Citrus Sinensis ID: 039972
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| 147838921 | 161 | hypothetical protein VITISV_022410 [Viti | 0.668 | 0.701 | 0.541 | 3e-27 | |
| 449461799 | 195 | PREDICTED: transcription factor bHLH87-l | 0.721 | 0.625 | 0.534 | 3e-27 | |
| 224091024 | 165 | predicted protein [Populus trichocarpa] | 0.810 | 0.830 | 0.477 | 6e-27 | |
| 15240948 | 912 | aprataxin [Arabidopsis thaliana] gi|7533 | 0.585 | 0.108 | 0.583 | 6e-26 | |
| 297810265 | 898 | basic helix-loop-helix family protein [A | 0.479 | 0.090 | 0.686 | 2e-25 | |
| 357506069 | 153 | LAX [Medicago truncatula] gi|355498338|g | 0.585 | 0.647 | 0.559 | 2e-25 | |
| 224091579 | 163 | predicted protein [Populus trichocarpa] | 0.414 | 0.429 | 0.771 | 1e-24 | |
| 357131240 | 228 | PREDICTED: transcription factor LAX PANI | 0.461 | 0.342 | 0.594 | 6e-21 | |
| 227016421 | 211 | barren stalk1-like protein [Leymus ciner | 0.366 | 0.293 | 0.709 | 4e-20 | |
| 227016419 | 211 | barren stalk1-like protein [Leymus ciner | 0.366 | 0.293 | 0.709 | 4e-20 |
| >gi|147838921|emb|CAN77067.1| hypothetical protein VITISV_022410 [Vitis vinifera] gi|297735648|emb|CBI18142.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 126 bits (316), Expect = 3e-27, Method: Compositional matrix adjust.
Identities = 71/131 (54%), Positives = 85/131 (64%), Gaps = 18/131 (13%)
Query: 30 LSTDPQSVAARQRRHRISDRFKILQSMVPGGTKMDTASMLDEAINYVKFLKAVIWFHENI 89
LSTDPQSVAAR+RRHRISDRFKILQS+VPGGTKMDT SML+EAI+YVK+LK IW H+ +
Sbjct: 36 LSTDPQSVAARERRHRISDRFKILQSLVPGGTKMDTVSMLEEAIHYVKYLKTQIWLHQTM 95
Query: 90 INFADHHHHEHDPPVAFGQLPGSFP-YSPESLYSSINNLAAAPVPQQDSMQ--ASETQPF 146
INF D DP + + S P + E+ YS LA MQ + T P
Sbjct: 96 INFVD-----DDPSLLYQS--DSLPSHQQEAFYSPDETLAM--------MQPYITTTAPV 140
Query: 147 QDFNVFQGEES 157
+D FQGEE+
Sbjct: 141 RDSYCFQGEET 151
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449461799|ref|XP_004148629.1| PREDICTED: transcription factor bHLH87-like [Cucumis sativus] gi|449532778|ref|XP_004173357.1| PREDICTED: transcription factor bHLH87-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224091024|ref|XP_002309150.1| predicted protein [Populus trichocarpa] gi|222855126|gb|EEE92673.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15240948|ref|NP_195751.1| aprataxin [Arabidopsis thaliana] gi|75335734|sp|Q9M041.1|BH140_ARATH RecName: Full=Transcription factor bHLH140; AltName: Full=Basic helix-loop-helix protein 140; Short=AtbHLH140; Short=bHLH 140; AltName: Full=Transcription factor EN 122; AltName: Full=bHLH transcription factor bHLH140 gi|7320709|emb|CAB81914.1| putative protein [Arabidopsis thaliana] gi|332002943|gb|AED90326.1| aprataxin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297810265|ref|XP_002873016.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297318853|gb|EFH49275.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357506069|ref|XP_003623323.1| LAX [Medicago truncatula] gi|355498338|gb|AES79541.1| LAX [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224091579|ref|XP_002334947.1| predicted protein [Populus trichocarpa] gi|222875273|gb|EEF12404.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357131240|ref|XP_003567247.1| PREDICTED: transcription factor LAX PANICLE-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|227016421|gb|ACP18672.1| barren stalk1-like protein [Leymus cinereus x Leymus triticoides] | Back alignment and taxonomy information |
|---|
| >gi|227016419|gb|ACP18671.1| barren stalk1-like protein [Leymus cinereus x Leymus triticoides] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 169 | ||||||
| TAIR|locus:2179122 | 912 | APTX "APRATAXIN-like" [Arabido | 0.781 | 0.144 | 0.485 | 5.7e-24 | |
| UNIPROTKB|Q5MP56 | 219 | BA1 "Uncharacterized protein" | 0.349 | 0.269 | 0.745 | 1.2e-19 | |
| TAIR|locus:2144791 | 224 | HEC3 "AT5G09750" [Arabidopsis | 0.331 | 0.25 | 0.75 | 2.4e-19 | |
| TAIR|locus:2089418 | 373 | AT3G21330 "AT3G21330" [Arabido | 0.514 | 0.233 | 0.531 | 4.3e-19 | |
| UNIPROTKB|Q6Z9R3 | 246 | P0461F06.33 "BHLH protein fami | 0.502 | 0.345 | 0.545 | 6.5e-19 | |
| UNIPROTKB|Q67TR8 | 236 | B1342C04.6 "Basic helix-loop-h | 0.331 | 0.237 | 0.732 | 4.1e-17 | |
| TAIR|locus:2074865 | 231 | HEC2 "AT3G50330" [Arabidopsis | 0.313 | 0.229 | 0.773 | 4.1e-17 | |
| TAIR|locus:2155543 | 241 | HEC1 "HECATE 1" [Arabidopsis t | 0.313 | 0.219 | 0.773 | 4.1e-17 | |
| UNIPROTKB|Q657D1 | 484 | P0697C12.40 "BHLH transcriptio | 0.331 | 0.115 | 0.678 | 6.7e-16 | |
| UNIPROTKB|Q69TX2 | 211 | P0021C04.13 "BHLH protein-like | 0.550 | 0.440 | 0.478 | 7.7e-16 |
| TAIR|locus:2179122 APTX "APRATAXIN-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 286 (105.7 bits), Expect = 5.7e-24, P = 5.7e-24
Identities = 68/140 (48%), Positives = 86/140 (61%)
Query: 30 LSTDPQSVAARQRRHRISDRFKILQSMVPGGTKMDTASMLDEAINYVKFLKAVIWFHENI 89
LSTDPQSVAAR RRHRISDRFKILQSMVPGG KMDT SMLDEAI+YVKFLKA IW+H+N+
Sbjct: 43 LSTDPQSVAARDRRHRISDRFKILQSMVPGGAKMDTVSMLDEAISYVKFLKAQIWYHQNM 102
Query: 90 INFADHHHHEHDPPVAFGQLPGSFPYSPESLYSSINNLAAAPVPQQDSMQASETQPFQDF 149
+ F + H E + PG+ + P+ L+ ++ A P+ S T +
Sbjct: 103 LLFINDH--ETTSSCTYS--PGAGEFGPK-LFGYDDDYA--PIMDTYSQGVPLTVADSKY 155
Query: 150 NVFQGEESETLMHLDGFMKY 169
+ G + H+ F KY
Sbjct: 156 TPWFGSVDDEQEHVTYF-KY 174
|
|
| UNIPROTKB|Q5MP56 BA1 "Uncharacterized protein" [Zea mays (taxid:4577)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144791 HEC3 "AT5G09750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089418 AT3G21330 "AT3G21330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6Z9R3 P0461F06.33 "BHLH protein family-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q67TR8 B1342C04.6 "Basic helix-loop-helix (BHLH)-like protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074865 HEC2 "AT3G50330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155543 HEC1 "HECATE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q657D1 P0697C12.40 "BHLH transcription-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q69TX2 P0021C04.13 "BHLH protein-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 3e-13 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 7e-13 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 4e-10 |
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Score = 60.3 bits (147), Expect = 3e-13
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
Query: 36 SVAARQRRHRISDRFKILQSMVPG---GTKMDTASMLDEAINYVKFLKAV 82
+ R+RR +I++ F L+S++P K+ A +L AI Y+K L+
Sbjct: 1 NARERRRRRKINEAFDELRSLLPTLPKNKKLSKAEILRLAIEYIKSLQEE 50
|
Length = 53 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.53 | |
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.52 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.51 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 99.22 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 98.98 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.96 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.68 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 98.57 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 98.21 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 98.05 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 98.02 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 97.98 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 97.86 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 95.7 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 95.68 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 95.13 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 93.62 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 92.71 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 91.31 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 80.24 |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
Probab=99.53 E-value=1.7e-14 Score=95.24 Aligned_cols=51 Identities=33% Similarity=0.660 Sum_probs=48.6
Q ss_pred CcccHHHHHHHHHHHHHHHHHHhcCCCC---CCCChhhHHHHHHHHHHHHHHHH
Q 039972 33 DPQSVAARQRRHRISDRFKILQSMVPGG---TKMDTASMLDEAINYVKFLKAVI 83 (169)
Q Consensus 33 ~~h~~~ER~RR~kin~~~~~Lr~lvP~~---~K~dkasiL~~aI~YIk~Lq~~v 83 (169)
..|+..||+||++||++|..|+++||.. .|+||++||+.||+||+.|+.++
T Consensus 6 ~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~ 59 (60)
T cd00083 6 EAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL 59 (60)
T ss_pred HHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence 4699999999999999999999999987 89999999999999999999876
|
A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 169 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 2e-10 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 1e-07 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 1e-07 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 6e-07 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 2e-06 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Score = 53.2 bits (128), Expect = 2e-10
Identities = 13/46 (28%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
Query: 36 SVAARQRRHRISDRFKILQSMVPG-GTKMDTASMLDEAINYVKFLK 80
+ ++ R I+D+ L+ +V G K++ +++L +AI+Y++FL+
Sbjct: 11 NAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQ 56
|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.72 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.66 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.66 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.65 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.64 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.61 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.61 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.61 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.58 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.51 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.51 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.26 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.23 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.17 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.03 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.88 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.84 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.44 | |
| 1pyi_A | 96 | Protein (pyrimidine pathway regulator 1); protein- | 84.19 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.72 E-value=6.8e-18 Score=119.53 Aligned_cols=62 Identities=21% Similarity=0.333 Sum_probs=57.4
Q ss_pred CcccHHHHHHHHHHHHHHHHHHhcCCCC-CCCChhhHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 039972 33 DPQSVAARQRRHRISDRFKILQSMVPGG-TKMDTASMLDEAINYVKFLKAVIWFHENIINFAD 94 (169)
Q Consensus 33 ~~h~~~ER~RR~kin~~~~~Lr~lvP~~-~K~dkasiL~~aI~YIk~Lq~~v~~L~~~~~~~~ 94 (169)
..|+.+||+||++||++|..|++|||++ .|+|||+||++||+||++|+.+++.|+.....+.
T Consensus 8 ~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~ 70 (82)
T 1am9_A 8 TAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR 70 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4699999999999999999999999997 9999999999999999999999999988666553
|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1pyi_A Protein (pyrimidine pathway regulator 1); protein-DNA complex, transcription/DNA complex, GAL4, zinc finger, Zn2Cys6, binuclear cluster; HET: DNA; 3.20A {Saccharomyces cerevisiae} SCOP: g.38.1.1 h.1.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 169 | ||||
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 3e-13 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 4e-12 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 1e-11 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 1e-10 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 2e-10 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 5e-10 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 1e-09 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 9e-09 |
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.0 bits (143), Expect = 3e-13
Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
Query: 43 RHRISDRFKILQSMVPGGT-KMDTASMLDEAINYVKFLKA 81
R I+D+ L+ +V G KM + +L +AI+Y+K+L+
Sbjct: 1 RSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQ 40
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 169 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.64 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.59 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.57 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.54 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.53 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.64 E-value=1.6e-16 Score=109.95 Aligned_cols=61 Identities=21% Similarity=0.340 Sum_probs=55.7
Q ss_pred CcccHHHHHHHHHHHHHHHHHHhcCCCC-CCCChhhHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 039972 33 DPQSVAARQRRHRISDRFKILQSMVPGG-TKMDTASMLDEAINYVKFLKAVIWFHENIINFA 93 (169)
Q Consensus 33 ~~h~~~ER~RR~kin~~~~~Lr~lvP~~-~K~dkasiL~~aI~YIk~Lq~~v~~L~~~~~~~ 93 (169)
..|+.+||+||++||++|..|++|||++ .|+||++||..||+||+.|+.+++.|......+
T Consensus 8 ~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~l 69 (80)
T d1am9a_ 8 TAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL 69 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3699999999999999999999999985 799999999999999999999999888755544
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|