Citrus Sinensis ID: 039995

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MHNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF
cHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccccccc
cccHHHHHHccccccccEccccccccccHHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccc
MHNKLFSLYYLMTrqprlskglgyaintseelNFVKDIAAAtgvvldpvysgkaAYGMLndmaqnpkkwegRKVLFVHTggllglfdkvdqmapllknwsrmdvhesvprkdgtgkmf
MHNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLknwsrmdvhesvprkdgtgkmf
MHNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF
****LFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWS******************
******SLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSR**VHESVPRKDGTG***
MHNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSRMDVHESVP*********
*HNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSR*DVHE***********F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNKLFSLYYLMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q9WY68312 Putative 1-aminocycloprop yes no 0.525 0.198 0.477 4e-11
O57809325 Putative 1-aminocycloprop yes no 0.593 0.215 0.410 3e-08
Q9V2L2330 Putative 1-aminocycloprop yes no 0.686 0.245 0.406 6e-08
Q8U4R3329 Putative 1-aminocycloprop yes no 0.584 0.209 0.445 8e-08
B7NBR4328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 9e-08
Q1RAM1328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 1e-07
B7NRG1328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 1e-07
B7MCH6328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 1e-07
B7UST8328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 1e-07
B5YRU5328 D-cysteine desulfhydrase yes no 0.533 0.192 0.437 1e-07
>sp|Q9WY68|1A1D_THEMA Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0225 PE=3 SV=1 Back     alignment and function desciption
 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 5/67 (7%)

Query: 20  KGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHT 79
           +G GYAI +SE++  +K++A+  G++LDPVY+ KA  GM+ +M +N +K     VLF+HT
Sbjct: 244 RGPGYAIPSSEDVEILKEVASIEGIILDPVYTAKAFRGMI-EMFRNSEK----NVLFIHT 298

Query: 80  GGLLGLF 86
           GG+ GLF
Sbjct: 299 GGIFGLF 305

Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) (taxid: 243274)
EC: 3EC: .EC: 5EC: .EC: 9EC: 9EC: .EC: 7
>sp|O57809|1A1D_PYRHO Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0054 PE=1 SV=2 Back     alignment and function description
>sp|Q9V2L2|1A1D_PYRAB Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB00630 PE=3 SV=1 Back     alignment and function description
>sp|Q8U4R3|1A1D_PYRFU Putative 1-aminocyclopropane-1-carboxylate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0010 PE=3 SV=2 Back     alignment and function description
>sp|B7NBR4|DCYD_ECOLU D-cysteine desulfhydrase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dcyD PE=3 SV=1 Back     alignment and function description
>sp|Q1RAM1|DCYD_ECOUT D-cysteine desulfhydrase OS=Escherichia coli (strain UTI89 / UPEC) GN=dcyD PE=3 SV=1 Back     alignment and function description
>sp|B7NRG1|DCYD_ECO7I D-cysteine desulfhydrase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dcyD PE=3 SV=1 Back     alignment and function description
>sp|B7MCH6|DCYD_ECO45 D-cysteine desulfhydrase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dcyD PE=3 SV=1 Back     alignment and function description
>sp|B7UST8|DCYD_ECO27 D-cysteine desulfhydrase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dcyD PE=3 SV=1 Back     alignment and function description
>sp|B5YRU5|DCYD_ECO5E D-cysteine desulfhydrase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dcyD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
224120432 387 predicted protein [Populus trichocarpa] 0.847 0.258 0.83 8e-44
118488292 387 unknown [Populus trichocarpa] 0.847 0.258 0.82 2e-43
255573527 427 1-aminocyclopropane-1-carboxylate deamin 0.847 0.234 0.8 1e-42
357521719 388 D-cysteine desulfhydrase [Medicago trunc 0.847 0.257 0.79 7e-42
388494388 388 unknown [Medicago truncatula] 0.847 0.257 0.79 7e-42
356512946 379 PREDICTED: putative 1-aminocyclopropane- 0.847 0.263 0.78 1e-41
326497841 422 predicted protein [Hordeum vulgare subsp 0.847 0.236 0.8 2e-41
357137907 419 PREDICTED: putative 1-aminocyclopropane- 0.847 0.238 0.78 3e-41
149392605156 1-aminocyclopropane-1-carboxylate deamin 0.847 0.641 0.78 7e-41
218191664 385 hypothetical protein OsI_09120 [Oryza sa 0.847 0.259 0.78 8e-41
>gi|224120432|ref|XP_002318328.1| predicted protein [Populus trichocarpa] gi|222859001|gb|EEE96548.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%)

Query: 19  SKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVH 78
           +KGLGYAINTSEEL FVK+IA ATGVVLDPVYSGKAAYGM+ DMA+NPK WEGRKVLF+H
Sbjct: 288 AKGLGYAINTSEELKFVKEIATATGVVLDPVYSGKAAYGMMKDMAENPKNWEGRKVLFIH 347

Query: 79  TGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF 118
           TGGLLGLFDKVDQM+ L++NW RM+V ESVPRKDG GKMF
Sbjct: 348 TGGLLGLFDKVDQMSSLVENWGRMEVQESVPRKDGIGKMF 387

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118488292|gb|ABK95965.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573527|ref|XP_002527688.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus communis] gi|223532919|gb|EEF34687.1| 1-aminocyclopropane-1-carboxylate deaminase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357521719|ref|XP_003631148.1| D-cysteine desulfhydrase [Medicago truncatula] gi|355525170|gb|AET05624.1| D-cysteine desulfhydrase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388494388|gb|AFK35260.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356512946|ref|XP_003525175.1| PREDICTED: putative 1-aminocyclopropane-1-carboxylate deaminase-like [Glycine max] Back     alignment and taxonomy information
>gi|326497841|dbj|BAJ94783.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357137907|ref|XP_003570540.1| PREDICTED: putative 1-aminocyclopropane-1-carboxylate deaminase-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|149392605|gb|ABR26105.1| 1-aminocyclopropane-1-carboxylate deaminase [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|218191664|gb|EEC74091.1| hypothetical protein OsI_09120 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2007725401 D-CDES "AT1G48420" [Arabidopsi 0.847 0.249 0.75 1.4e-39
UNIPROTKB|P76316328 dcyD [Escherichia coli K-12 (t 0.533 0.192 0.437 9.5e-09
UNIPROTKB|Q5LL69339 cuyA "L-cysteate sulfo-lyase" 0.550 0.191 0.393 3.5e-07
TIGR_CMR|SPO_A0158339 SPO_A0158 "ACC deaminase/D-cys 0.550 0.191 0.393 3.5e-07
UNIPROTKB|Q81NG1331 BAS3005 "Putative pyridoxal ph 0.550 0.196 0.393 9.2e-07
TIGR_CMR|BA_3236331 BA_3236 "pyridoxal phosphate-d 0.550 0.196 0.393 9.2e-07
UNIPROTKB|Q48L12314 PSPPH_1673 "ACC deaminase/D-cy 0.542 0.203 0.393 3.8e-06
TIGR_CMR|SPO_2657385 SPO_2657 "ACC deaminase/D-cyst 0.542 0.166 0.373 1.5e-05
POMBASE|SPAC922.03338 SPAC922.03 "1-aminocyclopropan 0.483 0.168 0.379 1.5e-05
UNIPROTKB|Q4KK38331 dcyD "D-cysteine desulfhydrase 0.423 0.151 0.403 3.1e-05
TAIR|locus:2007725 D-CDES "AT1G48420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 422 (153.6 bits), Expect = 1.4e-39, P = 1.4e-39
 Identities = 75/100 (75%), Positives = 91/100 (91%)

Query:    19 SKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVH 78
             +KG GYA+NTSEEL FVK +A++TGV+LDPVYSGKAAYG++N++ ++PK WEGRK+LF+H
Sbjct:   302 AKGKGYAMNTSEELEFVKKVASSTGVILDPVYSGKAAYGLINEITKDPKCWEGRKILFIH 361

Query:    79 TGGLLGLFDKVDQMAPLLKNWSRMDVHESVPRKDGTGKMF 118
             TGGLLGL+DKVDQMA L+ NWSRMDV ESVPRKDG GKMF
Sbjct:   362 TGGLLGLYDKVDQMASLMGNWSRMDVSESVPRKDGVGKMF 401
GO:0003824 "catalytic activity" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0008660 "1-aminocyclopropane-1-carboxylate deaminase activity" evidence=IGI;IDA
GO:0019148 "D-cysteine desulfhydrase activity" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0009693 "ethylene biosynthetic process" evidence=IMP
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0032880 "regulation of protein localization" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0019447 "D-cysteine catabolic process" evidence=IDA
UNIPROTKB|P76316 dcyD [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LL69 cuyA "L-cysteate sulfo-lyase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0158 SPO_A0158 "ACC deaminase/D-cysteine desulfhydrase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q81NG1 BAS3005 "Putative pyridoxal phosphate-dependent deaminase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3236 BA_3236 "pyridoxal phosphate-dependent deaminase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q48L12 PSPPH_1673 "ACC deaminase/D-cysteine desulfhydrase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2657 SPO_2657 "ACC deaminase/D-cysteine desulfhydrase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
POMBASE|SPAC922.03 SPAC922.03 "1-aminocyclopropane-1-carboxylate deaminase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KK38 dcyD "D-cysteine desulfhydrase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
TIGR01275318 TIGR01275, ACC_deam_rel, pyridoxal phosphate-depen 9e-27
PRK03910331 PRK03910, PRK03910, D-cysteine desulfhydrase; Vali 8e-20
COG2515323 COG2515, Acd, 1-aminocyclopropane-1-carboxylate de 5e-16
cd06449307 cd06449, ACCD, Aminocyclopropane-1-carboxylate dea 9e-14
PRK14045329 PRK14045, PRK14045, 1-aminocyclopropane-1-carboxyl 7e-12
TIGR01274337 TIGR01274, ACC_deam, 1-aminocyclopropane-1-carboxy 2e-06
PRK12390337 PRK12390, PRK12390, 1-aminocyclopropane-1-carboxyl 4e-06
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 2e-04
>gnl|CDD|233338 TIGR01275, ACC_deam_rel, pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information 
 Score =  100 bits (250), Expect = 9e-27
 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 20  KGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHT 79
            G GY + TSE +  VK +A+  G++LDPVY+GKA YG+++ + +    +  + +LF+HT
Sbjct: 248 FGPGYGVPTSEGMEIVKKVASLEGIILDPVYTGKAFYGLIDGIRKKE--FGDKPILFIHT 305

Query: 80  GGLLGLFDKVDQM 92
           GG+ GLF   D +
Sbjct: 306 GGIPGLFAYHDHL 318

This model represents a family of pyridoxal phosphate-dependent enzymes closely related to (and often designated as putative examples of) 1-aminocyclopropane-1-carboxylate deaminase. It appears that members of this family include both D-cysteine desulfhydrase (EC 4.4.1.15) and 1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7). Length = 318
>gnl|CDD|179673 PRK03910, PRK03910, D-cysteine desulfhydrase; Validated Back     alignment and domain information
>gnl|CDD|225313 COG2515, Acd, 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107210 cd06449, ACCD, Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>gnl|CDD|172537 PRK14045, PRK14045, 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>gnl|CDD|130341 TIGR01274, ACC_deam, 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>gnl|CDD|183494 PRK12390, PRK12390, 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.89
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.79
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 99.79
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 99.77
PRK03910331 D-cysteine desulfhydrase; Validated 99.52
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 99.51
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 99.51
PRK06381319 threonine synthase; Validated 99.08
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 98.88
PRK08329347 threonine synthase; Validated 98.86
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 98.72
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 98.69
PRK07591421 threonine synthase; Validated 98.66
PRK07048321 serine/threonine dehydratase; Validated 98.64
TIGR00260328 thrC threonine synthase. Involved in threonine bio 98.63
PRK06260397 threonine synthase; Validated 98.54
PRK06721352 threonine synthase; Reviewed 98.54
PRK08197394 threonine synthase; Validated 98.5
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 98.48
PRK06352351 threonine synthase; Validated 98.43
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 98.41
PRK09224 504 threonine dehydratase; Reviewed 98.41
PRK06815317 hypothetical protein; Provisional 98.39
PRK07409353 threonine synthase; Validated 98.29
PRK12391427 tryptophan synthase subunit beta; Reviewed 98.27
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 98.2
PLN02550 591 threonine dehydratase 98.14
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 98.07
PRK05638442 threonine synthase; Validated 98.07
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 97.98
PRK08639420 threonine dehydratase; Validated 97.97
PRK12483 521 threonine dehydratase; Reviewed 97.96
PRK06382406 threonine dehydratase; Provisional 97.77
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 97.7
PRK08198404 threonine dehydratase; Provisional 97.69
PRK10717330 cysteine synthase A; Provisional 97.62
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 97.6
PRK06110322 hypothetical protein; Provisional 97.57
PRK07476322 eutB threonine dehydratase; Provisional 97.53
TIGR01139298 cysK cysteine synthase A. This model distinguishes 97.52
TIGR01136299 cysKM cysteine synthases. This model discriminates 97.39
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 97.22
PRK08526403 threonine dehydratase; Provisional 97.16
PLN02569484 threonine synthase 96.71
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 96.57
PRK08246310 threonine dehydratase; Provisional 96.38
COG0498411 ThrC Threonine synthase [Amino acid transport and 96.38
PLN02970328 serine racemase 96.15
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 95.92
PRK02991441 D-serine dehydratase; Provisional 95.36
TIGR02079409 THD1 threonine dehydratase. This model represents 95.13
PRK08638333 threonine dehydratase; Validated 94.88
PRK08206399 diaminopropionate ammonia-lyase; Provisional 94.8
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 94.57
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 94.3
PRK07334403 threonine dehydratase; Provisional 94.2
PRK08813349 threonine dehydratase; Provisional 94.04
PRK06608338 threonine dehydratase; Provisional 93.25
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 93.25
PRK09225462 threonine synthase; Validated 93.19
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 93.12
PLN00011323 cysteine synthase 92.88
PRK06450338 threonine synthase; Validated 91.41
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 91.27
PLN02565322 cysteine synthase 90.74
PRK13028402 tryptophan synthase subunit beta; Provisional 89.89
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final 89.75
PLN02356423 phosphateglycerate kinase 89.0
PRK11761296 cysM cysteine synthase B; Provisional 88.14
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 87.06
PRK04346397 tryptophan synthase subunit beta; Validated 86.84
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 85.61
PLN02618410 tryptophan synthase, beta chain 84.65
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 83.15
PLN03013429 cysteine synthase 81.37
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 80.92
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.89  E-value=9.8e-24  Score=174.06  Aligned_cols=77  Identities=35%  Similarity=0.578  Sum_probs=70.4

Q ss_pred             hhhccccCCCcccCCHHHHHHHHHHHHHhCCccchhhhHHHHHHHHHHHHhCCCCCCCCeEEEEecCCcccccccHHH
Q 039995           14 RQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQ   91 (118)
Q Consensus        14 ~~l~~~~g~GYG~~t~e~~~~I~~~a~~eGI~LDPVYTgKa~~gL~~~l~~~g~~~~g~rVLfiHTGGl~glf~~~~~   91 (118)
                      -..+||+++|||+|++|..++|++++++|||+||||||||+|+|++++++ ++.++.+++||||||||+||+|+|.+.
T Consensus       246 ~~~~dy~~~~Yg~p~~e~~e~i~~~~~~eGillDpVYtgKam~Glid~~~-k~~f~~~~~vLfiHtGG~~gl~~y~~~  322 (323)
T COG2515         246 LLSDDYHHPGYGKPNEEDIEAIKLLARLEGILLDPVYTGKAMYGLIDLAR-KGEFPDGSPVLFIHTGGAPGLFAYSPR  322 (323)
T ss_pred             EEEecccCCccCCcCHHHHHHHHHHHHhhCcccccccchHHHHHHHHHHh-cccCCCCCceEEEEcCCccchhccccc
Confidence            35679999999999999999999999999999999999999999997544 578989999999999999999998654

>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1j0a_A325 Crystal Structure Analysis Of The Acc Deaminase Hom 2e-09
4d8t_A342 Crystal Structure Of D-Cysteine Desulfhydrase From 2e-07
4d96_A342 D-Cysteine Desulfhydrase From Salmonella Typhimuriu 2e-07
4d97_A346 Salmonella Typhimurium D-Cysteine Desulfhydrase Wit 2e-07
1rqx_A338 Crystal Structure Of Acc Deaminase Complexed With I 3e-05
>pdb|1J0A|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue Length = 325 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 3/73 (4%)
Query: 24  YAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLL 83
           Y   T E    ++ +    G++LDPVY+GKA YG++ D+A+  K   G K+LF+HTGG+ 
Sbjct: 256 YGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLV-DLAR--KGELGEKILFIHTGGIS 312
Query: 84  GLFDKVDQMAPLL 96
           G F   D++  LL
Sbjct: 313 GTFHYGDKLLSLL 325
>pdb|4D8T|A Chain A, Crystal Structure Of D-Cysteine Desulfhydrase From Salmonella Typhimurium At 2.2 A Resolution Length = 342 Back     alignment and structure
>pdb|4D96|A Chain A, D-Cysteine Desulfhydrase From Salmonella Typhimurium Complexed With 1- Amino-1-Carboxycyclopropane (Acc) Length = 342 Back     alignment and structure
>pdb|4D97|A Chain A, Salmonella Typhimurium D-Cysteine Desulfhydrase With D-Ser Bound At Active Site Length = 346 Back     alignment and structure
>pdb|1RQX|A Chain A, Crystal Structure Of Acc Deaminase Complexed With Inhibitor Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 1e-25
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 1e-24
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 5e-23
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 2e-22
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Length = 325 Back     alignment and structure
 Score = 97.4 bits (242), Expect = 1e-25
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 21  GLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTG 80
              Y   T E    ++ +    G++LDPVY+GKA YG+++   +      G K+LF+HTG
Sbjct: 253 FGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGEL---GEKILFIHTG 309

Query: 81  GLLGLFDKVDQMAPLL 96
           G+ G F   D++  LL
Sbjct: 310 GISGTFHYGDKLLSLL 325
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Length = 338 Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Length = 342 Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Length = 341 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 99.55
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 99.55
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 99.5
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 99.45
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 99.05
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 99.02
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 99.01
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 98.99
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 98.99
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 98.93
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 98.93
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 98.93
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 98.92
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 98.76
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 98.75
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 98.73
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 98.72
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 98.7
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 98.69
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 98.68
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 98.65
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 98.63
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 98.61
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 98.61
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 98.58
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 98.49
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 98.47
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 98.41
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 98.33
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 98.33
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 98.22
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 98.11
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 98.09
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 98.08
1x1q_A418 Tryptophan synthase beta chain; structural genomic 98.02
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 97.96
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; H 97.75
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.68
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 94.2
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 91.63
3v7n_A487 Threonine synthase; ssgcid, structural genomics, s 86.3
4f4f_A468 Threonine synthase; structural genomics, niaid, na 84.13
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
Probab=99.55  E-value=9.5e-15  Score=116.67  Aligned_cols=80  Identities=24%  Similarity=0.338  Sum_probs=70.3

Q ss_pred             hhhhhccccCCCcccCCHHHHHHHHHHHHHhCCccchhhhHHHHHHHHHHHHhCCCCCCCCeEEEEecCCcccccccHHH
Q 039995           12 MTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVDQ   91 (118)
Q Consensus        12 ~~~~l~~~~g~GYG~~t~e~~~~I~~~a~~eGI~LDPVYTgKa~~gL~~~l~~~g~~~~g~rVLfiHTGGl~glf~~~~~   91 (118)
                      .|..++++.+++|+++++|..++++.+++++||++||+|||++++++++ +.+.+.+.++++||+|||||.++++++.+.
T Consensus       257 ~~~~~~~~~~~~~~v~d~e~~~a~~~l~~~egi~~ep~~sa~alaa~~~-~~~~~~~~~~~~Vv~i~tGG~~~~~~~~~~  335 (341)
T 1f2d_A          257 DFTLDTRFAYPCYGVPNEGTIEAIRTCAEQEGVLTDPVYEGKSMQGLIA-LIKEDYFKPGANVLYVHLGGAPALSAYSSF  335 (341)
T ss_dssp             CCCEECTTSTTBTTBCCHHHHHHHHHHHHHHSCCCCTTTHHHHHHHHHH-HHHTTCSCTTCEEEEEECCCGGGGGGGGGG
T ss_pred             eEEEecCcccceEecCCHHHHHHHHHHHHHcCCccccchHHHHHHHHHH-HHHhCCCCCCCeEEEEECCchHHhhhhHHH
Confidence            3456678899999999999999999999999999999999999999997 555556777899999999999999887665


Q ss_pred             h
Q 039995           92 M   92 (118)
Q Consensus        92 ~   92 (118)
                      +
T Consensus       336 ~  336 (341)
T 1f2d_A          336 F  336 (341)
T ss_dssp             C
T ss_pred             h
Confidence            4
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-17
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-16
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 1e-15
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: 1-aminocyclopropane-1-carboxylate deaminase
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 74.3 bits (181), Expect = 1e-17
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 23  GYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGL 82
            Y   T E    ++ +    G++LDPVY+GKA YG+++   +      G K+LF+HTGG+
Sbjct: 255 EYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGEL---GEKILFIHTGGI 311

Query: 83  LGLFDKVDQMAPLL 96
            G F   D++  LL
Sbjct: 312 SGTFHYGDKLLSLL 325
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.8
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.78
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 99.73
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 98.64
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 98.63
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 98.44
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 98.07
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 97.91
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 97.53
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 97.53
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 97.42
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 97.03
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 96.55
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 96.5
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 96.11
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 95.94
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 94.98
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 94.55
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 93.19
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: 1-aminocyclopropane-1-carboxylate deaminase
species: Pseudomonas sp., strain ACP [TaxId: 306]

Probab=99.80  E-value=4e-20  Score=137.08  Aligned_cols=82  Identities=28%  Similarity=0.397  Sum_probs=73.8

Q ss_pred             hhhhhhccccCCCcccCCHHHHHHHHHHHHHhCCccchhhhHHHHHHHHHHHHhCCCCCCCCeEEEEecCCcccccccHH
Q 039995           11 LMTRQPRLSKGLGYAINTSEELNFVKDIAAATGVVLDPVYSGKAAYGMLNDMAQNPKKWEGRKVLFVHTGGLLGLFDKVD   90 (118)
Q Consensus        11 ~~~~~l~~~~g~GYG~~t~e~~~~I~~~a~~eGI~LDPVYTgKa~~gL~~~l~~~g~~~~g~rVLfiHTGGl~glf~~~~   90 (118)
                      ..+..+.++++++|+.+++|.++++++++++|||++||+|||++++++.+ +.+++.++++++||+|||||++|+|+|.+
T Consensus       255 ~~~~~~~~~~~~~~~v~d~ei~~a~~~l~~~eGI~~eP~~s~~a~a~l~~-~~~~~~~~~g~~Vv~i~TGG~~~~~~y~~  333 (338)
T d1tyza_         255 ADVVLDERFAGPEYGLPNEGTLEAIRLCARTEGMLTDPVYEGKSMHGMIE-MVRNGEFPEGSRVLYAHLGGVPALNGYSF  333 (338)
T ss_dssp             GGCEEECTTSCSBTTBCCHHHHHHHHHHHHHHSCCCCTTTHHHHHHHHHH-HHHTTCSCTTCEEEEEECCCGGGGGGGTG
T ss_pred             hhhhhhhhcccceEEEChHHHHHHHHHHHHHhCCcCChHHHHHHHHHHHH-HHhcCCCCCcCeEEEEECCchhhHHHHHH
Confidence            45666778899999999999999999999999999999999999999986 55567888999999999999999999876


Q ss_pred             Hhh
Q 039995           91 QMA   93 (118)
Q Consensus        91 ~~~   93 (118)
                      .++
T Consensus       334 ~~~  336 (338)
T d1tyza_         334 IFR  336 (338)
T ss_dssp             GGT
T ss_pred             HHh
Confidence            654
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure