Citrus Sinensis ID: 039716


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000--
MVCNMETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEHRFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDLEKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLSEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQEKPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccHHHHHHHHHHHHccccccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEcccccccccHHHccccccccccccccHHHHHHHHHHHHccccccEEEEEEEEcccEEEEEEEEEEEEcccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccEEEEcccccHHHHHHHHHccccccccccccHHHHHHHHHHHcc
ccccccccccccccEEEcccccccccccccccccccccccHHHHHEEEEcccccEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccHHccccccccccccccccccEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEcHHHccccHHHHHcccHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEEEEccccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccEEEccHHHHHHHHHHHHHccEEEccccEEEEEEEEEEcccccccccccccEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEcccccccHHHHcHccccccEccccccccccccHHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEEcccccccccccccccccccccEEEEcccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHccccHccccHHHccccccHccccccHHcccHHHHHHHHcccHHHHcccccHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccccccHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEcccHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccEEEEEHHHHHHcHHHHHHccccccccccccHHHHHHHHHHHcc
mvcnmetdliedmdieglpsmwpedigsdkqfnverpgggqdmleevtipedqtIVDFKRLLELtnytdkgssQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEehrfeeegyggdkrpisIMDELSDMwkdvcprkndvvfqskrvevdaeyDTVEYWKQRALDLEKMLEASGQREQALMEKLNESVtnlekqsspvEELSQILKRADNFLHFvlqnapvvmghqdkeLRYRFIYNhfpslheedilgktdveifsgagvkesQDFKREVLEKglpakreitFETELFGSKTFLIYvepvfsksgetigvnymgmdvtdQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMsheirspltgVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKleaakfrprEVVKHVLQTAAASLQKILMLEgdiaddvpieVIGDVLRIRQILTNLISNaikftpegkvgiklyvvpeppfakeglkQKSKAYQSATDAVkeekhqpksqtasdqngfhdkkhgegyqdhkhdddpgtpvshgnsmdedlEATVWIRCdvydtgigipenalPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMggrltvtskvhcgstftfilpyqvspieensddpddlsdmadqdsvtddvtagffqfqprtlgslfssngtsrskkllpnsigfasahkvngfsetsysfpsnnrqketapledacSVAEVAEtlsepessfshspepenetevsrgkqchvettswfqnpatestshsEANREMIQtsktnepqkicemqekpdrisqspssssaevpetkpkpkpkillveDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGieqampssgssnhfkriPIIAMTANALSESAEECFAngmdsfvskpVTFQKLKECLEQYFP
MVCNMETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLsrqrqeselkkleileehrfeeegyggdkrpISIMDELSDMWKDVCPrkndvvfqskrvevdaeydtVEYWKQRALDLEKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGagvkesqdfkREVLEkglpakreitfetelfgsktfLIYVEPVfsksgetigvnymgmdvtDQVRKREKMAKLREEIAvqkaketelnktihiteETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEaakfrprevVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVkeekhqpksqtasdqngfhDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLSepessfshspepenetevsrgKQCHvettswfqnpatestshseaNREMIqtsktnepqkICEMqekpdrisqspssssaevpetkpkpkpkillveDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
MVCNMETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQeselkkleileehrfeeeGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDLEKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENsddpddlsdmadqdsVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLsepessfshspepeneTEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQEKPDRIsqspssssAEVPETkpkpkpkILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
**********************************************VTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLL**************************************ISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL************************************QILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTD***************************************************PLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVP************************************************************************LEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQV*************************VTAGFFQFQP***************************************************************************************************************************************************************ILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAA*****************FKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECL*****
*********I**MDIEGLPSMWP**************GGGQDML********QTIVDFKRLLELT**********AYLVKHWEYRQSNAVRLLREE****************EILEEHRFEEEGYGGDKRPISIMDELSDMWKDVCPRKND*VF***RVEVDAEYDTVEYWKQRALDLEKMLEASGQREQALMEKLNESVTNLEKQSSP********KRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQ*****************ADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLSE*E********************CHVETTSWFQNPATESTSHSEANREMIQT*KTN*******************************KPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
MVCNMETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEHRFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDLEKMLEASGQREQALMEKLNES*************LSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKE*******************************NGFHDKKH*********************SMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEV*****************************HVETTSWFQN*********************NEPQKICEMQ***********************PKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
*****ETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEHRFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDLEKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEP**********************EEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDD***************LEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVS*******DPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLSEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNE**************************ETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEA*************HFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCNMETDLIEDMDIEGLPSMWPEDIGSDKQFNVERPGGGQDMLEEVTIPEDQTIVDFKRLLELTNYTDKGSSQMAYLVKHWEYRQSNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxHRFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDLEKMLEASxxxxxxxxxxxxxxxxxxxxxSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKxxxxxxxxxxxxxxxxxxxxxIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPLEDACSVAEVAETLSEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQEKPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1002 2.2.26 [Sep-21-2011]
Q3S4A7922 Histidine kinase 5 OS=Ara yes no 0.909 0.988 0.606 0.0
Q9C5U01080 Histidine kinase 4 OS=Ara no no 0.276 0.256 0.351 9e-39
Q9C5U11036 Histidine kinase 3 OS=Ara no no 0.278 0.269 0.353 2e-37
Q9C5U21176 Histidine kinase 2 OS=Ara no no 0.267 0.227 0.360 7e-34
Q54YZ9 2062 Hybrid signal transductio yes no 0.344 0.167 0.291 3e-33
Q41342754 Ethylene receptor 1 OS=So N/A no 0.274 0.364 0.296 2e-31
Q9M7M1738 Ethylene receptor OS=Prun N/A no 0.263 0.357 0.289 9e-31
Q86CZ21213 Hybrid signal transductio no no 0.253 0.209 0.338 2e-29
Q9XH58740 Ethylene receptor 1 OS=Pe N/A no 0.285 0.386 0.282 6e-29
Q9XH57741 Ethylene receptor 2 OS=Pe N/A no 0.288 0.390 0.274 7e-29
>sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=2 SV=1 Back     alignment and function desciption
 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1011 (60%), Positives = 734/1011 (72%), Gaps = 100/1011 (9%)

Query: 1    MVCNMETDLIEDMDIEGLPSMWPEDIGS--DKQFNVERPGGGQDMLEEVTIPEDQTIVDF 58
            MVC METD IE+MD+E L SMWPED+G+  DKQFNVE+P G  D L+EVTI E +TI D 
Sbjct: 1    MVCEMETDQIEEMDVEVLSSMWPEDVGTEADKQFNVEKPAGDLDTLKEVTI-ETRTIADM 59

Query: 59   KRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEH 118
             RL  L N T +GSSQ+  LVK WEY Q NAVRLL+EEL NL RQR+E+E K+L+I+EE+
Sbjct: 60   TRLPNLLNSTHQGSSQLTNLVKQWEYMQDNAVRLLKEELKNLDRQREEAEAKELKIIEEY 119

Query: 119  RFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL 178
            +FE      +   + ++DE SD+++    +K D +  SK++E+  E+DTV YWKQ+AL L
Sbjct: 120  KFE----SNEPENVPVLDETSDLFRRFRQKKRDALVDSKKIEIYEEFDTVAYWKQKALSL 175

Query: 179  EKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQ 238
            EKMLEAS +RE+ LMEKL+ES+  +E QS+PV+EL+Q LKRA+ FLHF+LQNAP+VMGHQ
Sbjct: 176  EKMLEASTERERRLMEKLSESLKTMESQSAPVQELTQNLKRAEGFLHFILQNAPIVMGHQ 235

Query: 239  DKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFET 298
            DK+LRY FIYN +PSL E+DILGKTDVEIF G GVKES+DFKREVLEKG  +KREITF T
Sbjct: 236  DKDLRYLFIYNKYPSLREQDILGKTDVEIFHGGGVKESEDFKREVLEKGKASKREITFTT 295

Query: 299  ELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELN 358
            +LFGSKTFLIYVEPV++K+GE IG+NYMGM+VTDQV KREKMAKLRE+ AV+KA E+ELN
Sbjct: 296  DLFGSKTFLIYVEPVYNKAGEKIGINYMGMEVTDQVVKREKMAKLREDNAVRKAMESELN 355

Query: 359  KTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLV 418
            KTIHITEETMRAKQMLATMSHEIRSPL+GVV MAEILS TKLD+EQRQLL VMISSGDLV
Sbjct: 356  KTIHITEETMRAKQMLATMSHEIRSPLSGVVGMAEILSTTKLDKEQRQLLNVMISSGDLV 415

Query: 419  LQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEV 478
            LQLINDILDLSKVESGVM+LEA KFRPREVVKHVLQTAAASL+K L LEG+IADDVPIEV
Sbjct: 416  LQLINDILDLSKVESGVMRLEATKFRPREVVKHVLQTAAASLKKSLTLEGNIADDVPIEV 475

Query: 479  IGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKEGLKQKSKAYQSATDAVKE 538
            +GDVLRIRQILTNLISNAIKFT EG VGIKL V+ EP F ++          +A +A  E
Sbjct: 476  VGDVLRIRQILTNLISNAIKFTHEGNVGIKLQVISEPSFVRD----------NALNADTE 525

Query: 539  EKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYD 598
            E          +QNG                                 E +VWI CDV+D
Sbjct: 526  EH---------EQNGL-------------------------------TETSVWICCDVWD 545

Query: 599  TGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGST 658
            TGIGIPENALP LF+KYMQ SADHARKYGGTGLGLAICKQLVELMGG+LTVTS+V  GST
Sbjct: 546  TGIGIPENALPCLFKKYMQASADHARKYGGTGLGLAICKQLVELMGGQLTVTSRVSEGST 605

Query: 659  FTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSK 718
            FTFILPY+V   ++ SDD D+ SDMADQ S  DD   G+FQF+P  LGS++S+ G   S 
Sbjct: 606  FTFILPYKVGRSDDYSDDQDEFSDMADQQSEPDDTAEGYFQFKP-LLGSIYSNGGPGISN 664

Query: 719  KLLPNSIGFASAHK-VNGFSETSYSFPSNNR-QKETAPLEDACSVAEVAETLSEPESSFS 776
              LP+ +   S  K +NGF     + PSNN  Q E   LE+   + E     S+ E+S  
Sbjct: 665  DFLPHKVMLTSPIKLINGF----VADPSNNTGQSEMLQLENGGYMDE-----SKLETSSG 715

Query: 777  HSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQEK 836
            H PE  ++ E   G+    E+ S   + A+      E   E+  +S   E +        
Sbjct: 716  HCPESAHQYENGNGRCFSKESESCSSSQASSEGGTLEMESELTVSSHREEEK-------- 767

Query: 837  PDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAV 896
                      +  EV ET    KPKILLVEDNKIN+MVAKSMMKQLGH++D+ NNGVEA+
Sbjct: 768  ----------AETEVKET---SKPKILLVEDNKINIMVAKSMMKQLGHTMDIANNGVEAI 814

Query: 897  HAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNH-- 954
             A+   +YDL+LMDVCMPV+DGLKATRLIRS+E+TGNW+AA EAG++     S S N   
Sbjct: 815  TAINSSSYDLVLMDVCMPVLDGLKATRLIRSYEETGNWNAAIEAGVD----ISTSENEQV 870

Query: 955  ----FKRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLEQYF 1001
                  R+PIIAMTAN L+ES+EEC+ANGMDSF+SKPVT QKL+ECL+QY 
Sbjct: 871  CMRPTNRLPIIAMTANTLAESSEECYANGMDSFISKPVTLQKLRECLQQYL 921




Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. Negative regulator of the ETR1-dependent abscisic acid (ABA) and ethylene signaling pathway that inhibits the root elongation. Promotes stomatal closure. Regulates stomatal opening by integrating multiple signals via hydrogen peroxide H(2)O(2) homeostasis in guard cells in an ABA-independent manner. May contribute to basal defense mechanisms by closing stomata in the presence of bacterial pathogens.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 3EC: .EC: 3
>sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 Back     alignment and function description
>sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 Back     alignment and function description
>sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 Back     alignment and function description
>sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 Back     alignment and function description
>sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1002
3594764521012 PREDICTED: histidine kinase 5-like [Viti 0.987 0.977 0.726 0.0
224143389945 histidine kinase cytokinin receptor [Pop 0.920 0.975 0.704 0.0
147778679979 hypothetical protein VITISV_033090 [Viti 0.953 0.975 0.697 0.0
356552435937 PREDICTED: histidine kinase 5-like [Glyc 0.922 0.986 0.693 0.0
255548630930 sensor histidine kinase, putative [Ricin 0.898 0.967 0.713 0.0
224092694923 histidine kinase cytokinin receptor [Pop 0.907 0.984 0.693 0.0
356509864933 PREDICTED: histidine kinase 5-like [Glyc 0.919 0.987 0.683 0.0
3574370451077 Histidine kinase cytokinin receptor [Med 0.983 0.914 0.646 0.0
449447373941 PREDICTED: histidine kinase 5-like [Cucu 0.917 0.976 0.649 0.0
449486822941 PREDICTED: LOW QUALITY PROTEIN: histidin 0.917 0.976 0.648 0.0
>gi|359476452|ref|XP_002271743.2| PREDICTED: histidine kinase 5-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1448 bits (3749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1023 (72%), Positives = 846/1023 (82%), Gaps = 34/1023 (3%)

Query: 1    MVCNMETDLIEDMDIEGLPSMWPEDIGSD--KQFNVERPGGGQDMLEEVTIPEDQTIVDF 58
            MVC ME D IE+MD+E L SMWPEDIG+D   QFN++RPG  QDMLEEV I E+ +IVDF
Sbjct: 1    MVCEMENDNIEEMDVEVLHSMWPEDIGNDAGNQFNMDRPGADQDMLEEVNIVEEPSIVDF 60

Query: 59   KRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQESELKKLEILEEH 118
            KRLLELTNY++KGSSQ+AYLVK+WEY+Q+NAVRLL+EELDNLSRQRQE ELKKLEILEEH
Sbjct: 61   KRLLELTNYSEKGSSQLAYLVKNWEYKQANAVRLLKEELDNLSRQRQEVELKKLEILEEH 120

Query: 119  RFEEEGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL 178
            RF EE YGGDKRPISI+D + D+W++V  R+N VV Q+KR+E+DAEYDTV YWKQRA+ L
Sbjct: 121  RFVEERYGGDKRPISILDGIYDIWQEVPRRRNSVVVQNKRLEIDAEYDTVIYWKQRAVHL 180

Query: 179  EKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQ 238
            EK+LEAS QRE  LMEK+ ES+ +LE+QSSPVEELSQILKRADNFLHFVLQNAPVV+GHQ
Sbjct: 181  EKLLEASVQREHMLMEKVQESIKSLERQSSPVEELSQILKRADNFLHFVLQNAPVVIGHQ 240

Query: 239  DKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFET 298
            DKELRYRFIYNHFPSL EEDI+GKTDVEIF+GAGVKESQ+FK+EVLE+GLPAKREITFET
Sbjct: 241  DKELRYRFIYNHFPSLQEEDIIGKTDVEIFTGAGVKESQEFKKEVLERGLPAKREITFET 300

Query: 299  ELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELN 358
            ELFGSKTFLIYVEPVFSK+G+TIGVNYMGMDVTDQVRKREKM K+REEIAVQKAKETELN
Sbjct: 301  ELFGSKTFLIYVEPVFSKAGDTIGVNYMGMDVTDQVRKREKMMKIREEIAVQKAKETELN 360

Query: 359  KTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLV 418
            KTIHITEETMRAKQMLATMSHEIRSPL+GVVS+AEIL+ T LDR QRQLL VM+SSGDLV
Sbjct: 361  KTIHITEETMRAKQMLATMSHEIRSPLSGVVSIAEILATTNLDRHQRQLLNVMLSSGDLV 420

Query: 419  LQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEV 478
            LQLINDILDLSKVESGVMKLEA KFRPREVVKHVLQTAAASLQKIL LEG +ADDVP+EV
Sbjct: 421  LQLINDILDLSKVESGVMKLEATKFRPREVVKHVLQTAAASLQKILTLEGHVADDVPLEV 480

Query: 479  IGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAK-EGLKQKSKAYQSATDA-- 535
             GDVLRIRQILTNLISNA+KFT EGKVGI LYV+PEP     EG  Q     QS   A  
Sbjct: 481  TGDVLRIRQILTNLISNAVKFTHEGKVGINLYVIPEPSSGNGEGGPQMFIDDQSTVSANI 540

Query: 536  VKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDED------LEAT 589
             KEEK    SQ++    G H        Q+H  +D+P  P++H +S  ED      LE T
Sbjct: 541  PKEEKCLSPSQSSCTSKGSH-------TQNHALNDEPIDPINHDDSKQEDKENSHPLETT 593

Query: 590  VWIRCDVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTV 649
            VWIRCDVYDTGIGIPE+ALPTLF+KYMQVSADHARKYGGTGLGLAICKQLVELMGG +TV
Sbjct: 594  VWIRCDVYDTGIGIPEHALPTLFKKYMQVSADHARKYGGTGLGLAICKQLVELMGGHMTV 653

Query: 650  TSKVHCGSTFTFILPYQVSPIEENSDDPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLF 709
            +S+ H GSTFTFILPY+VS I ++SDDPD+LSDMAD D+ TDD  AGFFQF PRTLGSLF
Sbjct: 654  SSREHSGSTFTFILPYKVSLISDHSDDPDELSDMADDDASTDDKNAGFFQFHPRTLGSLF 713

Query: 710  SSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNN-RQKETAPLEDACSVAEVAETL 768
            SS G+ R++KL PN+IG+ S HK+NG S+ SYSFP N    KE   LED CSV + AETL
Sbjct: 714  SSGGSGRTQKLPPNNIGYDSLHKLNGLSDDSYSFPFNKVTSKEMTSLEDTCSVVDAAETL 773

Query: 769  SEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQ 828
            SEPES   H+ EP+N+  VSRGK+C  E      N +T ST HS+ ++E+ +  KT+E  
Sbjct: 774  SEPESLLRHNAEPDNDNAVSRGKKCQDEANGQVHNHSTGSTHHSKVSKEVDEMGKTSEAP 833

Query: 829  KICEMQEKPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDV 888
            ++C   E  +R SQ  SSSS E  E K   KPKILLVED+KINVMV +SMMKQLGH+IDV
Sbjct: 834  EMCLRLEISERSSQCTSSSSPE--EPKSTLKPKILLVEDSKINVMVTQSMMKQLGHTIDV 891

Query: 889  VNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPS 948
            VNNG+EAV AVQC++YDLILMDVCMPVMDGL+ATR+IRSFE+TGNWDAA +AGIE   PS
Sbjct: 892  VNNGIEAVRAVQCRSYDLILMDVCMPVMDGLQATRIIRSFEETGNWDAAVKAGIE---PS 948

Query: 949  SGSSNHF----------KRIPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLKECLE 998
            + SS+            KR+PIIAMTANALSESA+EC+ANGMDSFVSKPVTFQKL +CL+
Sbjct: 949  TCSSDSLPNGHDSMTVTKRVPIIAMTANALSESADECYANGMDSFVSKPVTFQKLTQCLQ 1008

Query: 999  QYF 1001
            QY 
Sbjct: 1009 QYL 1011




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224143389|ref|XP_002324940.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222866374|gb|EEF03505.1| histidine kinase cytokinin receptor [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147778679|emb|CAN76109.1| hypothetical protein VITISV_033090 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552435|ref|XP_003544573.1| PREDICTED: histidine kinase 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255548630|ref|XP_002515371.1| sensor histidine kinase, putative [Ricinus communis] gi|223545315|gb|EEF46820.1| sensor histidine kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224092694|ref|XP_002309700.1| histidine kinase cytokinin receptor [Populus trichocarpa] gi|222855676|gb|EEE93223.1| histidine kinase cytokinin receptor [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356509864|ref|XP_003523664.1| PREDICTED: histidine kinase 5-like [Glycine max] Back     alignment and taxonomy information
>gi|357437045|ref|XP_003588798.1| Histidine kinase cytokinin receptor [Medicago truncatula] gi|355477846|gb|AES59049.1| Histidine kinase cytokinin receptor [Medicago truncatula] Back     alignment and taxonomy information
>gi|449447373|ref|XP_004141443.1| PREDICTED: histidine kinase 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449486822|ref|XP_004157413.1| PREDICTED: LOW QUALITY PROTEIN: histidine kinase 5-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1002
TAIR|locus:2159669922 HK5 "histidine kinase 5" [Arab 0.513 0.558 0.701 2.1e-286
TIGR_CMR|SPO_0094743 SPO_0094 "sensory box sensor h 0.201 0.271 0.401 2.4e-54
DICTYBASE|DDB_G02778832062 dhkJ "histidine kinase J" [Dic 0.162 0.079 0.425 3.7e-53
TIGR_CMR|GSU_1285772 GSU_1285 "sensory box sensor h 0.291 0.378 0.288 2.8e-52
TIGR_CMR|GSU_23141025 GSU_2314 "sensory box histidin 0.176 0.172 0.346 3e-51
CGD|CAL00026911081 NIK1 [Candida albicans (taxid: 0.137 0.127 0.402 3.1e-50
UNIPROTKB|Q5A5991081 NIK1 "Putative uncharacterized 0.137 0.127 0.402 3.1e-50
TIGR_CMR|GSU_1928810 GSU_1928 "sensor histidine kin 0.173 0.214 0.366 3.7e-50
TIGR_CMR|GSU_0718589 GSU_0718 "sensory box histidin 0.168 0.286 0.392 2.5e-49
TAIR|locus:20159641036 HK3 "histidine kinase 3" [Arab 0.142 0.138 0.430 9.9e-49
TAIR|locus:2159669 HK5 "histidine kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1819 (645.4 bits), Expect = 2.1e-286, Sum P(3) = 2.1e-286
 Identities = 366/522 (70%), Positives = 425/522 (81%)

Query:     1 MVCNMETDLIEDMDIEGLPSMWPEDIGS--DKQFNVERPGGGQDMLEEVTIPEDQTIVDF 58
             MVC METD IE+MD+E L SMWPED+G+  DKQFNVE+P G  D L+EVTI E +TI D 
Sbjct:     1 MVCEMETDQIEEMDVEVLSSMWPEDVGTEADKQFNVEKPAGDLDTLKEVTI-ETRTIADM 59

Query:    59 KRLLELTNYTDKGSSQMAYLVKHWEYRQSNAVRLLREELDNLSRQRQXXXXXXXXXXXXX 118
              RL  L N T +GSSQ+  LVK WEY Q NAVRLL+EEL NL RQR+             
Sbjct:    60 TRLPNLLNSTHQGSSQLTNLVKQWEYMQDNAVRLLKEELKNLDRQREEAEAKELKIIEEY 119

Query:   119 XXXXXGYGGDKRPISIMDELSDMWKDVCPRKNDVVFQSKRVEVDAEYDTVEYWKQRALDL 178
                      +   + ++DE SD+++    +K D +  SK++E+  E+DTV YWKQ+AL L
Sbjct:   120 KFES----NEPENVPVLDETSDLFRRFRQKKRDALVDSKKIEIYEEFDTVAYWKQKALSL 175

Query:   179 EKMLEASGQREQALMEKLNESVTNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQ 238
             EKMLEAS +RE+ LMEKL+ES+  +E QS+PV+EL+Q LKRA+ FLHF+LQNAP+VMGHQ
Sbjct:   176 EKMLEASTERERRLMEKLSESLKTMESQSAPVQELTQNLKRAEGFLHFILQNAPIVMGHQ 235

Query:   239 DKELRYRFIYNHFPSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKREITFET 298
             DK+LRY FIYN +PSL E+DILGKTDVEIF G GVKES+DFKREVLEKG  +KREITF T
Sbjct:   236 DKDLRYLFIYNKYPSLREQDILGKTDVEIFHGGGVKESEDFKREVLEKGKASKREITFTT 295

Query:   299 ELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELN 358
             +LFGSKTFLIYVEPV++K+GE IG+NYMGM+VTDQV KREKMAKLRE+ AV+KA E+ELN
Sbjct:   296 DLFGSKTFLIYVEPVYNKAGEKIGINYMGMEVTDQVVKREKMAKLREDNAVRKAMESELN 355

Query:   359 KTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLV 418
             KTIHITEETMRAKQMLATMSHEIRSPL+GVV MAEILS TKLD+EQRQLL VMISSGDLV
Sbjct:   356 KTIHITEETMRAKQMLATMSHEIRSPLSGVVGMAEILSTTKLDKEQRQLLNVMISSGDLV 415

Query:   419 LQLINDILDLSKVESGVMKLEAAKFRPREVVKHVLQTAAASLQKILMLEGDIADDVPIEV 478
             LQLINDILDLSKVESGVM+LEA KFRPREVVKHVLQTAAASL+K L LEG+IADDVPIEV
Sbjct:   416 LQLINDILDLSKVESGVMRLEATKFRPREVVKHVLQTAAASLKKSLTLEGNIADDVPIEV 475

Query:   479 IGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPPFAKE 520
             +GDVLRIRQILTNLISNAIKFT EG VGIKL V+ EP F ++
Sbjct:   476 VGDVLRIRQILTNLISNAIKFTHEGNVGIKLQVISEPSFVRD 517


GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000156 "phosphorelay response regulator activity" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004673 "protein histidine kinase activity" evidence=IEA;ISS;IDA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0018106 "peptidyl-histidine phosphorylation" evidence=IEA
GO:0009736 "cytokinin mediated signaling pathway" evidence=TAS
GO:0005773 "vacuole" evidence=IDA
GO:0009788 "negative regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0010105 "negative regulation of ethylene mediated signaling pathway" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0070301 "cellular response to hydrogen peroxide" evidence=IMP
GO:0071219 "cellular response to molecule of bacterial origin" evidence=IMP
GO:0071732 "cellular response to nitric oxide" evidence=IMP
GO:0090333 "regulation of stomatal closure" evidence=IMP
GO:0010048 "vernalization response" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048440 "carpel development" evidence=RCA
TIGR_CMR|SPO_0094 SPO_0094 "sensory box sensor histidine kinase/response regulator" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277883 dhkJ "histidine kinase J" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1285 GSU_1285 "sensory box sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
CGD|CAL0002691 NIK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A599 NIK1 "Putative uncharacterized protein NIK1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1928 GSU_1928 "sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0718 GSU_0718 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2015964 HK3 "histidine kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3S4A7AHK5_ARATH2, ., 7, ., 1, 3, ., 30.60630.90910.9880yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.130.976
3rd Layer2.7.13.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1002
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 5e-32
COG0642336 COG0642, BaeS, Signal transduction histidine kinas 1e-29
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 5e-28
cd00156113 cd00156, REC, Signal receiver domain; originally t 8e-28
PRK11107919 PRK11107, PRK11107, hybrid sensory histidine kinas 3e-27
PRK15347921 PRK15347, PRK15347, two component system sensor ki 5e-27
PRK11466914 PRK11466, PRK11466, hybrid sensory histidine kinas 3e-25
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 1e-23
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 3e-23
PRK11091 779 PRK11091, PRK11091, aerobic respiration control se 4e-23
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 3e-22
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 5e-22
pfam00072111 pfam00072, Response_reg, Response regulator receiv 1e-21
PRK11107919 PRK11107, PRK11107, hybrid sensory histidine kinas 2e-21
PRK15347 921 PRK15347, PRK15347, two component system sensor ki 7e-20
PRK11091779 PRK11091, PRK11091, aerobic respiration control se 1e-19
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinas 5e-19
pfam0051266 pfam00512, HisKA, His Kinase A (phospho-acceptor) 1e-18
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 2e-18
COG0642336 COG0642, BaeS, Signal transduction histidine kinas 2e-18
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) 2e-18
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 1e-17
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinas 1e-17
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine 8e-17
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor k 2e-16
PRK11091779 PRK11091, PRK11091, aerobic respiration control se 4e-16
COG5002459 COG5002, VicK, Signal transduction histidine kinas 4e-15
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 2e-14
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor k 5e-14
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine 8e-14
smart0044855 smart00448, REC, cheY-homologous receiver domain 2e-13
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/p 2e-13
PRK11466914 PRK11466, PRK11466, hybrid sensory histidine kinas 6e-13
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinas 6e-13
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kina 6e-13
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 8e-13
COG0745 229 COG0745, OmpR, Response regulators consisting of a 9e-13
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; 2e-12
PRK15347921 PRK15347, PRK15347, two component system sensor ki 3e-11
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provision 1e-10
COG3437 360 COG3437, COG3437, Response regulator containing a 1e-10
COG3706 435 COG3706, PleD, Response regulator containing a Che 1e-10
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regula 2e-10
PRK10618894 PRK10618, PRK10618, phosphotransfer intermediate p 3e-10
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; 8e-10
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regul 1e-09
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinas 2e-09
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory pro 2e-09
COG3290537 COG3290, CitA, Signal transduction histidine kinas 2e-09
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; 4e-09
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisiona 4e-09
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regul 7e-09
COG2197211 COG2197, CitB, Response regulator containing a Che 1e-08
PRK13837828 PRK13837, PRK13837, two-component VirA-like sensor 1e-08
COG2204 464 COG2204, AtoC, Response regulator containing CheY- 2e-08
COG4191603 COG4191, COG4191, Signal transduction histidine ki 3e-08
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kina 5e-08
PRK11086542 PRK11086, PRK11086, sensory histidine kinase DcuS; 6e-08
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein 6e-08
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kina 9e-08
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provision 1e-07
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methyleste 1e-07
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provision 1e-07
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provision 2e-07
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; 4e-07
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kina 5e-07
COG2201 350 COG2201, CheB, Chemotaxis response regulator conta 6e-07
COG5002459 COG5002, VicK, Signal transduction histidine kinas 1e-06
PRK13837828 PRK13837, PRK13837, two-component VirA-like sensor 1e-06
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory pro 1e-06
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response re 2e-06
TIGR02875 262 TIGR02875, spore_0_A, sporulation transcription fa 2e-06
COG3947 361 COG3947, COG3947, Response regulator containing Ch 2e-06
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; 3e-06
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; 3e-06
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provision 3e-06
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisi 3e-06
COG3852363 COG3852, NtrB, Signal transduction histidine kinas 4e-06
COG4191603 COG4191, COG4191, Signal transduction histidine ki 5e-06
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methyleste 8e-06
PRK15479221 PRK15479, PRK15479, transcriptional regulatory pro 8e-06
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system 9e-06
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisiona 1e-05
COG3852363 COG3852, NtrB, Signal transduction histidine kinas 1e-05
PRK09836 227 PRK09836, PRK09836, DNA-binding transcriptional ac 1e-05
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II) 1e-05
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 2e-05
PRK10766221 PRK10766, PRK10766, DNA-binding transcriptional re 2e-05
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 2e-05
PRK10336 219 PRK10336, PRK10336, DNA-binding transcriptional re 2e-05
COG5000712 COG5000, NtrY, Signal transduction histidine kinas 3e-05
PRK10618894 PRK10618, PRK10618, phosphotransfer intermediate p 5e-05
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional 5e-05
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 1e-04
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 1e-04
COG4753 475 COG4753, COG4753, Response regulator containing Ch 2e-04
PRK10710240 PRK10710, PRK10710, DNA-binding transcriptional re 3e-04
PRK09470461 PRK09470, cpxA, two-component sensor protein; Prov 3e-04
PRK10549466 PRK10549, PRK10549, signal transduction histidine- 3e-04
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 4e-04
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicat 4e-04
PRK10816 223 PRK10816, PRK10816, DNA-binding transcriptional re 4e-04
COG4565 224 COG4565, CitB, Response regulator of citrate/malat 5e-04
PRK10643222 PRK10643, PRK10643, DNA-binding transcriptional re 8e-04
COG4192673 COG4192, COG4192, Signal transduction histidine ki 0.001
PRK11083228 PRK11083, PRK11083, DNA-binding response regulator 0.002
pfam08448110 pfam08448, PAS_4, PAS fold 0.003
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 0.004
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
 Score =  134 bits (339), Expect = 5e-32
 Identities = 68/206 (33%), Positives = 109/206 (52%), Gaps = 17/206 (8%)

Query: 332 DQVRKREKMAKLREEIAVQKAKET-ELNKTIH--------------ITEETMRAK-QMLA 375
           D+ +  +++ + +E +    A+ T EL +T                  EE  RAK   LA
Sbjct: 410 DERQVAQELQEHKESLEQLVAQRTQELAETNERLNAEVKNHAKARAEAEEANRAKSAFLA 469

Query: 376 TMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGV 435
           TMSHEIR+PL G++   E+L +T L  +Q+Q L V+  SG+ +L ++NDILD SK+E+G 
Sbjct: 470 TMSHEIRTPLNGILGTLELLGDTGLTSQQQQYLQVINRSGESLLDILNDILDYSKIEAGH 529

Query: 436 MKLEAAKFRPREVVKHVLQ-TAAASLQKILMLEGDIADDVPIEVIGDVLRIRQILTNLIS 494
           + +    F    ++  V     + +  K + L  +I + +P    GD  RIRQ+L NL+ 
Sbjct: 530 LSISPRPFDLNALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNWWQGDGPRIRQVLINLVG 589

Query: 495 NAIKFTPEGKVGIKLYVVPEPPFAKE 520
           NAIKFT  G V +++ +  +     E
Sbjct: 590 NAIKFTDRGSVVLRVSLNDDSSLLFE 615


This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems]. Length = 968

>gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|236839 PRK11086, PRK11086, sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>gnl|CDD|227333 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|226655 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|219845 pfam08448, PAS_4, PAS fold Back     alignment and domain information
>gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1002
PRK11091 779 aerobic respiration control sensor protein ArcB; P 100.0
PRK10841924 hybrid sensory kinase in two-component regulatory 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component r 100.0
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 100.0
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 100.0
PRK15347 921 two component system sensor kinase SsrA; Provision 100.0
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK13557540 histidine kinase; Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal 100.0
PRK10618894 phosphotransfer intermediate protein in two-compon 100.0
PRK13837828 two-component VirA-like sensor kinase; Provisional 100.0
KOG0519786 consensus Sensory transduction histidine kinase [S 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 100.0
PRK11006430 phoR phosphate regulon sensor protein; Provisional 100.0
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitroge 100.0
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 100.0
PRK09303380 adaptive-response sensory kinase; Validated 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
PRK13560807 hypothetical protein; Provisional 100.0
COG5000712 NtrY Signal transduction histidine kinase involved 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transd 99.97
PRK10604433 sensor protein RstB; Provisional 99.97
PRK11086542 sensory histidine kinase DcuS; Provisional 99.96
PRK10815485 sensor protein PhoQ; Provisional 99.96
COG4191603 Signal transduction histidine kinase regulating C4 99.96
PRK10364457 sensor protein ZraS; Provisional 99.96
PRK13559361 hypothetical protein; Provisional 99.96
PRK10549466 signal transduction histidine-protein kinase BaeS; 99.96
PRK10755356 sensor protein BasS/PmrB; Provisional 99.96
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 99.95
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 99.95
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 99.95
PRK09835482 sensor kinase CusS; Provisional 99.95
PRK09470461 cpxA two-component sensor protein; Provisional 99.95
PRK10337449 sensor protein QseC; Provisional 99.95
PRK09467435 envZ osmolarity sensor protein; Provisional 99.94
PRK11100475 sensory histidine kinase CreC; Provisional 99.94
COG0642336 BaeS Signal transduction histidine kinase [Signal 99.94
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 99.94
COG3290537 CitA Signal transduction histidine kinase regulati 99.89
PRK11644495 sensory histidine kinase UhpB; Provisional 99.88
COG4192673 Signal transduction histidine kinase regulating ph 99.87
COG0745 229 OmpR Response regulators consisting of a CheY-like 99.83
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 99.81
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 99.8
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.75
COG3437 360 Response regulator containing a CheY-like receiver 99.72
COG2204 464 AtoC Response regulator containing CheY-like recei 99.71
PF00072112 Response_reg: Response regulator receiver domain; 99.71
COG4753 475 Response regulator containing CheY-like receiver d 99.71
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.7
COG4565 224 CitB Response regulator of citrate/malate metaboli 99.68
COG4566202 TtrR Response regulator [Signal transduction mecha 99.64
COG2197211 CitB Response regulator containing a CheY-like rec 99.62
PLN03029222 type-a response regulator protein; Provisional 99.62
COG3706 435 PleD Response regulator containing a CheY-like rec 99.6
PRK10547670 chemotaxis protein CheA; Provisional 99.59
PRK10046 225 dpiA two-component response regulator DpiA; Provis 99.58
COG3947 361 Response regulator containing CheY-like receiver a 99.56
PRK11173 237 two-component response regulator; Provisional 99.54
PRK10529 225 DNA-binding transcriptional activator KdpE; Provis 99.54
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provis 99.53
PRK09836 227 DNA-binding transcriptional activator CusR; Provis 99.52
PRK04184535 DNA topoisomerase VI subunit B; Validated 99.51
PRK09468 239 ompR osmolarity response regulator; Provisional 99.51
PRK10643 222 DNA-binding transcriptional regulator BasR; Provis 99.5
PRK10766 221 DNA-binding transcriptional regulator TorR; Provis 99.5
PRK10430 239 DNA-binding transcriptional activator DcuR; Provis 99.49
PRK10336 219 DNA-binding transcriptional regulator QseB; Provis 99.49
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory 99.48
PRK10701 240 DNA-binding transcriptional regulator RstA; Provis 99.48
PRK10161 229 transcriptional regulator PhoB; Provisional 99.48
TIGR02875 262 spore_0_A sporulation transcription factor Spo0A. 99.47
PRK13856 241 two-component response regulator VirG; Provisional 99.47
TIGR03787 227 marine_sort_RR proteobacterial dedicated sortase s 99.46
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provis 99.46
PRK11517 223 transcriptional regulatory protein YedW; Provision 99.46
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 99.44
PRK11083 228 DNA-binding response regulator CreB; Provisional 99.44
PRK10840216 transcriptional regulator RcsB; Provisional 99.43
COG4567182 Response regulator consisting of a CheY-like recei 99.43
TIGR01387 218 cztR_silR_copR heavy metal response regulator. Mem 99.43
PRK14084 246 two-component response regulator; Provisional 99.42
CHL00148 240 orf27 Ycf27; Reviewed 99.42
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.42
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.41
PRK15115 444 response regulator GlrR; Provisional 99.4
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.39
PRK09581 457 pleD response regulator PleD; Reviewed 99.39
PRK09483217 response regulator; Provisional 99.38
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.38
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.38
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.38
PRK11697 238 putative two-component response-regulatory protein 99.37
PRK09935210 transcriptional regulator FimZ; Provisional 99.37
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.36
PRK12555 337 chemotaxis-specific methylesterase; Provisional 99.36
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provis 99.35
PRK15479 221 transcriptional regulatory protein TctD; Provision 99.32
COG2201 350 CheB Chemotaxis response regulator containing a Ch 99.31
PRK09390202 fixJ response regulator FixJ; Provisional 99.3
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.3
TIGR01052488 top6b DNA topoisomerase VI, B subunit. This model 99.29
PF0051268 HisKA: His Kinase A (phospho-acceptor) domain; Int 99.28
PRK00742 354 chemotaxis-specific methylesterase; Provisional 99.27
PRK09581 457 pleD response regulator PleD; Reviewed 99.26
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 99.26
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.25
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 99.24
COG3707194 AmiR Response regulator with putative antiterminat 99.24
PRK13558 665 bacterio-opsin activator; Provisional 99.24
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.23
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.23
PRK13435145 response regulator; Provisional 99.22
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 99.21
PRK15369211 two component system sensor kinase SsrB; Provision 99.19
PRK10403215 transcriptional regulator NarP; Provisional 99.19
PRK10651216 transcriptional regulator NarL; Provisional 99.18
PRK15411207 rcsA colanic acid capsular biosynthesis activation 99.16
PRK03660146 anti-sigma F factor; Provisional 99.13
PRK09191261 two-component response regulator; Provisional 99.12
COG0643716 CheA Chemotaxis protein histidine kinase and relat 99.09
PRK10693 303 response regulator of RpoS; Provisional 99.07
cd00156113 REC Signal receiver domain; originally thought to 99.04
COG3920221 Signal transduction histidine kinase [Signal trans 98.9
COG3850574 NarQ Signal transduction histidine kinase, nitrate 98.9
COG3851497 UhpB Signal transduction histidine kinase, glucose 98.88
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 98.87
COG3275557 LytS Putative regulator of cell autolysis [Signal 98.83
COG4585365 Signal transduction histidine kinase [Signal trans 98.82
PRK04069161 serine-protein kinase RsbW; Provisional 98.81
PRK15029 755 arginine decarboxylase; Provisional 98.76
COG3279 244 LytT Response regulator of the LytR/AlgR family [T 98.74
COG2972456 Predicted signal transduction protein with a C-ter 98.66
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 98.57
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 98.57
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimer 98.53
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 98.51
COG4564459 Signal transduction histidine kinase [Signal trans 98.5
PRK13560807 hypothetical protein; Provisional 98.32
PF14501100 HATPase_c_5: GHKL domain 98.29
KOG0787414 consensus Dehydrogenase kinase [Signal transductio 98.25
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 98.19
COG3706 435 PleD Response regulator containing a CheY-like rec 98.12
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 98.09
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacce 98.05
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 98.03
PRK097761092 putative diguanylate cyclase; Provisional 97.85
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, 97.77
PRK13558665 bacterio-opsin activator; Provisional 97.77
PRK097761092 putative diguanylate cyclase; Provisional 97.73
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 97.67
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 97.62
PRK10060663 RNase II stability modulator; Provisional 97.52
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 97.42
PRK11359799 cyclic-di-GMP phosphodiesterase; Provisional 97.37
smart0044855 REC cheY-homologous receiver domain. CheY regulate 97.16
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 97.08
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 96.94
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 96.91
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 96.78
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 96.64
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 96.64
PF12860115 PAS_7: PAS fold 96.05
KOG0519786 consensus Sensory transduction histidine kinase [S 96.04
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 95.84
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 95.59
PRK02261137 methylaspartate mutase subunit S; Provisional 95.58
COG3829560 RocR Transcriptional regulator containing PAS, AAA 95.34
PRK11359799 cyclic-di-GMP phosphodiesterase; Provisional 95.28
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 95.26
PRK14083 601 HSP90 family protein; Provisional 94.69
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 93.96
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 93.91
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 93.66
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 93.57
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 93.13
PRK05218 613 heat shock protein 90; Provisional 92.84
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 92.23
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 92.22
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 90.91
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 89.71
PTZ00130 814 heat shock protein 90; Provisional 89.17
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 88.85
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 88.4
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 88.16
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 88.08
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 88.07
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 87.9
COG2461409 Uncharacterized conserved protein [Function unknow 86.98
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 86.1
PRK05644638 gyrB DNA gyrase subunit B; Validated 85.81
COG5381184 Uncharacterized protein conserved in bacteria [Fun 85.48
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 84.4
COG4999140 Uncharacterized domain of BarA-like signal transdu 83.19
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 83.04
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 82.92
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 81.98
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 80.99
PRK09426714 methylmalonyl-CoA mutase; Reviewed 80.76
TIGR03815 322 CpaE_hom_Actino helicase/secretion neighborhood Cp 80.51
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-65  Score=642.04  Aligned_cols=504  Identities=29%  Similarity=0.466  Sum_probs=422.1

Q ss_pred             HHHhhcCChHHHHHHHHHHHHHHHHHHHhccCcEEEEecccccEEEeeccC---CCCCcccccCCCchhccCccchhhhh
Q 039716          201 TNLEKQSSPVEELSQILKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHF---PSLHEEDILGKTDVEIFSGAGVKESQ  277 (1002)
Q Consensus       201 ~~l~~~~~~~~~~~~~l~~~~~~l~~il~~~p~~i~~~d~~~~~~~~~~~~---~~~~~e~iiGk~~~e~~~~~~~~~~~  277 (1002)
                      ..|.+...+.++..+.+++++.+++.+++++|.+++..|.++++.++|..+   .|+..++++|++..+++++.......
T Consensus       134 ~~L~~~i~~r~~~~~~l~~~~~~l~~il~~~~~~i~~~D~~g~i~~~N~a~~~l~G~~~~eliG~~~~~l~~~~~~~~~~  213 (779)
T PRK11091        134 EQLKNEIKEREETQIELEQQSSLLRSFLDASPDLVYYRNEDGEFSGCNRAMELLTGKSEKQLIGLTPKDVYSPEAAEKVI  213 (779)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcceEEEECCCCcEEeEcHHHHHHhCcCHHHHcCCChHHhCCHHHHHHHH
Confidence            445555555667778899999999999999999999999999999998764   67888999999999999876555555


Q ss_pred             HHHHHHHHhCCCcceeEEEEEeecCceEEEEEEeeeecCCCCEEEEEEEeechhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039716          278 DFKREVLEKGLPAKREITFETELFGSKTFLIYVEPVFSKSGETIGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETEL  357 (1002)
Q Consensus       278 ~~~~~vl~~g~~~~~e~~~~~~~~~~~~~~~~~~p~~~~~G~~~gi~~~~~DITe~~~~~~~~~~l~~el~~~~~~~~el  357 (1002)
                      .....++..+.+...+..+....+...++.++..|+++.+|.+.|+++++.|||++++.++++.+..             
T Consensus       214 ~~~~~~~~~~~~~~~e~~~~~~~G~~~~~~~~~~pi~~~~g~~~g~v~~~~DITe~k~~e~~l~~a~-------------  280 (779)
T PRK11091        214 ETDEKVFRHNVSLTYEQWLDYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALEKAS-------------  280 (779)
T ss_pred             HHHHHHHhcCCCeEEEEEEEcCCCCEEEEEEEeeeEEcCCCCEEEEEEEEeehhHHHHHHHHHHHHH-------------
Confidence            5566777777776666666666666678888999999999999999999999999876654432211             


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhccccHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCee
Q 039716          358 NKTIHITEETMRAKQMLATMSHEIRSPLTGVVSMAEILSNTKLDREQRQLLGVMISSGDLVLQLINDILDLSKVESGVMK  437 (1002)
Q Consensus       358 ~k~~~~~e~~~~~k~fla~iSHELRTPL~~I~g~~elL~~~~l~~~~~~~l~~i~~s~~~L~~LIndlLd~skiesg~~~  437 (1002)
                                ..+.+|+++|||||||||++|.|++++|.....++++++++..+..++.++..+|++++++++++++.+.
T Consensus       281 ----------~~~~~~~a~isHelrtPL~~I~g~~~ll~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~~~~  350 (779)
T PRK11091        281 ----------RDKTTFISTISHELRTPLNGIVGLSRILLDTELTAEQRKYLKTIHVSAITLGNIFNDIIDMDKMERRKLQ  350 (779)
T ss_pred             ----------HHHHHHHHHhhHhhcCcHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHhCCCcE
Confidence                      0124799999999999999999999999888888999999999999999999999999999999999999


Q ss_pred             eEeeecCHHHHHHHHHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCCCCeeEEEEEecCCCC
Q 039716          438 LEAAKFRPREVVKHVLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKVGIKLYVVPEPP  516 (1002)
Q Consensus       438 l~~~~~~l~~li~~v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~~G~I~I~v~~~~~~~  516 (1002)
                      +...++++.++++.+...+..... +++.+........|..+.+|+.+|+|||.||++||+||++.|.|.|.+....   
T Consensus       351 ~~~~~~~l~~~i~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~d~~~l~qvl~NLl~NAik~~~~g~v~i~~~~~~---  427 (779)
T PRK11091        351 LDNQPIDFTDFLADLENLSGLQAEQKGLRFDLEPLLPLPHKVITDGTRLRQILWNLISNAVKFTQQGGVTVRVRYEE---  427 (779)
T ss_pred             EEeeccCHHHHHHHHHHHHHHHHHhcCCEEEEEeCCCCCceEEeCHHHHHHHHHHHHHHHHHhCCCCcEEEEEEEcc---
Confidence            999999999999999887766543 6677777777777777999999999999999999999999998887764310   


Q ss_pred             cccchhhhhhhhhhcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEEEE
Q 039716          517 FAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDV  596 (1002)
Q Consensus       517 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V  596 (1002)
                                                                                              ...+.|+|
T Consensus       428 ------------------------------------------------------------------------~~~~~i~V  435 (779)
T PRK11091        428 ------------------------------------------------------------------------GDMLTFEV  435 (779)
T ss_pred             ------------------------------------------------------------------------CCEEEEEE
Confidence                                                                                    11378999


Q ss_pred             EecCCCCCcCcHhhhhhhccCC-CccccCcCCCccccHHHHHHHHHHhCCEEEEEeecCCceEEEEEEeCCCCCCCCCCC
Q 039716          597 YDTGIGIPENALPTLFRKYMQV-SADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQVSPIEENSD  675 (1002)
Q Consensus       597 ~DtGiGI~~e~l~~IF~pF~q~-~~~~~~~~~GtGLGLaI~k~Lve~~gG~I~v~S~~g~GTtF~~~LP~~~~~~~~~~~  675 (1002)
                      .|||+|||++.+++||+|||++ +...++.++||||||+|||+||+.|||+|+|+|.+|+||+|+|+||+......... 
T Consensus       436 ~D~G~Gi~~~~~~~iF~~f~~~~~~~~~~~~~GtGLGL~i~~~iv~~~gG~i~v~s~~g~Gt~f~i~lP~~~~~~~~~~-  514 (779)
T PRK11091        436 EDSGIGIPEDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSKRLAQAMGGDITVTSEEGKGSCFTLTIHAPAVAEEVED-  514 (779)
T ss_pred             EecCCCCCHHHHHHHHHHhhcccCCCCCCCCCCcchHHHHHHHHHHHcCCEEEEEecCCCeEEEEEEEecccccccccc-
Confidence            9999999999999999999998 44445557899999999999999999999999999999999999997432100000 


Q ss_pred             CCCccccccccCCcccccccccccccccccccccccCCcccccccccccccccccccccCccccccCCCCCcccccccch
Q 039716          676 DPDDLSDMADQDSVTDDVTAGFFQFQPRTLGSLFSSNGTSRSKKLLPNSIGFASAHKVNGFSETSYSFPSNNRQKETAPL  755 (1002)
Q Consensus       676 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  755 (1002)
                                                                                                      
T Consensus       515 --------------------------------------------------------------------------------  514 (779)
T PRK11091        515 --------------------------------------------------------------------------------  514 (779)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhccHHHHHhhhCCCCCCCCCCCCCCcchhhcccccccccccccccCCCCCccchhhhhHHHhhcccCCCchhhhhhcc
Q 039716          756 EDACSVAEVAETLSEPESSFSHSPEPENETEVSRGKQCHVETTSWFQNPATESTSHSEANREMIQTSKTNEPQKICEMQE  835 (1002)
Q Consensus       756 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  835 (1002)
                                            .+                                                        
T Consensus       515 ----------------------~~--------------------------------------------------------  516 (779)
T PRK11091        515 ----------------------AF--------------------------------------------------------  516 (779)
T ss_pred             ----------------------cc--------------------------------------------------------
Confidence                                  00                                                        


Q ss_pred             CCCcccCCCCCCCCCCCCCCCCCCCeEEEEecCHHHHHHHHHHHHhcCCeEEEEcCHHHHHHHHHcCCCcEEEEcCCCCC
Q 039716          836 KPDRISQSPSSSSAEVPETKPKPKPKILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPV  915 (1002)
Q Consensus       836 ~~~~~~~~~~~~~~~~~~~~~~~~~~ILiVeDn~~n~~~l~~~L~~~g~~v~~a~~G~eAl~~~~~~~~DlIlmDi~MP~  915 (1002)
                                 .    ....+..+.+||||||++.++..+..+|+..||.|..|.+|.+|++.+....||+||||+.||+
T Consensus       517 -----------~----~~~~~~~~~~ILivdD~~~~~~~l~~~L~~~g~~v~~a~~~~eal~~~~~~~~Dlvl~D~~mp~  581 (779)
T PRK11091        517 -----------D----EDDMPLPALNILLVEDIELNVIVARSVLEKLGNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPD  581 (779)
T ss_pred             -----------c----cccccccccceEEEcCCHHHHHHHHHHHHHcCCEEEEECCHHHHHHHhhcCCCCEEEEcCCCCC
Confidence                       0    0000023468999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHhccccCCCchhhhhhhhcccCCCCCCCCCCCC-ccEEEEcCCCCHHHHHHHHHcCCCEEEeCCCChHHHH
Q 039716          916 MDGLKATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKR-IPIIAMTANALSESAEECFANGMDSFVSKPVTFQKLK  994 (1002)
Q Consensus       916 mdG~e~~~~IR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-ipIIalTa~~~~~~~~~~~~aG~d~~l~KP~~~~~L~  994 (1002)
                      |||+++++.||....                        .+. +|||++|++... ...+|+.+||++||.||++..+|.
T Consensus       582 ~~G~e~~~~ir~~~~------------------------~~~~~~ii~~ta~~~~-~~~~~~~~G~~~~l~KP~~~~~L~  636 (779)
T PRK11091        582 MTGLDIARELRERYP------------------------REDLPPLVALTANVLK-DKKEYLDAGMDDVLSKPLSVPALT  636 (779)
T ss_pred             CCHHHHHHHHHhccc------------------------cCCCCcEEEEECCchH-hHHHHHHCCCCEEEECCCCHHHHH
Confidence            999999999996321                        134 499999998765 467899999999999999999999


Q ss_pred             HHHHhhc
Q 039716          995 ECLEQYF 1001 (1002)
Q Consensus       995 ~~l~~~l 1001 (1002)
                      .+|.+++
T Consensus       637 ~~l~~~~  643 (779)
T PRK11091        637 AMIKKFW  643 (779)
T ss_pred             HHHHHHh
Confidence            9998875



>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information
>KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1002
4euk_A153 Crystal Structure Length = 153 1e-55
2ayx_A254 Solution Structure Of The E.Coli Rcsc C-Terminus (R 2e-15
2ayz_A133 Solution Structure Of The E.Coli Rcsc C-Terminus (R 1e-14
3c97_A140 Crystal Structure Of The Response Regulator Receive 2e-13
2r25_B133 Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef 2e-12
1oxb_B134 Complex Between Ypd1 And Sln1 Response Regulator Do 2e-12
3sl2_A177 Atp Forms A Stable Complex With The Essential Histi 3e-11
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 2e-10
3dge_A258 Structure Of A Histidine Kinase-response Regulator 2e-10
3m6m_D143 Crystal Structure Of Rpff Complexed With Rec Domain 1e-08
3kht_A144 Crystal Structure Of Response Regulator From Hahell 9e-08
4ew8_A268 Crystal Structure Of A C-Terminal Part Of Tyrosine 9e-08
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 1e-07
3mm4_A206 Crystal Structure Of The Receiver Domain Of The His 2e-07
1ab5_A125 Structure Of Chey Mutant F14n, V21t Length = 125 3e-07
1ab6_A125 Structure Of Chey Mutant F14n, V86t Length = 125 5e-07
3fgz_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 1e-06
1ymv_A129 Signal Transduction Protein Chey Mutant With Phe 14 2e-06
1udr_A129 Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep 2e-06
3ffx_A128 Crystal Structure Of Chey Triple Mutant F14e, N59r, 2e-06
3fft_A128 Crystal Structure Of Chey Double Mutant F14e, E89r 2e-06
3rvj_A132 Structure Of The Chey-Bef3 Complex With Substitutio 2e-06
1ymu_A130 Signal Transduction Protein Chey Mutant With Met 17 2e-06
1d4z_A128 Crystal Structure Of Chey-95iv, A Hyperactive Chey 3e-06
3ffw_A128 Crystal Structure Of Chey Triple Mutant F14q, N59k, 3e-06
3f7n_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 3e-06
1djm_A129 Solution Structure Of Bef3-Activated Chey From Esch 4e-06
1eay_A128 Chey-Binding (P2) Domain Of Chea In Complex With Ch 4e-06
1cye_A129 Three Dimensional Structure Of Chemotactic Che Y Pr 4e-06
1cey_A128 Assignments, Secondary Structure, Global Fold, And 4e-06
3rvp_A132 Structure Of The Chey-Bef3 Complex With Substitutio 4e-06
3rvl_A132 Structure Of The Chey-Bef3 Complex With Substitutio 4e-06
1mih_A129 A Role For Chey Glu 89 In Chez-Mediated Dephosphory 5e-06
2chy_A128 Three-Dimensional Structure Of Chey, The Response R 5e-06
3gt7_A154 Crystal Structure Of Signal Receiver Domain Of Sign 6e-06
3myy_A128 Structure Of E. Coli Chey Mutant A113p Bound To Ber 6e-06
3oo0_A129 Structure Of Apo Chey A113p Length = 129 6e-06
3rvn_A132 Structure Of The Chey-Bef3 Complex With Substitutio 6e-06
2fka_A129 Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che 6e-06
2che_A128 Structure Of The Mg2+-Bound Form Of Chey And Mechan 6e-06
5chy_A128 Structure Of Chemotaxis Protein Chey Length = 128 6e-06
1e6k_A130 Two-Component Signal Transduction System D12a Mutan 7e-06
3olx_A129 Structural And Functional Effects Of Substitution A 9e-06
3olw_A129 Structural And Functional Effects Of Substitution A 1e-05
3olv_A129 Structural And Functional Effects Of Substitution A 1e-05
1jbe_A128 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co 1e-05
3oly_A129 Structural And Functional Effects Of Substitution A 2e-05
1vlz_A128 Uncoupled Phosphorylation And Activation In Bacteri 2e-05
1e6l_A127 Two-Component Signal Transduction System D13a Mutan 2e-05
1ehc_A128 Structure Of Signal Transduction Protein Chey Lengt 2e-05
3to5_A134 High Resolution Structure Of Chey3 From Vibrio Chol 2e-05
1dcf_A136 Crystal Structure Of The Receiver Domain Of The Eth 2e-05
3i42_A127 Structure Of Response Regulator Receiver Domain (Ch 2e-05
6chy_A128 Structure Of Chemotaxis Protein Chey Length = 128 2e-05
1zdm_A129 Crystal Structure Of Activated Chey Bound To Xe Len 3e-05
1c4w_A128 1.9 A Structure Of A-Thiophosphonate Modified Chey 3e-05
1hey_A128 Investigating The Structural Determinants Of The P2 3e-05
1e6m_A128 Two-Component Signal Transduction System D57a Mutan 3e-05
3h1g_A129 Crystal Structure Of Chey Mutant T84a Of Helicobact 1e-04
2id7_A128 1.75 A Structure Of T87i Phosphono-Chey Length = 12 1e-04
3dge_C122 Structure Of A Histidine Kinase-response Regulator 1e-04
2id9_A128 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length 2e-04
3gwg_A129 Crystal Structure Of Chey Of Helicobacter Pylori Le 3e-04
3d36_A244 How To Switch Off A Histidine Kinase: Crystal Struc 5e-04
1u8t_A128 Crystal Structure Of Chey D13k Y106w Alone And In C 6e-04
3a0r_A349 Crystal Structure Of Histidine Kinase Thka (Tm1359) 6e-04
>pdb|4EUK|A Chain A, Crystal Structure Length = 153 Back     alignment and structure

Iteration: 1

Score = 215 bits (547), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 100/146 (68%), Positives = 121/146 (82%), Gaps = 10/146 (6%) Query: 862 ILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLKA 921 ILLVEDNKIN+MVAKSMMKQLGH++D+ NNGVEA+ A+ +YDL+LMDVCMPV+DGLKA Sbjct: 11 ILLVEDNKINIMVAKSMMKQLGHTMDIANNGVEAITAINSSSYDLVLMDVCMPVLDGLKA 70 Query: 922 TRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNH------FKRIPIIAMTANALSESAEEC 975 TRLIRS+E+TGNW+AA EAG++ S S N R+PIIAMTAN L+ES+EEC Sbjct: 71 TRLIRSYEETGNWNAAIEAGVD----ISTSENEQVCMRPTNRLPIIAMTANTLAESSEEC 126 Query: 976 FANGMDSFVSKPVTFQKLKECLEQYF 1001 +ANGMDSF+SKPVT QKL+ECL+QY Sbjct: 127 YANGMDSFISKPVTLQKLRECLQQYL 152
>pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 Back     alignment and structure
>pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 Back     alignment and structure
>pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 Back     alignment and structure
>pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3- Length = 133 Back     alignment and structure
>pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain In Space Group P2(1)2(1)2(1) Length = 134 Back     alignment and structure
>pdb|3SL2|A Chain A, Atp Forms A Stable Complex With The Essential Histidine Kinase Walk (yycg) Domain Length = 177 Back     alignment and structure
>pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure
>pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 Back     alignment and structure
>pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 Back     alignment and structure
>pdb|3KHT|A Chain A, Crystal Structure Of Response Regulator From Hahella Chejuensis Length = 144 Back     alignment and structure
>pdb|4EW8|A Chain A, Crystal Structure Of A C-Terminal Part Of Tyrosine Kinase (Divl) From Caulobacter Crescentus Cb15 At 2.50 A Resolution Length = 268 Back     alignment and structure
>pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 Back     alignment and structure
>pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 Back     alignment and structure
>pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 Back     alignment and structure
>pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 Back     alignment and structure
>pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 Back     alignment and structure
>pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 Back     alignment and structure
>pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 Back     alignment and structure
>pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 Back     alignment and structure
>pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 Back     alignment and structure
>pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 Back     alignment and structure
>pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 Back     alignment and structure
>pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 Back     alignment and structure
>pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 Back     alignment and structure
>pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 Back     alignment and structure
>pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 Back     alignment and structure
>pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|3GT7|A Chain A, Crystal Structure Of Signal Receiver Domain Of Signal Transduction Histidine Kinase From Syntrophus Aciditrophicus Length = 154 Back     alignment and structure
>pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 Back     alignment and structure
>pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 Back     alignment and structure
>pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 Back     alignment and structure
>pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 Back     alignment and structure
>pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 Back     alignment and structure
>pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 Back     alignment and structure
>pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 Back     alignment and structure
>pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 Back     alignment and structure
>pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 Back     alignment and structure
>pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 Back     alignment and structure
>pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 Back     alignment and structure
>pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 Back     alignment and structure
>pdb|1DCF|A Chain A, Crystal Structure Of The Receiver Domain Of The Ethylene Receptor Of Arabidopsis Thaliana Length = 136 Back     alignment and structure
>pdb|3I42|A Chain A, Structure Of Response Regulator Receiver Domain (Chey-Like) From Methylobacillus Flagellatus Length = 127 Back     alignment and structure
>pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 Back     alignment and structure
>pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 Back     alignment and structure
>pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 Back     alignment and structure
>pdb|1HEY|A Chain A, Investigating The Structural Determinants Of The P21-Like Triphosphate And Mg2+ Binding Site Length = 128 Back     alignment and structure
>pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 Back     alignment and structure
>pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 Back     alignment and structure
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 Back     alignment and structure
>pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3D36|A Chain A, How To Switch Off A Histidine Kinase: Crystal Structure Of Geobacillus Stearothermophilus Kinb With The Inhibitor Sda Length = 244 Back     alignment and structure
>pdb|1U8T|A Chain A, Crystal Structure Of Chey D13k Y106w Alone And In Complex With A Flim Peptide Length = 128 Back     alignment and structure
>pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1002
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 7e-52
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 1e-51
2ayx_A254 Sensor kinase protein RCSC; two independent struct 3e-50
2ayx_A254 Sensor kinase protein RCSC; two independent struct 1e-13
3c97_A140 Signal transduction histidine kinase; structural g 4e-50
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 1e-47
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 2e-47
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 1e-27
1mb3_A124 Cell division response regulator DIVK; signal tran 8e-47
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 1e-45
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 2e-42
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 4e-40
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 3e-29
3i42_A127 Response regulator receiver domain protein (CHEY- 5e-40
3luf_A259 Two-component system response regulator/ggdef doma 1e-34
3luf_A 259 Two-component system response regulator/ggdef doma 2e-18
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 2e-28
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 4e-27
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 2e-13
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 5e-27
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 2e-26
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 3e-10
3grc_A140 Sensor protein, kinase; protein structure initiati 3e-24
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 1e-23
3bre_A 358 Probable two-component response regulator; protein 2e-22
1w25_A 459 Stalked-cell differentiation controlling protein; 8e-22
1w25_A 459 Stalked-cell differentiation controlling protein; 4e-12
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 3e-20
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 6e-20
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 6e-13
3cnb_A143 DNA-binding response regulator, MERR family; signa 1e-19
3heb_A152 Response regulator receiver domain protein (CHEY); 1e-19
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 2e-19
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 2e-10
3h5i_A140 Response regulator/sensory box protein/ggdef domai 7e-19
3gt7_A154 Sensor protein; structural genomics, signal receiv 1e-18
3eq2_A 394 Probable two-component response regulator; adaptor 2e-18
3cg0_A140 Response regulator receiver modulated diguanylate 2e-18
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 3e-18
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 3e-18
2zay_A147 Response regulator receiver protein; structural ge 6e-18
3hdg_A137 Uncharacterized protein; two-component sensor acti 1e-17
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 2e-17
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 4e-07
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 2e-17
3nhm_A133 Response regulator; protein structure initiative I 3e-17
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 1e-16
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 3e-06
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 3e-16
3n0r_A286 Response regulator; sigma factor, receiver, two-co 4e-16
1srr_A124 SPO0F, sporulation response regulatory protein; as 5e-16
3c3m_A138 Response regulator receiver protein; structural ge 7e-16
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 2e-15
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 3e-15
3r0j_A 250 Possible two component system response transcript 5e-15
3n53_A140 Response regulator receiver modulated diguanylate; 5e-15
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 6e-15
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 1e-14
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 1e-13
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 1e-14
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 9e-08
1s8n_A205 Putative antiterminator; RV1626, structural genomi 1e-14
3cfy_A137 Putative LUXO repressor protein; structural genomi 2e-14
3cg4_A142 Response regulator receiver domain protein (CHEY-; 2e-14
3snk_A135 Response regulator CHEY-like protein; P-loop conta 3e-14
3hdv_A136 Response regulator; PSI-II, structural genomics, P 3e-14
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 3e-14
3lua_A140 Response regulator receiver protein; two-component 3e-14
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 5e-14
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 8e-14
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 1e-13
1ys7_A233 Transcriptional regulatory protein PRRA; response 1e-13
2qxy_A142 Response regulator; regulation of transcription, N 1e-13
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 1e-13
3q9s_A249 DNA-binding response regulator; DNA binding protei 1e-13
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 2e-13
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 4e-04
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 2e-13
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 1e-08
3lte_A132 Response regulator; structural genomics, PSI, prot 2e-13
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 2e-13
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 2e-13
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 2e-13
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 4e-13
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 5e-13
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 7e-13
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 7e-13
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 2e-11
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 7e-13
1xhf_A123 DYE resistance, aerobic respiration control protei 1e-12
3eqz_A135 Response regulator; structural genomics, unknown f 2e-12
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 3e-12
3a10_A116 Response regulator; phosphoacceptor, signaling pro 3e-12
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 3e-12
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 3e-12
2rjn_A154 Response regulator receiver:metal-dependent phosph 6e-12
4dad_A146 Putative pilus assembly-related protein; response 6e-12
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 6e-12
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 9e-12
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 9e-12
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 9e-12
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 1e-11
1mvo_A136 PHOP response regulator; phosphate regulon, transc 1e-11
1zgz_A122 Torcad operon transcriptional regulatory protein; 2e-11
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 2e-11
3rqi_A184 Response regulator protein; structural genomics, s 2e-11
2oqr_A230 Sensory transduction protein REGX3; response regul 3e-11
2gwr_A238 DNA-binding response regulator MTRA; two-component 3e-11
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 4e-11
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 5e-11
3crn_A132 Response regulator receiver domain protein, CHEY-; 5e-11
2gkg_A127 Response regulator homolog; social motility, recei 6e-11
3jte_A143 Response regulator receiver protein; structural ge 7e-11
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 1e-10
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 1e-10
2pln_A137 HP1043, response regulator; signaling protein; 1.8 2e-10
1dz3_A130 Stage 0 sporulation protein A; response regulator, 3e-10
3eul_A152 Possible nitrate/nitrite response transcriptional 8e-10
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 1e-09
2hqr_A223 Putative transcriptional regulator; phosporylation 2e-09
3f6c_A134 Positive transcription regulator EVGA; structural 2e-09
2qr3_A140 Two-component system response regulator; structura 3e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
3cz5_A153 Two-component response regulator, LUXR family; str 6e-09
1yio_A208 Response regulatory protein; transcription regulat 7e-09
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 7e-09
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 9e-09
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 9e-09
2rdm_A132 Response regulator receiver protein; structural ge 2e-08
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 3e-08
3c3w_A225 Two component transcriptional regulatory protein; 3e-08
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 5e-08
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 5e-08
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 6e-08
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 7e-08
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 9e-08
2qv0_A143 Protein MRKE; structural genomics, transcription, 2e-07
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 3e-07
2qsj_A154 DNA-binding response regulator, LUXR family; struc 5e-07
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 2e-06
4fmt_A228 CHPT protein; A phosphotransfer protein, A two-com 2e-06
4fmt_A228 CHPT protein; A phosphotransfer protein, A two-com 5e-05
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 2e-06
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 9e-06
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 3e-05
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 7e-05
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 2e-04
3cax_A369 Uncharacterized protein PF0695; structural genomic 7e-04
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
 Score =  177 bits (451), Expect = 7e-52
 Identities = 29/142 (20%), Positives = 63/142 (44%), Gaps = 22/142 (15%)

Query: 861  KILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLK 920
            K+L++++N ++ MV K ++  LG  +  V++  E +  V    + ++ MDVCMP ++  +
Sbjct: 9    KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVS-HEHKVVFMDVCMPGVENYQ 67

Query: 921  ATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGM 980
                I                         +    +R  ++A++ N    + E+C + G+
Sbjct: 68   IALRIHEKF---------------------TKQRHQRPLLVALSGNTDKSTKEKCMSFGL 106

Query: 981  DSFVSKPVTFQKLKECLEQYFP 1002
            D  + KPV+   +++ L     
Sbjct: 107  DGVLLKPVSLDNIRDVLSDLLE 128


>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Length = 158 Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Length = 185 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Length = 114 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Length = 145 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 Back     alignment and structure
>4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Length = 152 Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Length = 125 Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1002
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 100.0
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 100.0
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 100.0
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 100.0
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 100.0
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 100.0
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 100.0
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.98
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 99.97
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 99.97
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.97
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.93
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 99.93
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 99.91
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.91
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 99.9
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 99.89
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 99.89
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 99.88
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 99.87
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 99.87
2lpm_A123 Two-component response regulator; transcription re 99.87
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 99.85
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.84
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.82
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.82
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.81
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.81
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.8
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.8
3rqi_A184 Response regulator protein; structural genomics, s 99.79
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 99.78
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.78
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.78
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.77
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.77
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.77
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.77
3zxo_A129 Redox sensor histidine kinase response regulator; 99.77
3luf_A259 Two-component system response regulator/ggdef doma 99.77
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.76
1mb3_A124 Cell division response regulator DIVK; signal tran 99.76
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.76
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.76
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.76
3r0j_A 250 Possible two component system response transcript 99.76
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.76
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.75
3i42_A127 Response regulator receiver domain protein (CHEY- 99.75
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.75
1xhf_A123 DYE resistance, aerobic respiration control protei 99.75
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.75
3lua_A140 Response regulator receiver protein; two-component 99.75
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.75
3heb_A152 Response regulator receiver domain protein (CHEY); 99.75
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.75
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.75
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.75
3grc_A140 Sensor protein, kinase; protein structure initiati 99.74
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.74
4dad_A146 Putative pilus assembly-related protein; response 99.74
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.74
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.74
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.74
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.74
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.74
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.74
3jte_A143 Response regulator receiver protein; structural ge 99.74
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 99.73
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.73
3nhm_A133 Response regulator; protein structure initiative I 99.73
3eul_A152 Possible nitrate/nitrite response transcriptional 99.73
3c3m_A138 Response regulator receiver protein; structural ge 99.73
3f6c_A134 Positive transcription regulator EVGA; structural 99.73
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.73
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 99.72
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.72
3lte_A132 Response regulator; structural genomics, PSI, prot 99.72
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.72
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.72
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.72
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.72
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.72
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.72
1yio_A208 Response regulatory protein; transcription regulat 99.72
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.71
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.71
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.71
2zay_A147 Response regulator receiver protein; structural ge 99.71
2qxy_A142 Response regulator; regulation of transcription, N 99.7
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.7
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.7
3eq2_A 394 Probable two-component response regulator; adaptor 99.7
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.69
3n53_A140 Response regulator receiver modulated diguanylate; 99.69
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 99.69
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.69
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.69
3cg0_A140 Response regulator receiver modulated diguanylate 99.69
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.69
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.69
2qr3_A140 Two-component system response regulator; structura 99.69
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.69
1w25_A 459 Stalked-cell differentiation controlling protein; 99.68
3cz5_A153 Two-component response regulator, LUXR family; str 99.68
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.68
3eqz_A135 Response regulator; structural genomics, unknown f 99.68
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.67
1ys7_A 233 Transcriptional regulatory protein PRRA; response 99.67
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.67
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.67
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.67
2gkg_A127 Response regulator homolog; social motility, recei 99.67
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 99.66
2gwr_A 238 DNA-binding response regulator MTRA; two-component 99.65
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.65
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.65
3c97_A140 Signal transduction histidine kinase; structural g 99.65
3bre_A 358 Probable two-component response regulator; protein 99.64
2oqr_A 230 Sensory transduction protein REGX3; response regul 99.64
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.64
2rdm_A132 Response regulator receiver protein; structural ge 99.64
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.64
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.64
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription 99.62
3c3w_A 225 Two component transcriptional regulatory protein; 99.62
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.62
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.62
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.6
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.6
2hqr_A 223 Putative transcriptional regulator; phosporylation 99.59
3luf_A 259 Two-component system response regulator/ggdef doma 99.57
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.53
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.45
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.42
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 99.1
1w25_A 459 Stalked-cell differentiation controlling protein; 99.05
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.99
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.93
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.9
3mr0_A142 Sensory box histidine kinase/response regulator; P 98.88
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 98.81
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.8
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 98.8
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 98.77
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.76
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.74
3nja_A125 Probable ggdef family protein; structural genomics 98.71
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.68
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 98.67
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.64
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.59
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 98.56
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.52
3eeh_A125 Putative light and redox sensing histidine kinase; 98.47
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.47
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 98.46
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 98.46
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.46
3icy_A118 Sensor protein; sensory box histidine kinase/respo 98.45
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.38
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 98.36
2qkp_A151 Uncharacterized protein; structural genomics, unkn 98.35
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 98.34
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.31
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.28
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.27
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 98.27
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 98.26
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 98.26
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 98.21
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 98.21
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 98.21
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 98.18
2r78_A117 Sensor protein; sensory box sensor histidine kinas 98.17
3mjq_A126 Uncharacterized protein; NESG, structural genomics 98.16
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 98.11
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.05
3olo_A118 Two-component sensor histidine kinase; structural 98.03
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 97.97
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 97.95
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 97.95
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 97.9
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 97.89
3cax_A369 Uncharacterized protein PF0695; structural genomic 97.88
3zcc_A114 HAMP, osmolarity sensor protein ENVZ; signaling pr 97.87
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 97.87
3b33_A115 Sensor protein; structural genomics, PAS domain, n 97.64
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 97.59
1byw_A110 Protein (human ERG potassium channel); PAS domain, 97.57
4f3l_A361 Mclock, circadian locomoter output cycles protein 97.55
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 97.5
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 97.47
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 97.39
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 97.38
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 97.27
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 97.25
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 97.16
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 97.12
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 97.1
3zrx_A115 AF1503 protein, osmolarity sensor protein ENVZ; si 96.9
2ayx_A 254 Sensor kinase protein RCSC; two independent struct 96.88
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 96.77
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 96.72
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 96.68
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 96.67
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 96.47
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.28
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 95.13
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 96.12
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 95.92
3peh_A281 Endoplasmin homolog; structural genomics, structur 95.73
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 95.52
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 95.5
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 95.39
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 95.27
3rty_A339 Period circadian protein; PAS domain, signalling, 95.18
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 94.71
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 94.63
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 94.58
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 94.54
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 94.24
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 93.68
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 93.62
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 92.69
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 92.63
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 91.73
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 91.63
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 91.47
4duh_A220 DNA gyrase subunit B; structure-based drug design, 90.08
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 89.58
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 87.43
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 87.34
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 87.08
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 85.77
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 83.73
4f3l_A361 Mclock, circadian locomoter output cycles protein 83.19
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 81.06
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 80.67
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=2.6e-40  Score=374.05  Aligned_cols=335  Identities=24%  Similarity=0.351  Sum_probs=255.6

Q ss_pred             HHHHHHHHHHHHhccCcEEEEecccccEEEeeccC---CCCCcccccCCCchhccCccchhhhhHHHHHHHHhCCCccee
Q 039716          217 LKRADNFLHFVLQNAPVVMGHQDKELRYRFIYNHF---PSLHEEDILGKTDVEIFSGAGVKESQDFKREVLEKGLPAKRE  293 (1002)
Q Consensus       217 l~~~~~~l~~il~~~p~~i~~~d~~~~~~~~~~~~---~~~~~e~iiGk~~~e~~~~~~~~~~~~~~~~vl~~g~~~~~e  293 (1002)
                      +++++.+++.+++++|.+|+..|.++++.++|..+   .|+..++++|++..++...   .........++..+.+..  
T Consensus         3 l~~~~~~~~~i~~~~~~~i~~~d~~g~i~~~N~a~~~l~G~~~~e~~G~~~~~~~~~---~~~~~~~~~~~~~~~~~~--   77 (349)
T 3a0r_A            3 VEHLRNFSESILESLETAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDF---EEIGSVAESVFENKEPVF--   77 (349)
T ss_dssp             ------CCCSSGGGSSSEEEEEESSSBCSCBCHHHHHHHSCCSTTTTTCBSTTSTTT---THHHHHHHHHHHHCCCCE--
T ss_pred             hHHHHHHHHHHHhhhcCeEEEECCCCCEEeeHHHHHHHhCCCHHHHcCcCHHHCcCh---hHHHHHHHHHHhcCCcee--
Confidence            44556778889999999999999999999998764   6888999999998887332   223334455666655432  


Q ss_pred             EEEEEeecCceEEEEEEeeeecCCCCE-EEEEEEeechhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039716          294 ITFETELFGSKTFLIYVEPVFSKSGET-IGVNYMGMDVTDQVRKREKMAKLREEIAVQKAKETELNKTIHITEETMRAKQ  372 (1002)
Q Consensus       294 ~~~~~~~~~~~~~~~~~~p~~~~~G~~-~gi~~~~~DITe~~~~~~~~~~l~~el~~~~~~~~el~k~~~~~e~~~~~k~  372 (1002)
                        ......+..++.+...|+.+..|.. .|+++++.|||++++.++++.+.                     +.....++
T Consensus        78 --~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~DiTe~~~~e~~~~~~---------------------~~~~~~~~  134 (349)
T 3a0r_A           78 --LNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDDVTELYKYEEERKRR---------------------ERLSILGE  134 (349)
T ss_dssp             --EECCCBTTBCCEEEEEEECCTTTTSSCEEEEEEECCSTTTTTTTTTTHH---------------------HHHHHHHH
T ss_pred             --ecccccCceEEEEEEEEEEcCCCceeeEEEEEEEechHHHHHHHHHHHH---------------------HHHHHHHH
Confidence              2222346677888899999988775 58999999999987654433211                     11112357


Q ss_pred             HHHHhhhccccHHHHHHHHHHHHhCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCeeeEeeecCHHHHHHH
Q 039716          373 MLATMSHEIRSPLTGVVSMAEILSNTKLD-REQRQLLGVMISSGDLVLQLINDILDLSKVESGVMKLEAAKFRPREVVKH  451 (1002)
Q Consensus       373 fla~iSHELRTPL~~I~g~~elL~~~~l~-~~~~~~l~~i~~s~~~L~~LIndlLd~skiesg~~~l~~~~~~l~~li~~  451 (1002)
                      |++.+||||||||++|.+++++|.....+ +..+++++.+..++.++..++++++++++..   ..+...++++.++++.
T Consensus       135 ~~~~i~Helr~pL~~i~~~~~~l~~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~---~~~~~~~~~l~~~~~~  211 (349)
T 3a0r_A          135 MTARVAHEIRNPITIIGGFIMRMKKHLDDPETLKKYINIITNELSRLETIVKEILEYSKER---QVLEFTEFNLNELIRE  211 (349)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTSCSCSSCTTHHHHHHHHHHHHHHHHHHHHHHHHHCC----CEEEEEEEHHHHHHH
T ss_pred             HHHHHHHHhcchHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCc---cccCCcccCHHHHHHH
Confidence            99999999999999999999999765333 3457889999999999999999999999943   3466788999999999


Q ss_pred             HHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCC-CCeeEEEEEecCCCCcccchhhhhhhhh
Q 039716          452 VLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTP-EGKVGIKLYVVPEPPFAKEGLKQKSKAY  529 (1002)
Q Consensus       452 v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~-~G~I~I~v~~~~~~~~~~~~~~~~~~~~  529 (1002)
                      ++..+...+. +.+.+....... +..+.+|+.+|.|||.||++||+||++ .|.|.|.+...                 
T Consensus       212 ~~~~~~~~~~~~~i~~~~~~~~~-~~~~~~d~~~l~~vl~nLl~NA~k~~~~~~~i~i~~~~~-----------------  273 (349)
T 3a0r_A          212 VYVLFEEKIRKMNIDFCFETDNE-DLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDM-----------------  273 (349)
T ss_dssp             HHHHHHHHHTTTTCCCEEEESCS-CCEEEECHHHHHHHHHHHHTHHHHTTCTTCCEEEEEEEE-----------------
T ss_pred             HHHHHHHHHHHcCcEEEEecCCC-CceEEeCHHHHHHHHHHHHHHHHHhccCCCEEEEEEEec-----------------
Confidence            9988876654 456666555544 346889999999999999999999995 57777766421                 


Q ss_pred             hcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEEEEEecCCCCCcCcHh
Q 039716          530 QSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRCDVYDTGIGIPENALP  609 (1002)
Q Consensus       530 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtGiGI~~e~l~  609 (1002)
                                                                                 ..++.|+|.|+|+|||++.++
T Consensus       274 -----------------------------------------------------------~~~~~i~v~D~G~Gi~~~~~~  294 (349)
T 3a0r_A          274 -----------------------------------------------------------YTKVRVSVWNSGPPIPEELKE  294 (349)
T ss_dssp             -----------------------------------------------------------TTEEEEEEEEESCCCCGGGGT
T ss_pred             -----------------------------------------------------------CCEEEEEEEECCCCCChHHHh
Confidence                                                                       114889999999999999999


Q ss_pred             hhhhhccCCCccccCcCCCccccHHHHHHHHH-HhCCEEEEEeecCCceEEEEEEeCC
Q 039716          610 TLFRKYMQVSADHARKYGGTGLGLAICKQLVE-LMGGRLTVTSKVHCGSTFTFILPYQ  666 (1002)
Q Consensus       610 ~IF~pF~q~~~~~~~~~~GtGLGLaI~k~Lve-~~gG~I~v~S~~g~GTtF~~~LP~~  666 (1002)
                      +||+||++.+      .+|+||||+|||++|+ .|||.|+++|.++ ||+|+|+||..
T Consensus       295 ~if~~f~~~~------~~g~GlGL~i~~~~v~~~~gg~i~~~~~~~-Gt~f~i~lP~~  345 (349)
T 3a0r_A          295 KIFSPFFTTK------TQGTGLGLSICRKIIEDEHGGKIWTENREN-GVVFIFEIPKT  345 (349)
T ss_dssp             TTSSSCCCC------------CCCTHHHHHHHHTTCSBCCEEECSS-EEEEEEEEESC
T ss_pred             hcCCCCccCC------CCCccchHHHHHHHHHHhCCCEEEEEeCCC-cEEEEEEecCC
Confidence            9999999753      4599999999999999 8999999999865 99999999975



>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1002
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 1e-24
d2c2aa2161 d.122.1.3 (A:321-481) Sensor histidine kinase TM08 2e-24
d2c2aa2161 d.122.1.3 (A:321-481) Sensor histidine kinase TM08 6e-11
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 2e-23
d1ysra1148 d.122.1.3 (A:299-446) Sensor-type histidine kinase 1e-22
d1ysra1148 d.122.1.3 (A:299-446) Sensor-type histidine kinase 8e-08
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 3e-22
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 3e-22
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 4e-22
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 1e-21
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 3e-21
d1bxda_161 d.122.1.3 (A:) Histidine kinase domain of the osmo 6e-21
d1bxda_161 d.122.1.3 (A:) Histidine kinase domain of the osmo 9e-08
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 3e-20
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 7e-20
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 2e-19
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-19
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 3e-19
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 4e-19
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 5e-19
d1jm6a2190 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin 9e-19
d1jm6a2190 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin 5e-10
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 9e-19
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 1e-18
d1id0a_146 d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche 1e-18
d1id0a_146 d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche 1e-07
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 2e-18
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 7e-18
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 2e-17
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 3e-17
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 7e-17
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 1e-16
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 1e-16
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 7e-16
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 9e-16
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 2e-15
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 5e-15
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 5e-15
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 1e-14
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 5e-14
d1gkza2193 d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci 7e-14
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 2e-13
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 4e-13
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 6e-13
d1i58a_189 d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m 8e-13
d1r62a_156 d.122.1.3 (A:) Nitrogen regulation protein NtrB, C 1e-12
d1r62a_156 d.122.1.3 (A:) Nitrogen regulation protein NtrB, C 2e-07
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 2e-10
d2c2aa189 a.30.2.1 (A:232-320) Sensor histidine kinase TM085 2e-08
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 4e-08
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 2e-04
d1joya_67 a.30.2.1 (A:) EnvZ histidine kinase {Escherichia c 1e-07
d1th8a_139 d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus 9e-05
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: Receiver domain of the ethylene receptor
domain: Receiver domain of the ethylene receptor
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 98.1 bits (244), Expect = 1e-24
 Identities = 29/140 (20%), Positives = 63/140 (45%), Gaps = 22/140 (15%)

Query: 861  KILLVEDNKINVMVAKSMMKQLGHSIDVVNNGVEAVHAVQCQNYDLILMDVCMPVMDGLK 920
            K+L++++N ++ MV K ++  LG  +  V++  E +  V    + ++ MDVCMP ++  +
Sbjct: 9    KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVS-HEHKVVFMDVCMPGVENYQ 67

Query: 921  ATRLIRSFEDTGNWDAAAEAGIEQAMPSSGSSNHFKRIPIIAMTANALSESAEECFANGM 980
                I                         +    +R  ++A++ N    + E+C + G+
Sbjct: 68   IALRIHEKF---------------------TKQRHQRPLLVALSGNTDKSTKEKCMSFGL 106

Query: 981  DSFVSKPVTFQKLKECLEQY 1000
            D  + KPV+   +++ L   
Sbjct: 107  DGVLLKPVSLDNIRDVLSDL 126


>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Length = 67 Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1002
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 100.0
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 99.96
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 99.96
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 99.96
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 99.95
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 99.94
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 99.94
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.92
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.92
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.92
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.92
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.91
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.91
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.91
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.91
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.91
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.91
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.9
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.9
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.9
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.9
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.9
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.9
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.9
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.9
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.9
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.9
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.89
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.89
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.89
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.89
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.89
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.88
d1s8na_190 Probable two-component system transcriptional regu 99.88
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.88
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.87
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.87
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.86
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.85
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.81
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.77
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 99.7
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.65
d1i58a_189 Histidine kinase CheA {Thermotoga maritima [TaxId: 99.43
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 99.41
d2c2aa189 Sensor histidine kinase TM0853 {Thermotoga maritim 99.41
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 99.22
d1joya_67 EnvZ histidine kinase {Escherichia coli [TaxId: 56 99.04
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 98.74
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 98.5
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 98.34
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.33
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 98.28
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.88
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 97.57
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 97.49
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 97.38
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 96.4
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 95.47
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 95.36
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 95.07
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 92.98
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 86.52
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 85.24
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 84.52
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 83.39
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 80.22
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=8.6e-33  Score=276.36  Aligned_cols=155  Identities=30%  Similarity=0.434  Sum_probs=124.1

Q ss_pred             eEeeecCHHHHHHHHHHHHHHHHh-hcceeccccCCCCCeeEEccHHHHHHHHHHHHhhhhhcCCCCee--EEEEEecCC
Q 039716          438 LEAAKFRPREVVKHVLQTAAASLQ-KILMLEGDIADDVPIEVIGDVLRIRQILTNLISNAIKFTPEGKV--GIKLYVVPE  514 (1002)
Q Consensus       438 l~~~~~~l~~li~~v~~~~~~~~~-k~i~l~~~i~~~~p~~v~gD~~rL~QIL~NLlsNAIKfT~~G~I--~I~v~~~~~  514 (1002)
                      ++.++|++.+++++++..+...+. +.+.+........+..+.+|+.+|+|||.|||+||+|||++|.+  .|.+.+.. 
T Consensus         2 l~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~-   80 (161)
T d2c2aa2           2 INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDE-   80 (161)
T ss_dssp             CCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEE-
T ss_pred             CccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCCEEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEEEEe-
Confidence            456789999999999998887664 56777766665666789999999999999999999999988642  33332210 


Q ss_pred             CCcccchhhhhhhhhhcchhhhhhhccCCCCCccCCCCCCCCCCCCCCccCCCCCCCCCCCccCCCCCccccccceEEEE
Q 039716          515 PPFAKEGLKQKSKAYQSATDAVKEEKHQPKSQTASDQNGFHDKKHGEGYQDHKHDDDPGTPVSHGNSMDEDLEATVWIRC  594 (1002)
Q Consensus       515 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i  594 (1002)
                                                                                               ...++.|
T Consensus        81 -------------------------------------------------------------------------~~~~~~i   87 (161)
T d2c2aa2          81 -------------------------------------------------------------------------KDGGVLI   87 (161)
T ss_dssp             -------------------------------------------------------------------------ETTEEEE
T ss_pred             -------------------------------------------------------------------------cCCEEEE
Confidence                                                                                     1125889


Q ss_pred             EEEecCCCCCcCcHhhhhhhccCCCccccCcCCCccccHHHHHHHHHHhCCEEEEEeecCCceEEEEEEeCC
Q 039716          595 DVYDTGIGIPENALPTLFRKYMQVSADHARKYGGTGLGLAICKQLVELMGGRLTVTSKVHCGSTFTFILPYQ  666 (1002)
Q Consensus       595 ~V~DtGiGI~~e~l~~IF~pF~q~~~~~~~~~~GtGLGLaI~k~Lve~~gG~I~v~S~~g~GTtF~~~LP~~  666 (1002)
                      +|.|+|+|||++.+++||+||||.+...+++.+|+||||+|||+||+.|||+|+|+|.+|+||+|+|+||..
T Consensus        88 ~V~D~G~GI~~~~~~~iF~~F~~~~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~~~Gt~f~i~lP~~  159 (161)
T d2c2aa2          88 IVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPKD  159 (161)
T ss_dssp             EEEECSSCCCGGGTTGGGSTTCCCC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEECC
T ss_pred             EEEEcCCCCCHHHHHHhhCCcEEcCCCCCCCCCcccHHHHHHHHHHHHCCCEEEEEecCCCeeEEEEEEEcc
Confidence            999999999999999999999999877777788999999999999999999999999999999999999974



>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure