09303 | 380 | adaptive-response sensory kinase; Validated | 100.0 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 100.0 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 100.0 | |
| COG5000 | 712 | NtrY Signal transduction histidine kinase involved | 100.0 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 100.0 | |
| COG4251 | 750 | Bacteriophytochrome (light-regulated signal transd | 99.97 | |
| PRK10604 | 433 | sensor protein RstB; Provisional | 99.97 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 99.96 | |
| PRK10815 | 485 | sensor protein PhoQ; Provisional | 99.96 | |
| COG4191 | 603 | Signal transduction histidine kinase regulating C4 | 99.96 | |
| PRK10364 | 457 | sensor protein ZraS; Provisional | 99.96 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 99.96 | |
| PRK10549 | 466 | signal transduction histidine-protein kinase BaeS; | 99.96 | |
| PRK10755 | 356 | sensor protein BasS/PmrB; Provisional | 99.96 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 99.95 | |
| TIGR03785 | 703 | marine_sort_HK proteobacterial dedicated sortase s | 99.95 | |
| TIGR01386 | 457 | cztS_silS_copS heavy metal sensor kinase. Members | 99.95 | |
| PRK09835 | 482 | sensor kinase CusS; Provisional | 99.95 | |
| PRK09470 | 461 | cpxA two-component sensor protein; Provisional | 99.95 | |
| PRK10337 | 449 | sensor protein QseC; Provisional | 99.95 | |
| PRK09467 | 435 | envZ osmolarity sensor protein; Provisional | 99.94 | |
| PRK11100 | 475 | sensory histidine kinase CreC; Provisional | 99.94 | |
| COG0642 | 336 | BaeS Signal transduction histidine kinase [Signal | 99.94 | |
| TIGR02916 | 679 | PEP_his_kin putative PEP-CTERM system histidine ki | 99.94 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 99.89 | |
| PRK11644 | 495 | sensory histidine kinase UhpB; Provisional | 99.88 | |
| COG4192 | 673 | Signal transduction histidine kinase regulating ph | 99.87 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.83 | |
| PF02518 | 111 | HATPase_c: Histidine kinase-, DNA gyrase B-, and H | 99.81 | |
| PRK10935 | 565 | nitrate/nitrite sensor protein NarQ; Provisional | 99.8 | |
| PRK10600 | 569 | nitrate/nitrite sensor protein NarX; Provisional | 99.75 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 99.72 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.71 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 99.71 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 99.71 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.7 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 99.68 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 99.64 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 99.62 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 99.62 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.6 | |
| PRK10547 | 670 | chemotaxis protein CheA; Provisional | 99.59 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 99.58 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 99.56 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 99.54 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 99.54 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 99.53 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 99.52 | |
| PRK04184 | 535 | DNA topoisomerase VI subunit B; Validated | 99.51 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 99.51 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 99.5 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 99.5 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 99.49 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 99.49 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 99.48 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 99.48 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 99.48 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 99.47 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 99.47 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 99.46 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 99.46 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 99.46 | |
| smart00387 | 111 | HATPase_c Histidine kinase-like ATPases. Histidine | 99.44 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 99.44 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 99.43 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 99.43 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 99.43 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 99.42 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 99.42 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 99.42 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.41 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.4 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.39 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.39 | |
| PRK09483 | 217 | response regulator; Provisional | 99.38 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 99.38 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 99.38 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.38 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 99.37 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 99.37 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.36 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 99.36 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 99.35 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 99.32 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 99.31 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 99.3 | |
| PRK14868 | 795 | DNA topoisomerase VI subunit B; Provisional | 99.3 | |
| TIGR01052 | 488 | top6b DNA topoisomerase VI, B subunit. This model | 99.29 | |
| PF00512 | 68 | HisKA: His Kinase A (phospho-acceptor) domain; Int | 99.28 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 99.27 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.26 | |
| PRK14867 | 659 | DNA topoisomerase VI subunit B; Provisional | 99.26 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 99.25 | |
| cd00075 | 103 | HATPase_c Histidine kinase-like ATPases; This fami | 99.24 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 99.24 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.24 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 99.23 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 99.23 | |
| PRK13435 | 145 | response regulator; Provisional | 99.22 | |
| TIGR01925 | 137 | spIIAB anti-sigma F factor. This model describes t | 99.21 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 99.19 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 99.19 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 99.18 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 99.16 | |
| PRK03660 | 146 | anti-sigma F factor; Provisional | 99.13 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.12 | |
| COG0643 | 716 | CheA Chemotaxis protein histidine kinase and relat | 99.09 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 99.07 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 99.04 | |
| COG3920 | 221 | Signal transduction histidine kinase [Signal trans | 98.9 | |
| COG3850 | 574 | NarQ Signal transduction histidine kinase, nitrate | 98.9 | |
| COG3851 | 497 | UhpB Signal transduction histidine kinase, glucose | 98.88 | |
| PF08448 | 110 | PAS_4: PAS fold; InterPro: IPR013656 The PAS fold | 98.87 | |
| COG3275 | 557 | LytS Putative regulator of cell autolysis [Signal | 98.83 | |
| COG4585 | 365 | Signal transduction histidine kinase [Signal trans | 98.82 | |
| PRK04069 | 161 | serine-protein kinase RsbW; Provisional | 98.81 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 98.76 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 98.74 | |
| COG2972 | 456 | Predicted signal transduction protein with a C-ter | 98.66 | |
| PF13426 | 104 | PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ | 98.57 | |
| TIGR01924 | 159 | rsbW_low_gc serine-protein kinase RsbW. This model | 98.57 | |
| smart00388 | 66 | HisKA His Kinase A (phosphoacceptor) domain. Dimer | 98.53 | |
| PF00989 | 113 | PAS: PAS fold; InterPro: IPR013767 PAS domains are | 98.51 | |
| COG4564 | 459 | Signal transduction histidine kinase [Signal trans | 98.5 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 98.32 | |
| PF14501 | 100 | HATPase_c_5: GHKL domain | 98.29 | |
| KOG0787 | 414 | consensus Dehydrogenase kinase [Signal transductio | 98.25 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 98.19 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 98.12 | |
| PF13596 | 106 | PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. | 98.09 | |
| cd00082 | 65 | HisKA Histidine Kinase A (dimerization/phosphoacce | 98.05 | |
| TIGR00585 | 312 | mutl DNA mismatch repair protein MutL. All protein | 98.03 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 97.85 | |
| COG1389 | 538 | DNA topoisomerase VI, subunit B [DNA replication, | 97.77 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 97.77 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 97.73 | |
| TIGR00229 | 124 | sensory_box PAS domain S-box. The PAS domain was p | 97.67 | |
| PF13581 | 125 | HATPase_c_2: Histidine kinase-like ATPase domain | 97.62 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 97.52 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 97.42 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 97.37 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 97.16 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 97.08 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 96.94 | |
| COG2172 | 146 | RsbW Anti-sigma regulatory factor (Ser/Thr protein | 96.91 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 96.78 | |
| PRK00095 | 617 | mutL DNA mismatch repair protein; Reviewed | 96.64 | |
| cd00130 | 103 | PAS PAS domain; PAS motifs appear in archaea, euba | 96.64 | |
| PF12860 | 115 | PAS_7: PAS fold | 96.05 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 96.04 | |
| PF13589 | 137 | HATPase_c_3: Histidine kinase-, DNA gyrase B-, and | 95.84 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 95.59 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 95.58 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 95.34 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 95.28 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 95.26 | |
| PRK14083 | 601 | HSP90 family protein; Provisional | 94.69 | |
| PTZ00272 | 701 | heat shock protein 83 kDa (Hsp83); Provisional | 93.96 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 93.91 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 93.66 | |
| PF08447 | 91 | PAS_3: PAS fold; InterPro: IPR013655 The PAS fold | 93.57 | |
| PRK05559 | 631 | DNA topoisomerase IV subunit B; Reviewed | 93.13 | |
| PRK05218 | 613 | heat shock protein 90; Provisional | 92.84 | |
| PF14598 | 111 | PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W | 92.23 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 92.22 | |
| COG2202 | 232 | AtoS FOG: PAS/PAC domain [Signal transduction mech | 90.91 | |
| TIGR01055 | 625 | parE_Gneg DNA topoisomerase IV, B subunit, proteob | 89.71 | |
| PTZ00130 | 814 | heat shock protein 90; Provisional | 89.17 | |
| COG0323 | 638 | MutL DNA mismatch repair enzyme (predicted ATPase) | 88.85 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 88.4 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 88.16 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 88.08 | |
| TIGR01059 | 654 | gyrB DNA gyrase, B subunit. This model describes t | 88.07 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 87.9 | |
| COG2461 | 409 | Uncharacterized conserved protein [Function unknow | 86.98 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 86.1 | |
| PRK05644 | 638 | gyrB DNA gyrase subunit B; Validated | 85.81 | |
| COG5381 | 184 | Uncharacterized protein conserved in bacteria [Fun | 85.48 | |
| PF13188 | 64 | PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. | 84.4 | |
| COG4999 | 140 | Uncharacterized domain of BarA-like signal transdu | 83.19 | |
| COG0326 | 623 | HtpG Molecular chaperone, HSP90 family [Posttransl | 83.04 | |
| PF03709 | 115 | OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal | 82.92 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 81.98 | |
| smart00433 | 594 | TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras | 80.99 | |
| PRK09426 | 714 | methylmalonyl-CoA mutase; Reviewed | 80.76 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 80.51 |
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-65 Score=642.04 Aligned_cols=504 Identities=29% Similarity=0.466 Sum_probs=422.1
Q ss_pred HHHhhcCChHHHHHHHHHHHHHHHHHHHhccCcEEEEecccccEEEeeccC---CCCCcccccCCCchhccCccchhhhh
Q 039716 201 TNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHF---PSLHEEDILGKTDVEIFSGAGVKESQ 277 (1002)
Q Consensus 201 ~~l~~~~~~~~~~~~~l~~~~~~l~~il~~~p~~i~~~d~~~~~~~~~~~~---~~~~~e~iiGk~~~e~~~~~~~~~~~ 277 (1002)
..|.+...+.++..+.+++++.+++.+++++|.+++..|.++++.++|..+ .|+..++++|++..+++++.......
T Consensus 134 ~~L~~~i~~r~~~~~~l~~~~~~l~~il~~~~~~i~~~D~~g~i~~~N~a~~~l~G~~~~eliG~~~~~l~~~~~~~~~~ 213 (779)
T PRK11091 134 EQLKNEIKEREETQIELEQQSSLLRSFLDASPDLVYYRNEDGEFSGCNRAMELLTGKSEKQLIGLTPKDVYSPEAAEKVI 213 (779)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcceEEEECCCCcEEeEcHHHHHHhCcCHHHHcCCChHHhCCHHHHHHHH
Confidence 445555555667778899999999999999999999999999999998764 67888999999999999876555555
Q ss_pred HHHHHHHHhCCCcceeEEEEEeecCceEEEEEEeeeecCCCCEEEEEEEeechhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039716 278 DFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETEL 357 (1002)
Q Consensus 278 ~~~~~vl~~g~~~~~e~~~~~~~~~~~~~~~~~~p~~~~~G~~~gi~~~~~DITe~~~~~~~~~~l~~el~~~~~~~~el 357 (1002)
.....++..+.+...+..+....+...++.++..|+++.+|.+.|+++++.|||++++.++++.+..
T Consensus 214 ~~~~~~~~~~~~~~~e~~~~~~~G~~~~~~~~~~pi~~~~g~~~g~v~~~~DITe~k~~e~~l~~a~------------- 280 (779)
T PRK11091 214 ETDEKVFRHNVSLTYEQWLDYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALEKAS------------- 280 (779)
T ss_pred HHHHHHHhcCCCeEEEEEEEcCCCCEEEEEEEeeeEEcCCCCEEEEEEEEeehhHHHHHHHHHHHHH-------------
Confidence 5566777777776666666666666678888999999999999999999999999876654432211
Q ss_pred HHHHHHHHHHHHHHHHHHHhhhccccHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCee
Q 039716 358 NKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMK 437 (1002)
Q Consensus 358 ~k~~~~~e~~~~~k~fla~iSHELRTPL~~I~g~~elL~~~~l~~~~~~~l~~i~~s~~~L~~LIndlLd~skiesg~~~ 437 (1002)
..+.+|+++|||||||||++|.|++++|.....++++++++..+..++.++..+|++++++++++++.+.
T Consensus 281 ----------~~~~~~~a~isHelrtPL~~I~g~~~ll~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~~~~ 350 (779)
T PRK11091 281 ----------RDKTTFISTISHELRTPLNGIVGLSRILLDTELTAEQRKYLKTIHVSAITLGNIFNDIIDMDKMERRKLQ 350 (779)
T ss_pred ----------HHHHHHHHHhhHhhcCcHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhCCCcE
Confidence 0124799999999999999999999999888888999999999999999999999999999999999999
Q ss_pred eEeeecCHHHHHHHHHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCCCCeeEEEEEecCCCC
Q 039716 438 LEAAKFRPREVVKHVLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPP 516 (1002)
Q Consensus 438 l~~~~~~l~~li~~v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~~G~I~I~v~~~~~~~ 516 (1002)
+...++++.++++.+...+..... +++.+........|..+.+|+.+|+|||.||++||+||++.|.|.|.+....
T Consensus 351 ~~~~~~~l~~~i~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~d~~~l~qvl~NLl~NAik~~~~g~v~i~~~~~~--- 427 (779)
T PRK11091 351 LDNQPIDFTDFLADLENLSGLQAEQKGLRFDLEPLLPLPHKVITDGTRLRQILWNLISNAVKFTQQGGVTVRVRYEE--- 427 (779)
T ss_pred EEeeccCHHHHHHHHHHHHHHHHHhcCCEEEEEeCCCCCceEEeCHHHHHHHHHHHHHHHHHhCCCCcEEEEEEEcc---
Confidence 999999999999999887766543 6677777777777777999999999999999999999999998887764310
Q ss_pred cccchhhhhhhhhhcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEEEE
Q 039716 517 FAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDV 596 (1002)
Q Consensus 517 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V 596 (1002)
...+.|+|
T Consensus 428 ------------------------------------------------------------------------~~~~~i~V 435 (779)
T PRK11091 428 ------------------------------------------------------------------------GDMLTFEV 435 (779)
T ss_pred ------------------------------------------------------------------------CCEEEEEE
Confidence 11378999
Q ss_pred EecCCCCCcCcHhhhhhhccCC-CccccCcCCCccccHHHHHHHHHHhCCEEEEEeecCCceEEEEEEeCCCCCCCCCCC
Q 039716 597 YDTGIGIPENALPTLFRKYMQV-SADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSD 675 (1002)
Q Consensus 597 ~DtGiGI~~e~l~~IF~pF~q~-~~~~~~~~~GtGLGLaI~k~Lve~~gG~I~v~S~~g~GTtF~~~LP~~~~~~~~~~~ 675 (1002)
.|||+|||++.+++||+|||++ +...++.++||||||+|||+||+.|||+|+|+|.+|+||+|+|+||+.........
T Consensus 436 ~D~G~Gi~~~~~~~iF~~f~~~~~~~~~~~~~GtGLGL~i~~~iv~~~gG~i~v~s~~g~Gt~f~i~lP~~~~~~~~~~- 514 (779)
T PRK11091 436 EDSGIGIPEDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSKRLAQAMGGDITVTSEEGKGSCFTLTIHAPAVAEEVED- 514 (779)
T ss_pred EecCCCCCHHHHHHHHHHhhcccCCCCCCCCCCcchHHHHHHHHHHHcCCEEEEEecCCCeEEEEEEEecccccccccc-
Confidence 9999999999999999999998 44445557899999999999999999999999999999999999997432100000
Q ss_pred CCCccccccccCCcccccccccccccccccccccccCCcccccccccccccccccccccCccccccCCCCCcccccccch
Q 039716 676 DPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPL 755 (1002)
Q Consensus 676 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 755 (1002)
T Consensus 515 -------------------------------------------------------------------------------- 514 (779)
T PRK11091 515 -------------------------------------------------------------------------------- 514 (779)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred hhhccHHHHHhhhCCCCCCCCCCCCCCcchhhcccccccccccccccCCCCCccchhhhhHHHhhcccCCCchhhhhhcc
Q 039716 756 EDACSVAEVAETLSEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQE 835 (1002)
Q Consensus 756 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 835 (1002)
.+
T Consensus 515 ----------------------~~-------------------------------------------------------- 516 (779)
T PRK11091 515 ----------------------AF-------------------------------------------------------- 516 (779)
T ss_pred ----------------------cc--------------------------------------------------------
Confidence 00
Q ss_pred CCCcccCCCCCCCCCCCCCCCCCCCeEEEEecCHHHHHHHHHHHHhcCCeEEEEcCHHHHHHHHHcCCCcEEEEcCCCCC
Q 039716 836 KPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPV 915 (1002)
Q Consensus 836 ~~~~~~~~~~~~~~~~~~~~~~~~~~ILiVeDn~~n~~~l~~~L~~~g~~v~~a~~G~eAl~~~~~~~~DlIlmDi~MP~ 915 (1002)
. ....+..+.+||||||++.++..+..+|+..||.|..|.+|.+|++.+....||+||||+.||+
T Consensus 517 -----------~----~~~~~~~~~~ILivdD~~~~~~~l~~~L~~~g~~v~~a~~~~eal~~~~~~~~Dlvl~D~~mp~ 581 (779)
T PRK11091 517 -----------D----EDDMPLPALNILLVEDIELNVIVARSVLEKLGNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPD 581 (779)
T ss_pred -----------c----cccccccccceEEEcCCHHHHHHHHHHHHHcCCEEEEECCHHHHHHHhhcCCCCEEEEcCCCCC
Confidence 0 0000023468999999999999999999999999999999999999999999999999999999
Q ss_pred CCHHHHHHHHhccccCCCchhhhhhhhcccCCCCCCCCCCCC-ccEEEEcCCCCHHHHHHHHHcCCCEEEeCCCChHHHH
Q 039716 916 MDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKR-IPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLK 994 (1002)
Q Consensus 916 mdG~e~~~~IR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-ipIIalTa~~~~~~~~~~~~aG~d~~l~KP~~~~~L~ 994 (1002)
|||+++++.||.... .+. +|||++|++... ...+|+.+||++||.||++..+|.
T Consensus 582 ~~G~e~~~~ir~~~~------------------------~~~~~~ii~~ta~~~~-~~~~~~~~G~~~~l~KP~~~~~L~ 636 (779)
T PRK11091 582 MTGLDIARELRERYP------------------------REDLPPLVALTANVLK-DKKEYLDAGMDDVLSKPLSVPALT 636 (779)
T ss_pred CCHHHHHHHHHhccc------------------------cCCCCcEEEEECCchH-hHHHHHHCCCCEEEECCCCHHHHH
Confidence 999999999996321 134 499999998765 467899999999999999999999
Q ss_pred HHHHhhc
Q 039716 995 ECLEQYF 1001 (1002)
Q Consensus 995 ~~l~~~l 1001 (1002)
.+|.+++
T Consensus 637 ~~l~~~~ 643 (779)
T PRK11091 637 AMIKKFW 643 (779)
T ss_pred HHHHHHh
Confidence 9998875
|
|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >PRK09303 adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10604 sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >PRK10815 sensor protein PhoQ; Provisional | Back alignment and domain information |
|---|
| >COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10364 sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10549 signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >PRK10755 sensor protein BasS/PmrB; Provisional | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase | Back alignment and domain information |
|---|
| >TIGR01386 cztS_silS_copS heavy metal sensor kinase | Back alignment and domain information |
|---|
| >PRK09835 sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >PRK09470 cpxA two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK10337 sensor protein QseC; Provisional | Back alignment and domain information |
|---|
| >PRK09467 envZ osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK11100 sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11644 sensory histidine kinase UhpB; Provisional | Back alignment and domain information |
|---|
| >COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >PRK10935 nitrate/nitrite sensor protein NarQ; Provisional | Back alignment and domain information |
|---|
| >PRK10600 nitrate/nitrite sensor protein NarX; Provisional | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10547 chemotaxis protein CheA; Provisional | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK04184 DNA topoisomerase VI subunit B; Validated | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >smart00387 HATPase_c Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK14868 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01052 top6b DNA topoisomerase VI, B subunit | Back alignment and domain information |
|---|
| >PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK14867 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR01925 spIIAB anti-sigma F factor | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK03660 anti-sigma F factor; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04069 serine-protein kinase RsbW; Provisional | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A | Back alignment and domain information |
|---|
| >TIGR01924 rsbW_low_gc serine-protein kinase RsbW | Back alignment and domain information |
|---|
| >smart00388 HisKA His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] | Back alignment and domain information |
|---|
| >COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14501 HATPase_c_5: GHKL domain | Back alignment and domain information |
|---|
| >KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D | Back alignment and domain information |
|---|
| >cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >TIGR00585 mutl DNA mismatch repair protein MutL | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >TIGR00229 sensory_box PAS domain S-box | Back alignment and domain information |
|---|
| >PF13581 HATPase_c_2: Histidine kinase-like ATPase domain | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >PRK00095 mutL DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >PF12860 PAS_7: PAS fold | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK14083 HSP90 family protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PRK05559 DNA topoisomerase IV subunit B; Reviewed | Back alignment and domain information |
|---|
| >PRK05218 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial | Back alignment and domain information |
|---|
| >PTZ00130 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >TIGR01059 gyrB DNA gyrase, B subunit | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
| >COG2461 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05644 gyrB DNA gyrase subunit B; Validated | Back alignment and domain information |
|---|
| >COG5381 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A | Back alignment and domain information |
|---|
| >COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >smart00433 TOP2c TopoisomeraseII | Back alignment and domain information |
|---|
| >PRK09426 methylmalonyl-CoA mutase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1002 | ||||
| 4euk_A | 153 | Crystal Structure Length = 153 | 1e-55 | ||
| 2ayx_A | 254 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 2e-15 | ||
| 2ayz_A | 133 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 1e-14 | ||
| 3c97_A | 140 | Crystal Structure Of The Response Regulator Receive | 2e-13 | ||
| 2r25_B | 133 | Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef | 2e-12 | ||
| 1oxb_B | 134 | Complex Between Ypd1 And Sln1 Response Regulator Do | 2e-12 | ||
| 3sl2_A | 177 | Atp Forms A Stable Complex With The Essential Histi | 3e-11 | ||
| 2c2a_A | 258 | Structure Of The Entire Cytoplasmic Portion Of A Se | 2e-10 | ||
| 3dge_A | 258 | Structure Of A Histidine Kinase-response Regulator | 2e-10 | ||
| 3m6m_D | 143 | Crystal Structure Of Rpff Complexed With Rec Domain | 1e-08 | ||
| 3kht_A | 144 | Crystal Structure Of Response Regulator From Hahell | 9e-08 | ||
| 4ew8_A | 268 | Crystal Structure Of A C-Terminal Part Of Tyrosine | 9e-08 | ||
| 1m5t_A | 124 | Crystal Structure Of The Response Regulator Divk Le | 1e-07 | ||
| 3mm4_A | 206 | Crystal Structure Of The Receiver Domain Of The His | 2e-07 | ||
| 1ab5_A | 125 | Structure Of Chey Mutant F14n, V21t Length = 125 | 3e-07 | ||
| 1ab6_A | 125 | Structure Of Chey Mutant F14n, V86t Length = 125 | 5e-07 | ||
| 3fgz_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 1e-06 | ||
| 1ymv_A | 129 | Signal Transduction Protein Chey Mutant With Phe 14 | 2e-06 | ||
| 1udr_A | 129 | Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep | 2e-06 | ||
| 3ffx_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59r, | 2e-06 | ||
| 3fft_A | 128 | Crystal Structure Of Chey Double Mutant F14e, E89r | 2e-06 | ||
| 3rvj_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 2e-06 | ||
| 1ymu_A | 130 | Signal Transduction Protein Chey Mutant With Met 17 | 2e-06 | ||
| 1d4z_A | 128 | Crystal Structure Of Chey-95iv, A Hyperactive Chey | 3e-06 | ||
| 3ffw_A | 128 | Crystal Structure Of Chey Triple Mutant F14q, N59k, | 3e-06 | ||
| 3f7n_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 3e-06 | ||
| 1djm_A | 129 | Solution Structure Of Bef3-Activated Chey From Esch | 4e-06 | ||
| 1eay_A | 128 | Chey-Binding (P2) Domain Of Chea In Complex With Ch | 4e-06 | ||
| 1cye_A | 129 | Three Dimensional Structure Of Chemotactic Che Y Pr | 4e-06 | ||
| 1cey_A | 128 | Assignments, Secondary Structure, Global Fold, And | 4e-06 | ||
| 3rvp_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 4e-06 | ||
| 3rvl_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 4e-06 | ||
| 1mih_A | 129 | A Role For Chey Glu 89 In Chez-Mediated Dephosphory | 5e-06 | ||
| 2chy_A | 128 | Three-Dimensional Structure Of Chey, The Response R | 5e-06 | ||
| 3gt7_A | 154 | Crystal Structure Of Signal Receiver Domain Of Sign | 6e-06 | ||
| 3myy_A | 128 | Structure Of E. Coli Chey Mutant A113p Bound To Ber | 6e-06 | ||
| 3oo0_A | 129 | Structure Of Apo Chey A113p Length = 129 | 6e-06 | ||
| 3rvn_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 6e-06 | ||
| 2fka_A | 129 | Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che | 6e-06 | ||
| 2che_A | 128 | Structure Of The Mg2+-Bound Form Of Chey And Mechan | 6e-06 | ||
| 5chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 6e-06 | ||
| 1e6k_A | 130 | Two-Component Signal Transduction System D12a Mutan | 7e-06 | ||
| 3olx_A | 129 | Structural And Functional Effects Of Substitution A | 9e-06 | ||
| 3olw_A | 129 | Structural And Functional Effects Of Substitution A | 1e-05 | ||
| 3olv_A | 129 | Structural And Functional Effects Of Substitution A | 1e-05 | ||
| 1jbe_A | 128 | 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co | 1e-05 | ||
| 3oly_A | 129 | Structural And Functional Effects Of Substitution A | 2e-05 | ||
| 1vlz_A | 128 | Uncoupled Phosphorylation And Activation In Bacteri | 2e-05 | ||
| 1e6l_A | 127 | Two-Component Signal Transduction System D13a Mutan | 2e-05 | ||
| 1ehc_A | 128 | Structure Of Signal Transduction Protein Chey Lengt | 2e-05 | ||
| 3to5_A | 134 | High Resolution Structure Of Chey3 From Vibrio Chol | 2e-05 | ||
| 1dcf_A | 136 | Crystal Structure Of The Receiver Domain Of The Eth | 2e-05 | ||
| 3i42_A | 127 | Structure Of Response Regulator Receiver Domain (Ch | 2e-05 | ||
| 6chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 2e-05 | ||
| 1zdm_A | 129 | Crystal Structure Of Activated Chey Bound To Xe Len | 3e-05 | ||
| 1c4w_A | 128 | 1.9 A Structure Of A-Thiophosphonate Modified Chey | 3e-05 | ||
| 1hey_A | 128 | Investigating The Structural Determinants Of The P2 | 3e-05 | ||
| 1e6m_A | 128 | Two-Component Signal Transduction System D57a Mutan | 3e-05 | ||
| 3h1g_A | 129 | Crystal Structure Of Chey Mutant T84a Of Helicobact | 1e-04 | ||
| 2id7_A | 128 | 1.75 A Structure Of T87i Phosphono-Chey Length = 12 | 1e-04 | ||
| 3dge_C | 122 | Structure Of A Histidine Kinase-response Regulator | 1e-04 | ||
| 2id9_A | 128 | 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length | 2e-04 | ||
| 3gwg_A | 129 | Crystal Structure Of Chey Of Helicobacter Pylori Le | 3e-04 | ||
| 3d36_A | 244 | How To Switch Off A Histidine Kinase: Crystal Struc | 5e-04 | ||
| 1u8t_A | 128 | Crystal Structure Of Chey D13k Y106w Alone And In C | 6e-04 | ||
| 3a0r_A | 349 | Crystal Structure Of Histidine Kinase Thka (Tm1359) | 6e-04 |
| >pdb|4EUK|A Chain A, Crystal Structure Length = 153 | Back alignment and structure |
|
| >pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 | Back alignment and structure |
| >pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 | Back alignment and structure |
| >pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 | Back alignment and structure |
| >pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3- Length = 133 | Back alignment and structure |
| >pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain In Space Group P2(1)2(1)2(1) Length = 134 | Back alignment and structure |
| >pdb|3SL2|A Chain A, Atp Forms A Stable Complex With The Essential Histidine Kinase Walk (yycg) Domain Length = 177 | Back alignment and structure |
| >pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 | Back alignment and structure |
| >pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 | Back alignment and structure |
| >pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 | Back alignment and structure |
| >pdb|3KHT|A Chain A, Crystal Structure Of Response Regulator From Hahella Chejuensis Length = 144 | Back alignment and structure |
| >pdb|4EW8|A Chain A, Crystal Structure Of A C-Terminal Part Of Tyrosine Kinase (Divl) From Caulobacter Crescentus Cb15 At 2.50 A Resolution Length = 268 | Back alignment and structure |
| >pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 | Back alignment and structure |
| >pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 | Back alignment and structure |
| >pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 | Back alignment and structure |
| >pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 | Back alignment and structure |
| >pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 | Back alignment and structure |
| >pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 | Back alignment and structure |
| >pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 | Back alignment and structure |
| >pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 | Back alignment and structure |
| >pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 | Back alignment and structure |
| >pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 | Back alignment and structure |
| >pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 | Back alignment and structure |
| >pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 | Back alignment and structure |
| >pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 | Back alignment and structure |
| >pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 | Back alignment and structure |
| >pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 | Back alignment and structure |
| >pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 | Back alignment and structure |
| >pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|3GT7|A Chain A, Crystal Structure Of Signal Receiver Domain Of Signal Transduction Histidine Kinase From Syntrophus Aciditrophicus Length = 154 | Back alignment and structure |
| >pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 | Back alignment and structure |
| >pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 | Back alignment and structure |
| >pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 | Back alignment and structure |
| >pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 | Back alignment and structure |
| >pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 | Back alignment and structure |
| >pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 | Back alignment and structure |
| >pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 | Back alignment and structure |
| >pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 | Back alignment and structure |
| >pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 | Back alignment and structure |
| >pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 | Back alignment and structure |
| >pdb|1DCF|A Chain A, Crystal Structure Of The Receiver Domain Of The Ethylene Receptor Of Arabidopsis Thaliana Length = 136 | Back alignment and structure |
| >pdb|3I42|A Chain A, Structure Of Response Regulator Receiver Domain (Chey-Like) From Methylobacillus Flagellatus Length = 127 | Back alignment and structure |
| >pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 | Back alignment and structure |
| >pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 | Back alignment and structure |
| >pdb|1HEY|A Chain A, Investigating The Structural Determinants Of The P21-Like Triphosphate And Mg2+ Binding Site Length = 128 | Back alignment and structure |
| >pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 | Back alignment and structure |
| >pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 | Back alignment and structure |
| >pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 | Back alignment and structure |
| >pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3D36|A Chain A, How To Switch Off A Histidine Kinase: Crystal Structure Of Geobacillus Stearothermophilus Kinb With The Inhibitor Sda Length = 244 | Back alignment and structure |
| >pdb|1U8T|A Chain A, Crystal Structure Of Chey D13k Y106w Alone And In Complex With A Flim Peptide Length = 128 | Back alignment and structure |
| >pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1002 | |||
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 7e-52 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 1e-51 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 3e-50 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 1e-13 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 4e-50 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 1e-47 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 2e-47 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 1e-27 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 8e-47 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 1e-45 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 2e-42 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 4e-40 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 3e-29 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 5e-40 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 1e-34 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 2e-18 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 2e-28 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 4e-27 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 2e-13 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 5e-27 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 2e-26 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 3e-10 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 3e-24 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 1e-23 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 2e-22 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 8e-22 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 4e-12 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 3e-20 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 6e-20 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 6e-13 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 1e-19 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 1e-19 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 2e-19 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 2e-10 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 7e-19 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 1e-18 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 2e-18 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 2e-18 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 3e-18 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 3e-18 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 6e-18 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 1e-17 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 2e-17 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 4e-07 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 2e-17 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 3e-17 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 1e-16 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 3e-06 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 3e-16 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 4e-16 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 5e-16 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 7e-16 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 2e-15 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 3e-15 | |
| 3r0j_A | 250 | Possible two component system response transcript | 5e-15 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 5e-15 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 6e-15 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 1e-14 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 1e-13 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 1e-14 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 9e-08 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 1e-14 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 2e-14 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 2e-14 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 3e-14 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 3e-14 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 3e-14 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 3e-14 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 5e-14 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 8e-14 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 1e-13 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 1e-13 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 1e-13 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 1e-13 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 1e-13 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 2e-13 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 4e-04 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 2e-13 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 1e-08 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 2e-13 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 2e-13 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 2e-13 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 2e-13 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 4e-13 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 5e-13 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 7e-13 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 7e-13 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 2e-11 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 7e-13 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 1e-12 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 2e-12 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 3e-12 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 3e-12 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 3e-12 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 3e-12 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 6e-12 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 6e-12 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 6e-12 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 9e-12 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 9e-12 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 9e-12 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 1e-11 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 1e-11 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 2e-11 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 2e-11 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 2e-11 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 3e-11 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 3e-11 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 4e-11 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 5e-11 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 5e-11 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 6e-11 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 7e-11 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 1e-10 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 1e-10 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 2e-10 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 3e-10 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 8e-10 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 1e-09 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 2e-09 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 2e-09 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 6e-09 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 7e-09 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 7e-09 | |
| 1th8_A | 145 | Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s | 9e-09 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 9e-09 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 2e-08 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 3e-08 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 3e-08 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 5e-08 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 5e-08 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 6e-08 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 7e-08 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 9e-08 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 2e-07 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 3e-07 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 5e-07 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 2e-06 | |
| 4fmt_A | 228 | CHPT protein; A phosphotransfer protein, A two-com | 2e-06 | |
| 4fmt_A | 228 | CHPT protein; A phosphotransfer protein, A two-com | 5e-05 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 2e-06 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 9e-06 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 3e-05 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 7e-05 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 2e-04 | |
| 3cax_A | 369 | Uncharacterized protein PF0695; structural genomic | 7e-04 |
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
Score = 177 bits (451), Expect = 7e-52
Identities = 29/142 (20%), Positives = 63/142 (44%), Gaps = 22/142 (15%)
Query: 861 KILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLK 920
K+L++++N ++ MV K ++ LG + V++ E + V + ++ MDVCMP ++ +
Sbjct: 9 KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVS-HEHKVVFMDVCMPGVENYQ 67
Query: 921 ATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGM 980
I + +R ++A++ N + E+C + G+
Sbjct: 68 IALRIHEKF---------------------TKQRHQRPLLVALSGNTDKSTKEKCMSFGL 106
Query: 981 DSFVSKPVTFQKLKECLEQYFP 1002
D + KPV+ +++ L
Sbjct: 107 DGVLLKPVSLDNIRDVLSDLLE 128
|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 | Back alignment and structure |
|---|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 | Back alignment and structure |
|---|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 | Back alignment and structure |
|---|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Length = 158 | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Length = 185 | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Length = 114 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Length = 145 | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 | Back alignment and structure |
|---|
| >4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Length = 152 | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Length = 125 | Back alignment and structure |
|---|
| >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Length = 369 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1002 | |||
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 100.0 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 100.0 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 100.0 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 100.0 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 100.0 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 100.0 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 100.0 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 99.98 | |
| 4fpp_A | 247 | Phosphotransferase; four helix bundle, bergerat fo | 99.97 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 99.97 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 99.97 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.93 | |
| 1b3q_A | 379 | Protein (chemotaxis protein CHEA); histine kinase, | 99.93 | |
| 3ehh_A | 218 | Sensor kinase (YOCF protein); four-helix bundle, G | 99.91 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.91 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 99.9 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 99.89 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 99.89 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 99.88 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 99.87 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 99.87 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.87 | |
| 1i58_A | 189 | Chemotaxis protein CHEA; beta-alpha sandwich, sign | 99.85 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.84 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.82 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.82 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.81 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.81 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.8 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.8 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.79 | |
| 3ehg_A | 128 | Sensor kinase (YOCF protein); GHL ATPase domain, t | 99.78 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.78 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.78 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.77 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 99.77 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.77 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 99.77 | |
| 3zxo_A | 129 | Redox sensor histidine kinase response regulator; | 99.77 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.77 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.76 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.76 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 99.76 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 99.76 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 99.76 | |
| 3r0j_A | 250 | Possible two component system response transcript | 99.76 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 99.76 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.75 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.75 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.75 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.75 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 99.75 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 99.75 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 99.75 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 99.75 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.75 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 99.75 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 99.75 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.74 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 99.74 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 99.74 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 99.74 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 99.74 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 99.74 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 99.74 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 99.74 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 99.74 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 99.74 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.73 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 99.73 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 99.73 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 99.73 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 99.73 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 99.73 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 99.73 | |
| 3zxq_A | 124 | Hypoxia sensor histidine kinase response regulato; | 99.72 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 99.72 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 99.72 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 99.72 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 99.72 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 99.72 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 99.72 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.72 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 99.72 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 99.72 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 99.71 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 99.71 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 99.71 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 99.71 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 99.7 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 99.7 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 99.7 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 99.7 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 99.69 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 99.69 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 99.69 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 99.69 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 99.69 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 99.69 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 99.69 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 99.69 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 99.69 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 99.69 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.68 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 99.68 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.68 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 99.68 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 99.67 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 99.67 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 99.67 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 99.67 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 99.67 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 99.67 | |
| 1th8_A | 145 | Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s | 99.66 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 99.65 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 99.65 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 99.65 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 99.65 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 99.64 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 99.64 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 99.64 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 99.64 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 99.64 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 99.64 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 99.62 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 99.62 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 99.62 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 99.62 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 99.6 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 99.6 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 99.59 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.57 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 99.53 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 99.45 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 99.42 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 99.1 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.05 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 98.99 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 98.93 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 98.9 | |
| 3mr0_A | 142 | Sensory box histidine kinase/response regulator; P | 98.88 | |
| 2gj3_A | 120 | Nitrogen fixation regulatory protein; PAS domain, | 98.81 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 98.8 | |
| 4hia_A | 176 | LOV protein; PAS, HTH, signaling protein; HET: FMN | 98.8 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 98.77 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 98.76 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 98.74 | |
| 3nja_A | 125 | Probable ggdef family protein; structural genomics | 98.71 | |
| 3f1p_B | 121 | ARYL hydrocarbon receptor nuclear translocator; PA | 98.68 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 98.67 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 98.64 | |
| 3lyx_A | 124 | Sensory BOX/ggdef domain protein; structural genom | 98.59 | |
| 3vol_A | 233 | Aerotaxis transducer AER2; heme, oxygen sensor pro | 98.56 | |
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 98.52 | |
| 3eeh_A | 125 | Putative light and redox sensing histidine kinase; | 98.47 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 98.47 | |
| 1d06_A | 130 | Nitrogen fixation regulatory protein FIXL; oxygen | 98.46 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 98.46 | |
| 3f1p_A | 117 | Endothelial PAS domain-containing protein 1; PAS d | 98.46 | |
| 3icy_A | 118 | Sensor protein; sensory box histidine kinase/respo | 98.45 | |
| 1v9y_A | 167 | Heme PAS sensor protein; signaling protein; HET: H | 98.38 | |
| 1b63_A | 333 | MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A | 98.36 | |
| 2qkp_A | 151 | Uncharacterized protein; structural genomics, unkn | 98.35 | |
| 1kij_A | 390 | DNA gyrase subunit B; topoisomerase, gyrase B-coum | 98.34 | |
| 3mqq_A | 120 | Transcriptional regulator, LUXR family; PAS domain | 98.31 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 98.28 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 98.27 | |
| 1h7s_A | 365 | PMS1 protein homolog 2; DNA repair, GHL ATPase, mi | 98.27 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 98.26 | |
| 4hi4_A | 121 | Aerotaxis transducer AER2; PAS domain, diatomic GA | 98.26 | |
| 3na3_A | 348 | DNA mismatch repair protein MLH1; MUTL protein hom | 98.21 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 98.21 | |
| 3ke6_A | 399 | Protein RV1364C/MT1410; anti-sigma factor, anti-si | 98.21 | |
| 2vv6_A | 119 | FIXL, sensor protein FIXL; signaling protein, tran | 98.18 | |
| 2r78_A | 117 | Sensor protein; sensory box sensor histidine kinas | 98.17 | |
| 3mjq_A | 126 | Uncharacterized protein; NESG, structural genomics | 98.16 | |
| 3h9w_A | 115 | Diguanylate cyclase with PAS/PAC sensor; alpha-bet | 98.11 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 98.05 | |
| 3olo_A | 118 | Two-component sensor histidine kinase; structural | 98.03 | |
| 3fg8_A | 118 | Uncharacterized protein RHA05790; PAS domain, stru | 97.97 | |
| 3bwl_A | 126 | Sensor protein; structural genomics, APC87707.1, P | 97.95 | |
| 2kdk_A | 121 | ARYL hydrocarbon receptor nuclear translocator-LI | 97.95 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 97.9 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 97.89 | |
| 3cax_A | 369 | Uncharacterized protein PF0695; structural genomic | 97.88 | |
| 3zcc_A | 114 | HAMP, osmolarity sensor protein ENVZ; signaling pr | 97.87 | |
| 3h4l_A | 367 | DNA mismatch repair protein PMS1; ATP binding, DNA | 97.87 | |
| 3b33_A | 115 | Sensor protein; structural genomics, PAS domain, n | 97.64 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 97.59 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 97.57 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 97.55 | |
| 2w0n_A | 118 | Sensor protein DCUS; signal transduction, two-comp | 97.5 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 97.47 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 97.39 | |
| 1ixm_A | 192 | SPO0B, protein (sporulation response regulatory pr | 97.38 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 97.27 | |
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 97.25 | |
| 3mfx_A | 129 | Sensory BOX/ggdef family protein; alpha-beta prote | 97.16 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 97.12 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 97.1 | |
| 3zrx_A | 115 | AF1503 protein, osmolarity sensor protein ENVZ; si | 96.9 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 96.88 | |
| 1nwz_A | 125 | PYP, photoactive yellow protein; PAS, LOV, GAF, do | 96.77 | |
| 3a0s_A | 96 | Sensor protein; PAS-fold, kinase, phosphoprotein, | 96.72 | |
| 1mzu_A | 129 | PPR; photoactive yellow protein, PAS, PYP, signali | 96.68 | |
| 2vlg_A | 111 | Sporulation kinase A; histidine kinase, two-compon | 96.67 | |
| 1s16_A | 390 | Topoisomerase IV subunit B; two-domain protein com | 96.47 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.28 | |
| 2ykf_A | 305 | Pdtas, probable sensor histidine kinase pdtas; tra | 95.13 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 96.12 | |
| 1ll8_A | 114 | PAS kinase; PAS domain, ligand binding, ligand scr | 95.92 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 95.73 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 95.52 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 95.5 | |
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 95.39 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 95.27 | |
| 3rty_A | 339 | Period circadian protein; PAS domain, signalling, | 95.18 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 94.71 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 94.63 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 94.58 | |
| 1ei1_A | 391 | DNA gyrase B, GYRB; ATPase domain, dimer, isomeras | 94.54 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 94.24 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 93.68 | |
| 3fv5_A | 201 | DNA topoisomerase 4 subunit B; topoisomerase IV B | 93.62 | |
| 3cwv_A | 369 | DNA gyrase, B subunit, truncated; structural genom | 92.69 | |
| 4dj3_A | 317 | Period circadian protein homolog 3; PAS domain, ci | 92.63 | |
| 3gdi_A | 309 | Period circadian protein homolog 2; tandem PAS dom | 91.73 | |
| 3q7r_A | 121 | Transcriptional regulatory protein; CHXR, receiver | 91.63 | |
| 4dj2_A | 320 | Period circadian protein homolog 1; PAS domains, c | 91.47 | |
| 4duh_A | 220 | DNA gyrase subunit B; structure-based drug design, | 90.08 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 89.58 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 87.43 | |
| 4emv_A | 226 | DNA topoisomerase IV, B subunit; protein-inhibitor | 87.34 | |
| 1zxm_A | 400 | TOPO IIA ATPase, DNA topoisomerase II, alpha isozy | 87.08 | |
| 3ied_A | 272 | Heat shock protein; HSP90, chaperone, structural g | 85.77 | |
| 3ttz_A | 198 | DNA gyrase subunit B; protein-inhibitor complex, A | 83.73 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 83.19 | |
| 1oj5_A | 132 | Steroid receptor coactivator 1A; transcriptional c | 81.06 | |
| 2i2x_B | 258 | MTAC, methyltransferase 1; TIM barrel and helix bu | 80.67 |
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-40 Score=374.05 Aligned_cols=335 Identities=24% Similarity=0.351 Sum_probs=255.6
Q ss_pred HHHHHHHHHHHHhccCcEEEEecccccEEEeeccC---CCCCcccccCCCchhccCccchhhhhHHHHHHHHhCCCccee
Q 039716 217 LKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHF---PSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKRE 293 (1002)
Q Consensus 217 l~~~~~~l~~il~~~p~~i~~~d~~~~~~~~~~~~---~~~~~e~iiGk~~~e~~~~~~~~~~~~~~~~vl~~g~~~~~e 293 (1002)
+++++.+++.+++++|.+|+..|.++++.++|..+ .|+..++++|++..++... .........++..+.+..
T Consensus 3 l~~~~~~~~~i~~~~~~~i~~~d~~g~i~~~N~a~~~l~G~~~~e~~G~~~~~~~~~---~~~~~~~~~~~~~~~~~~-- 77 (349)
T 3a0r_A 3 VEHLRNFSESILESLETAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDF---EEIGSVAESVFENKEPVF-- 77 (349)
T ss_dssp ------CCCSSGGGSSSEEEEEESSSBCSCBCHHHHHHHSCCSTTTTTCBSTTSTTT---THHHHHHHHHHHHCCCCE--
T ss_pred hHHHHHHHHHHHhhhcCeEEEECCCCCEEeeHHHHHHHhCCCHHHHcCcCHHHCcCh---hHHHHHHHHHHhcCCcee--
Confidence 44556778889999999999999999999998764 6888999999998887332 223334455666655432
Q ss_pred EEEEEeecCceEEEEEEeeeecCCCCE-EEEEEEeechhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039716 294 ITFETELFGSKTFLIYVEPVFSKSGET-IGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQ 372 (1002)
Q Consensus 294 ~~~~~~~~~~~~~~~~~~p~~~~~G~~-~gi~~~~~DITe~~~~~~~~~~l~~el~~~~~~~~el~k~~~~~e~~~~~k~ 372 (1002)
......+..++.+...|+.+..|.. .|+++++.|||++++.++++.+. +.....++
T Consensus 78 --~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~DiTe~~~~e~~~~~~---------------------~~~~~~~~ 134 (349)
T 3a0r_A 78 --LNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDDVTELYKYEEERKRR---------------------ERLSILGE 134 (349)
T ss_dssp --EECCCBTTBCCEEEEEEECCTTTTSSCEEEEEEECCSTTTTTTTTTTHH---------------------HHHHHHHH
T ss_pred --ecccccCceEEEEEEEEEEcCCCceeeEEEEEEEechHHHHHHHHHHHH---------------------HHHHHHHH
Confidence 2222346677888899999988775 58999999999987654433211 11112357
Q ss_pred HHHHhhhccccHHHHHHHHHHHHhCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCeeeEeeecCHHHHHHH
Q 039716 373 MLATMSHEIRSPLTGVVSMAEILSNTKLD-REQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKH 451 (1002)
Q Consensus 373 fla~iSHELRTPL~~I~g~~elL~~~~l~-~~~~~~l~~i~~s~~~L~~LIndlLd~skiesg~~~l~~~~~~l~~li~~ 451 (1002)
|++.+||||||||++|.+++++|.....+ +..+++++.+..++.++..++++++++++.. ..+...++++.++++.
T Consensus 135 ~~~~i~Helr~pL~~i~~~~~~l~~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~---~~~~~~~~~l~~~~~~ 211 (349)
T 3a0r_A 135 MTARVAHEIRNPITIIGGFIMRMKKHLDDPETLKKYINIITNELSRLETIVKEILEYSKER---QVLEFTEFNLNELIRE 211 (349)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHTTSCSCSSCTTHHHHHHHHHHHHHHHHHHHHHHHHHCC----CEEEEEEEHHHHHHH
T ss_pred HHHHHHHHhcchHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCc---cccCCcccCHHHHHHH
Confidence 99999999999999999999999765333 3457889999999999999999999999943 3466788999999999
Q ss_pred HHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCC-CCeeEEEEEecCCCCcccchhhhhhhhh
Q 039716 452 VLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTP-EGKVGIKLYVVPEPPFAKEGLKQKSKAY 529 (1002)
Q Consensus 452 v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~-~G~I~I~v~~~~~~~~~~~~~~~~~~~~ 529 (1002)
++..+...+. +.+.+....... +..+.+|+.+|.|||.||++||+||++ .|.|.|.+...
T Consensus 212 ~~~~~~~~~~~~~i~~~~~~~~~-~~~~~~d~~~l~~vl~nLl~NA~k~~~~~~~i~i~~~~~----------------- 273 (349)
T 3a0r_A 212 VYVLFEEKIRKMNIDFCFETDNE-DLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDM----------------- 273 (349)
T ss_dssp HHHHHHHHHTTTTCCCEEEESCS-CCEEEECHHHHHHHHHHHHTHHHHTTCTTCCEEEEEEEE-----------------
T ss_pred HHHHHHHHHHHcCcEEEEecCCC-CceEEeCHHHHHHHHHHHHHHHHHhccCCCEEEEEEEec-----------------
Confidence 9988876654 456666555544 346889999999999999999999995 57777766421
Q ss_pred hcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEEEEEecCCCCCcCcHh
Q 039716 530 QSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALP 609 (1002)
Q Consensus 530 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtGiGI~~e~l~ 609 (1002)
..++.|+|.|+|+|||++.++
T Consensus 274 -----------------------------------------------------------~~~~~i~v~D~G~Gi~~~~~~ 294 (349)
T 3a0r_A 274 -----------------------------------------------------------YTKVRVSVWNSGPPIPEELKE 294 (349)
T ss_dssp -----------------------------------------------------------TTEEEEEEEEESCCCCGGGGT
T ss_pred -----------------------------------------------------------CCEEEEEEEECCCCCChHHHh
Confidence 114889999999999999999
Q ss_pred hhhhhccCCCccccCcCCCccccHHHHHHHHH-HhCCEEEEEeecCCceEEEEEEeCC
Q 039716 610 TLFRKYMQVSADHARKYGGTGLGLAICKQLVE-LMGGRLTVTSKVHCGSTFTFILPYQ 666 (1002)
Q Consensus 610 ~IF~pF~q~~~~~~~~~~GtGLGLaI~k~Lve-~~gG~I~v~S~~g~GTtF~~~LP~~ 666 (1002)
+||+||++.+ .+|+||||+|||++|+ .|||.|+++|.++ ||+|+|+||..
T Consensus 295 ~if~~f~~~~------~~g~GlGL~i~~~~v~~~~gg~i~~~~~~~-Gt~f~i~lP~~ 345 (349)
T 3a0r_A 295 KIFSPFFTTK------TQGTGLGLSICRKIIEDEHGGKIWTENREN-GVVFIFEIPKT 345 (349)
T ss_dssp TTSSSCCCC------------CCCTHHHHHHHHTTCSBCCEEECSS-EEEEEEEEESC
T ss_pred hcCCCCccCC------CCCccchHHHHHHHHHHhCCCEEEEEeCCC-cEEEEEEecCC
Confidence 9999999753 4599999999999999 8999999999865 99999999975
|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* | Back alignment and structure |
|---|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A | Back alignment and structure |
|---|
| >4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A | Back alignment and structure |
|---|
| >3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* | Back alignment and structure |
|---|
| >4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* | Back alignment and structure |
|---|
| >3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* | Back alignment and structure |
|---|
| >1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* | Back alignment and structure |
|---|
| >2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* | Back alignment and structure |
|---|
| >4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* | Back alignment and structure |
|---|
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} | Back alignment and structure |
|---|
| >3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A | Back alignment and structure |
|---|
| >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A | Back alignment and structure |
|---|
| >3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* | Back alignment and structure |
|---|
| >1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... | Back alignment and structure |
|---|
| >3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* | Back alignment and structure |
|---|
| >1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 | Back alignment and structure |
|---|
| >2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... | Back alignment and structure |
|---|
| >1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* | Back alignment and structure |
|---|
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A | Back alignment and structure |
|---|
| >1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* | Back alignment and structure |
|---|
| >3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A | Back alignment and structure |
|---|
| >4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* | Back alignment and structure |
|---|
| >1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* | Back alignment and structure |
|---|
| >3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 | Back alignment and structure |
|---|
| >2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1002 | ||||
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 1e-24 | |
| d2c2aa2 | 161 | d.122.1.3 (A:321-481) Sensor histidine kinase TM08 | 2e-24 | |
| d2c2aa2 | 161 | d.122.1.3 (A:321-481) Sensor histidine kinase TM08 | 6e-11 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 2e-23 | |
| d1ysra1 | 148 | d.122.1.3 (A:299-446) Sensor-type histidine kinase | 1e-22 | |
| d1ysra1 | 148 | d.122.1.3 (A:299-446) Sensor-type histidine kinase | 8e-08 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 3e-22 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 3e-22 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 4e-22 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 1e-21 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 3e-21 | |
| d1bxda_ | 161 | d.122.1.3 (A:) Histidine kinase domain of the osmo | 6e-21 | |
| d1bxda_ | 161 | d.122.1.3 (A:) Histidine kinase domain of the osmo | 9e-08 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 3e-20 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 7e-20 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 2e-19 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 3e-19 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 3e-19 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 4e-19 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 5e-19 | |
| d1jm6a2 | 190 | d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin | 9e-19 | |
| d1jm6a2 | 190 | d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin | 5e-10 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 9e-19 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 1e-18 | |
| d1id0a_ | 146 | d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche | 1e-18 | |
| d1id0a_ | 146 | d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche | 1e-07 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 2e-18 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 7e-18 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 2e-17 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 3e-17 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 7e-17 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 1e-16 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 1e-16 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 7e-16 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 9e-16 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 2e-15 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 5e-15 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 5e-15 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 1e-14 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 5e-14 | |
| d1gkza2 | 193 | d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci | 7e-14 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 2e-13 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 4e-13 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 6e-13 | |
| d1i58a_ | 189 | d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m | 8e-13 | |
| d1r62a_ | 156 | d.122.1.3 (A:) Nitrogen regulation protein NtrB, C | 1e-12 | |
| d1r62a_ | 156 | d.122.1.3 (A:) Nitrogen regulation protein NtrB, C | 2e-07 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 2e-10 | |
| d2c2aa1 | 89 | a.30.2.1 (A:232-320) Sensor histidine kinase TM085 | 2e-08 | |
| d2hkja3 | 219 | d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A | 4e-08 | |
| d2hkja3 | 219 | d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A | 2e-04 | |
| d1joya_ | 67 | a.30.2.1 (A:) EnvZ histidine kinase {Escherichia c | 1e-07 | |
| d1th8a_ | 139 | d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus | 9e-05 |
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: Receiver domain of the ethylene receptor domain: Receiver domain of the ethylene receptor species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 98.1 bits (244), Expect = 1e-24
Identities = 29/140 (20%), Positives = 63/140 (45%), Gaps = 22/140 (15%)
Query: 861 KILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLK 920
K+L++++N ++ MV K ++ LG + V++ E + V + ++ MDVCMP ++ +
Sbjct: 9 KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVS-HEHKVVFMDVCMPGVENYQ 67
Query: 921 ATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGM 980
I + +R ++A++ N + E+C + G+
Sbjct: 68 IALRIHEKF---------------------TKQRHQRPLLVALSGNTDKSTKEKCMSFGL 106
Query: 981 DSFVSKPVTFQKLKECLEQY 1000
D + KPV+ +++ L
Sbjct: 107 DGVLLKPVSLDNIRDVLSDL 126
|
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 | Back information, alignment and structure |
|---|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Length = 67 | Back information, alignment and structure |
|---|
| >d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Length = 139 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1002 | |||
| d2c2aa2 | 161 | Sensor histidine kinase TM0853 {Thermotoga maritim | 100.0 | |
| d1ysra1 | 148 | Sensor-type histidine kinase PrrB {Mycobacterium t | 99.96 | |
| d1bxda_ | 161 | Histidine kinase domain of the osmosensor EnvZ {Es | 99.96 | |
| d1id0a_ | 146 | Histidine kinase PhoQ domain {Escherichia coli [Ta | 99.96 | |
| d1r62a_ | 156 | Nitrogen regulation protein NtrB, C-terminal domai | 99.95 | |
| d1gkza2 | 193 | Branched-chain alpha-ketoacid dehydrogenase kinase | 99.94 | |
| d1jm6a2 | 190 | Pyruvate dehydrogenase kinase {Rat (Rattus norvegi | 99.94 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.92 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.92 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.92 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.92 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.91 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.91 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.91 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.91 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.91 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.91 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.9 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.9 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.9 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.9 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.9 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.9 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.9 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.9 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.9 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.9 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.89 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.89 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.89 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.89 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.89 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.88 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.88 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.88 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.87 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.87 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.86 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.85 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.81 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.77 | |
| d1ixma_ | 179 | Sporulation response regulatory protein Spo0B {Bac | 99.7 | |
| d2hkja3 | 219 | Topoisomerase VI-B subunit {Archaeon Sulfolobus sh | 99.65 | |
| d1i58a_ | 189 | Histidine kinase CheA {Thermotoga maritima [TaxId: | 99.43 | |
| d1th8a_ | 139 | Anti-sigma factor spoIIab {Bacillus stearothermoph | 99.41 | |
| d2c2aa1 | 89 | Sensor histidine kinase TM0853 {Thermotoga maritim | 99.41 | |
| d1y8oa2 | 125 | Pyruvate dehydrogenase kinase {Human (Homo sapiens | 99.22 | |
| d1joya_ | 67 | EnvZ histidine kinase {Escherichia coli [TaxId: 56 | 99.04 | |
| d1ew0a_ | 130 | Histidine kinase FixL heme domain {Rhizobium melil | 98.74 | |
| d1n9la_ | 109 | Putative blue light receptor, phot-lov1 domain {Gr | 98.5 | |
| d1p97a_ | 114 | Hypoxia-inducible factor Hif2a, C-terminal domain | 98.34 | |
| d1jnua_ | 104 | Photoreceptor phy3 flavin-binding domain, lov2 {Ma | 98.33 | |
| d1bywa_ | 110 | Erg potassium channel, N-terminal domain {Human (H | 98.28 | |
| d1v9ya_ | 113 | Direct oxygen sensor protein, DOS {Escherichia col | 97.88 | |
| d1xj3a1 | 106 | Histidine kinase FixL heme domain {Bradyrhizobium | 97.57 | |
| d1nwza_ | 125 | Photoactive yellow protein, PYP {Ectothiorhodospir | 97.49 | |
| d1mzua_ | 110 | PYP domain of sensor histidine kinase Ppr {Rhodosp | 97.38 | |
| d1h7sa2 | 203 | DNA mismatch repair protein PMS2 {Human (Homo sapi | 96.4 | |
| d1oj5a_ | 109 | PAS domain of steroid receptor coactivator 1A, NCo | 95.47 | |
| d1b63a2 | 218 | DNA mismatch repair protein MutL {Escherichia coli | 95.36 | |
| d1ll8a_ | 114 | N-terminal PAS domain of Pas kinase {Human (Homo s | 95.07 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 92.98 | |
| d1pvga2 | 239 | DNA topoisomerase II {Baker's yeast (Saccharomyces | 86.52 | |
| d1ei1a2 | 219 | DNA gyrase B {Escherichia coli [TaxId: 562]} | 85.24 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 84.52 | |
| d2iwxa1 | 213 | HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T | 83.39 | |
| d1kija2 | 212 | DNA gyrase B {Thermus thermophilus [TaxId: 274]} | 80.22 |
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Histidine kinase domain: Sensor histidine kinase TM0853 species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=8.6e-33 Score=276.36 Aligned_cols=155 Identities=30% Similarity=0.434 Sum_probs=124.1
Q ss_pred eEeeecCHHHHHHHHHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCCCCee--EEEEEecCC
Q 039716 438 LEAAKFRPREVVKHVLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKV--GIKLYVVPE 514 (1002)
Q Consensus 438 l~~~~~~l~~li~~v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~~G~I--~I~v~~~~~ 514 (1002)
++.++|++.+++++++..+...+. +.+.+........+..+.+|+.+|+|||.|||+||+|||++|.+ .|.+.+..
T Consensus 2 l~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~- 80 (161)
T d2c2aa2 2 INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDE- 80 (161)
T ss_dssp CCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEE-
T ss_pred CccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCCEEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEEEEe-
Confidence 456789999999999998887664 56777766665666789999999999999999999999988642 33332210
Q ss_pred CCcccchhhhhhhhhhcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEE
Q 039716 515 PPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRC 594 (1002)
Q Consensus 515 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i 594 (1002)
...++.|
T Consensus 81 -------------------------------------------------------------------------~~~~~~i 87 (161)
T d2c2aa2 81 -------------------------------------------------------------------------KDGGVLI 87 (161)
T ss_dssp -------------------------------------------------------------------------ETTEEEE
T ss_pred -------------------------------------------------------------------------cCCEEEE
Confidence 1125889
Q ss_pred EEEecCCCCCcCcHhhhhhhccCCCccccCcCCCccccHHHHHHHHHHhCCEEEEEeecCCceEEEEEEeCC
Q 039716 595 DVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQ 666 (1002)
Q Consensus 595 ~V~DtGiGI~~e~l~~IF~pF~q~~~~~~~~~~GtGLGLaI~k~Lve~~gG~I~v~S~~g~GTtF~~~LP~~ 666 (1002)
+|.|+|+|||++.+++||+||||.+...+++.+|+||||+|||+||+.|||+|+|+|.+|+||+|+|+||..
T Consensus 88 ~V~D~G~GI~~~~~~~iF~~F~~~~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~~~Gt~f~i~lP~~ 159 (161)
T d2c2aa2 88 IVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD 159 (161)
T ss_dssp EEEECSSCCCGGGTTGGGSTTCCCC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEECC
T ss_pred EEEEcCCCCCHHHHHHhhCCcEEcCCCCCCCCCcccHHHHHHHHHHHHCCCEEEEEecCCCeeEEEEEEEcc
Confidence 999999999999999999999999877777788999999999999999999999999999999999999974
|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} | Back information, alignment and structure |
|---|
| >d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|