Citrus Sinensis ID: 040221


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MQSPEDSVPTPRVPAENDGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
cccccccccccccccccccccccEEEEEEEHHHHHHHHcccHHHHHHHccccccccccccEEEEccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHcccHHHHHHHHcccccccccccEEEcc
ccccccccccccccccccccccccEEEEEccHHHEEEccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHccccHHHHHHHccccccEEEEccEEEcc
mqspedsvptprvpaendgsgdgrEAAVAKTAGFVVFSGIAISILKAlnplnknrnettqpqpiaestqpiqpppqqpivtkpsicteksepepascrtveiVRGDTLWGLSRKYGVSIDAIKeanglsgdtiyagkkliip
mqspedsvptprvpaendgsgdGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPiaestqpiqpppqqPIVTKPSICTEksepepascrtveivrgdtlwgLSRKYGVSIDAIkeanglsgdtiyagkkliip
MQSPEDSVPTPRVPAENDGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTqpiqpppqqpiVTKPSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
***************************VAKTAGFVVFSGIAISILKALN***********************************************CRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLI**
***************************VAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQP************************************VEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
*************************AAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSIC***********RTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
**********************GREAAVAKTAGFVVFSGIAISILKALNPLN********************************************CRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSPEDSVPTPRVPAENDGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
P37710737 Autolysin OS=Enterococcus yes no 0.457 0.088 0.462 4e-09
P0C2T5437 Probable N-acetylmuramida N/A no 0.345 0.112 0.530 1e-07
A2RHZ5437 Probable N-acetylmuramida yes no 0.345 0.112 0.530 2e-07
Q01836 467 Probable endopeptidase p6 yes no 0.612 0.186 0.382 2e-07
Q9CIT4439 Probable N-acetylmuramida yes no 0.345 0.111 0.489 2e-07
O34669 287 Cell wall-binding protein yes no 0.316 0.156 0.488 1e-06
P21171 484 Probable endopeptidase p6 yes no 0.619 0.181 0.366 1e-06
Q01837 524 Probable endopeptidase p6 no no 0.380 0.103 0.446 2e-06
Q01839 524 Probable endopeptidase p6 no no 0.366 0.099 0.428 3e-06
P54421 334 Probable peptidoglycan en no no 0.338 0.143 0.479 5e-06
>sp|P37710|ALYS_ENTFA Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_0799 PE=3 SV=2 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 77  QPIVTK--PSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIY 134
           Q I+ K   S     S    AS +   +  GD+LWGLS +YG+SI  IK+ NGLSGDTIY
Sbjct: 670 QTIIVKKGASAGGNASSTNSASGKRHTVKSGDSLWGLSMQYGISIQKIKQLNGLSGDTIY 729

Query: 135 AGKKLII 141
            G+ L +
Sbjct: 730 IGQTLKV 736




Hydrolyzes the cell wall of E.faecalis and M.lysodeikticus. May play an important role in cell wall growth and cell separation.
Enterococcus faecalis (strain ATCC 700802 / V583) (taxid: 226185)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|P0C2T5|ACMA_LACLC Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris GN=acmA PE=3 SV=1 Back     alignment and function description
>sp|A2RHZ5|ACMA_LACLM Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=acmA PE=3 SV=1 Back     alignment and function description
>sp|Q01836|P60_LISIN Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iap PE=3 SV=2 Back     alignment and function description
>sp|Q9CIT4|ACMA_LACLA Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=acmA PE=3 SV=1 Back     alignment and function description
>sp|O34669|YOCH_BACSU Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) GN=yocH PE=1 SV=1 Back     alignment and function description
>sp|P21171|P60_LISMO Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=iap PE=1 SV=2 Back     alignment and function description
>sp|Q01837|P60_LISIV Probable endopeptidase p60 OS=Listeria ivanovii GN=iap PE=3 SV=1 Back     alignment and function description
>sp|Q01839|P60_LISWE Probable endopeptidase p60 OS=Listeria welshimeri GN=iap PE=3 SV=1 Back     alignment and function description
>sp|P54421|LYTE_BACSU Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) GN=lytE PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
225446672133 PREDICTED: probable endopeptidase p60-li 0.823 0.879 0.579 2e-31
42565395132 cell wall hydrolase, partial [Hyacinthus 0.838 0.901 0.475 3e-21
116778927148 unknown [Picea sitchensis] gi|148908768| 0.922 0.885 0.420 4e-21
116791072152 unknown [Picea sitchensis] 0.922 0.861 0.416 8e-21
30214345594 unnamed protein product [Vitis vinifera] 0.654 0.989 0.539 3e-20
116783392150 unknown [Picea sitchensis] 0.816 0.773 0.410 9e-17
302758198161 hypothetical protein SELMODRAFT_438219 [ 0.823 0.726 0.330 8e-09
302758692161 hypothetical protein SELMODRAFT_438100 [ 0.823 0.726 0.314 1e-08
313122909 366 cell wall-associated hydrolase [Lactobac 0.288 0.112 0.634 7e-08
116513351 379 cell wall-associated hydrolase [Lactobac 0.338 0.126 0.562 7e-08
>gi|225446672|ref|XP_002281964.1| PREDICTED: probable endopeptidase p60-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 91/126 (72%), Gaps = 9/126 (7%)

Query: 18  DGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPP-Q 76
           +G G  +EAAVAKTAGF VFSGIA+SILKALN  N N N       + E +QP  P   +
Sbjct: 16  NGEGHSKEAAVAKTAGFFVFSGIAMSILKALNSCN-NDNNKLLTHSVTEPSQPTDPSHSR 74

Query: 77  QPIVTKPSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAG 136
           +PI        ++ E   ++ +T++IV+GDTLWGLSRK+GVSIDAIKEANGL+GDTIYAG
Sbjct: 75  EPIF-------KEKEVRESTQKTIDIVKGDTLWGLSRKHGVSIDAIKEANGLTGDTIYAG 127

Query: 137 KKLIIP 142
           KKL+IP
Sbjct: 128 KKLVIP 133




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|42565395|gb|AAS20972.1| cell wall hydrolase, partial [Hyacinthus orientalis] Back     alignment and taxonomy information
>gi|116778927|gb|ABK21059.1| unknown [Picea sitchensis] gi|148908768|gb|ABR17490.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|116791072|gb|ABK25848.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|302143455|emb|CBI22016.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|116783392|gb|ABK22923.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|302758198|ref|XP_002962522.1| hypothetical protein SELMODRAFT_438219 [Selaginella moellendorffii] gi|300169383|gb|EFJ35985.1| hypothetical protein SELMODRAFT_438219 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302758692|ref|XP_002962769.1| hypothetical protein SELMODRAFT_438100 [Selaginella moellendorffii] gi|300169630|gb|EFJ36232.1| hypothetical protein SELMODRAFT_438100 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|313122909|ref|YP_004033168.1| cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312279472|gb|ADQ60191.1| Cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ND02] Back     alignment and taxonomy information
>gi|116513351|ref|YP_812257.1| cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|116092666|gb|ABJ57819.1| Cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
UNIPROTKB|Q722W8 477 iap "Protein P60" [Listeria mo 0.640 0.190 0.368 1.3e-09
UNIPROTKB|Q81WS5 265 BAS3606 "Putative cell wall hy 0.387 0.207 0.431 1.2e-07
TIGR_CMR|BA_3893 265 BA_3893 "cell wall hydrolase, 0.387 0.207 0.431 1.2e-07
TIGR_CMR|CHY_0674 274 CHY_0674 "putative cell-wall a 0.309 0.160 0.431 2.2e-06
ZFIN|ZDB-GENE-060929-1094 211 lysmd1 "LysM, putative peptido 0.373 0.251 0.446 5.4e-05
UNIPROTKB|Q1JQA8215 LYSMD2 "LysM and putative pept 0.267 0.176 0.538 7e-05
UNIPROTKB|F1MNB9 225 LYSMD1 "LysM and putative pept 0.295 0.186 0.488 0.00014
UNIPROTKB|E2RD13 227 LYSMD1 "Uncharacterized protei 0.295 0.185 0.488 0.00014
UNIPROTKB|F1SSY1 227 LYSMD1 "Uncharacterized protei 0.295 0.185 0.488 0.00014
UNIPROTKB|Q9KV14 581 VC_0344 "N-acetylmuramoyl-L-al 0.295 0.072 0.428 0.00041
UNIPROTKB|Q722W8 iap "Protein P60" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 1.3e-09, Sum P(2) = 1.3e-09
 Identities = 35/95 (36%), Positives = 43/95 (45%)

Query:    50 PLNKNRNETT--QPQPIAESTXXXXXXXXXXXVTKPSICTEKSEPEPASCRTVEIVR-GD 106
             P  + + ETT  Q  P AE T              P +   K  P      T   V+ GD
Sbjct:   150 PTQEVKKETTIQQAAPAAE-TKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGD 208

Query:   107 TLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLII 141
             T+W LS KYGVS+  I   N LS  +IY G+KL I
Sbjct:   209 TIWALSVKYGVSVQDIMSWNNLSSSSIYVGQKLAI 243


GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|Q81WS5 BAS3606 "Putative cell wall hydrolase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3893 BA_3893 "cell wall hydrolase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0674 CHY_0674 "putative cell-wall associated endopeptidase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1094 lysmd1 "LysM, putative peptidoglycan-binding, domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JQA8 LYSMD2 "LysM and putative peptidoglycan-binding domain-containing protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNB9 LYSMD1 "LysM and putative peptidoglycan-binding domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD13 LYSMD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSY1 LYSMD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KV14 VC_0344 "N-acetylmuramoyl-L-alanine amidase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018780001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (128 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
pfam0147643 pfam01476, LysM, LysM domain 4e-15
cd0011845 cd00118, LysM, Lysine Motif is a small domain invo 5e-13
smart0025744 smart00257, LysM, Lysin motif 5e-11
PRK13914 481 PRK13914, PRK13914, invasion associated secreted e 5e-09
COG1388124 COG1388, LytE, FOG: LysM repeat [Cell envelope bio 2e-08
PRK06347592 PRK06347, PRK06347, autolysin; Reviewed 3e-07
PRK13914 481 PRK13914, PRK13914, invasion associated secreted e 5e-07
TIGR0289944 TIGR02899, spore_safA, spore coat assembly protein 6e-06
PRK06347 592 PRK06347, PRK06347, autolysin; Reviewed 1e-05
PRK14125103 PRK14125, PRK14125, cell division suppressor prote 2e-05
PRK06347592 PRK06347, PRK06347, autolysin; Reviewed 3e-05
PRK06347 592 PRK06347, PRK06347, autolysin; Reviewed 1e-04
PRK11198147 PRK11198, PRK11198, LysM domain/BON superfamily pr 6e-04
>gnl|CDD|144899 pfam01476, LysM, LysM domain Back     alignment and domain information
 Score = 64.3 bits (158), Expect = 4e-15
 Identities = 17/41 (41%), Positives = 30/41 (73%)

Query: 102 IVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142
           + +GDTL  ++++YG++++ + E NGLS   +Y G+KL IP
Sbjct: 3   VKKGDTLSSIAKRYGITVEELAELNGLSSPNLYVGQKLKIP 43


The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known. Length = 43

>gnl|CDD|212030 cd00118, LysM, Lysine Motif is a small domain involved in binding peptidoglycan Back     alignment and domain information
>gnl|CDD|197609 smart00257, LysM, Lysin motif Back     alignment and domain information
>gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|224306 COG1388, LytE, FOG: LysM repeat [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed Back     alignment and domain information
>gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|131945 TIGR02899, spore_safA, spore coat assembly protein SafA Back     alignment and domain information
>gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed Back     alignment and domain information
>gnl|CDD|184523 PRK14125, PRK14125, cell division suppressor protein YneA; Provisional Back     alignment and domain information
>gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed Back     alignment and domain information
>gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed Back     alignment and domain information
>gnl|CDD|236880 PRK11198, PRK11198, LysM domain/BON superfamily protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
PRK06347592 autolysin; Reviewed 99.88
PRK10783456 mltD membrane-bound lytic murein transglycosylase 99.84
PRK06347592 autolysin; Reviewed 99.83
PRK13914 481 invasion associated secreted endopeptidase; Provis 99.74
COG1388124 LytE FOG: LysM repeat [Cell envelope biogenesis, o 99.59
PF0147644 LysM: LysM domain; InterPro: IPR018392 This domain 99.58
PRK10783456 mltD membrane-bound lytic murein transglycosylase 99.52
PRK14125103 cell division suppressor protein YneA; Provisional 99.35
TIGR0289944 spore_safA spore coat assembly protein SafA. in wh 99.27
cd0011846 LysM Lysin domain, found in a variety of enzymes i 99.27
TIGR02907338 spore_VI_D stage VI sporulation protein D. SpoVID, 99.26
PRK10871 319 nlpD lipoprotein NlpD; Provisional 99.19
PRK13914 481 invasion associated secreted endopeptidase; Provis 99.1
smart0025744 LysM Lysin motif. 98.97
PF0147644 LysM: LysM domain; InterPro: IPR018392 This domain 98.97
PRK11198147 LysM domain/BON superfamily protein; Provisional 98.88
COG3858 423 Predicted glycosyl hydrolase [General function pre 98.64
PRK14125103 cell division suppressor protein YneA; Provisional 98.52
TIGR0289944 spore_safA spore coat assembly protein SafA. in wh 98.46
cd0011846 LysM Lysin domain, found in a variety of enzymes i 98.46
TIGR02907338 spore_VI_D stage VI sporulation protein D. SpoVID, 98.25
PRK10871 319 nlpD lipoprotein NlpD; Provisional 98.24
PF0422585 OapA: Opacity-associated protein A LysM-like domai 98.09
smart0025744 LysM Lysin motif. 97.97
COG1388124 LytE FOG: LysM repeat [Cell envelope biogenesis, o 97.96
COG1652269 XkdP Uncharacterized protein containing LysM domai 97.91
TIGR0350574 FimV_core FimV N-terminal domain. This region is f 97.84
PRK11198147 LysM domain/BON superfamily protein; Provisional 97.59
PRK10190 310 L,D-transpeptidase; Provisional 97.48
PRK10260 306 L,D-transpeptidase; Provisional 97.48
PF0548960 Phage_tail_X: Phage Tail Protein X; InterPro: IPR0 96.82
PRK11649 439 putative peptidase; Provisional 96.74
COG3170 755 FimV Tfp pilus assembly protein FimV [Cell motilit 96.69
TIGR0350574 FimV_core FimV N-terminal domain. This region is f 95.9
COG3061242 OapA Cell envelope opacity-associated protein A [C 95.86
PRK10190 310 L,D-transpeptidase; Provisional 95.7
PRK10260 306 L,D-transpeptidase; Provisional 95.4
PRK11649 439 putative peptidase; Provisional 93.93
PF0422585 OapA: Opacity-associated protein A LysM-like domai 93.81
COG4784479 Putative Zn-dependent protease [General function p 93.36
COG1652269 XkdP Uncharacterized protein containing LysM domai 92.71
KOG2850 186 consensus Predicted peptidoglycan-binding protein, 92.58
PF1351852 HTH_28: Helix-turn-helix domain 91.72
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 90.34
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 89.1
PF0548960 Phage_tail_X: Phage Tail Protein X; InterPro: IPR0 87.93
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 85.89
COG4254 339 Uncharacterized protein conserved in bacteria [Fun 85.48
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 83.77
PRK09413121 IS2 repressor TnpA; Reviewed 83.07
COG2963116 Transposase and inactivated derivatives [DNA repli 81.21
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 80.33
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 80.16
COG500470 P2-like prophage tail protein X [General function 80.16
>PRK06347 autolysin; Reviewed Back     alignment and domain information
Probab=99.88  E-value=3e-22  Score=166.44  Aligned_cols=115  Identities=23%  Similarity=0.340  Sum_probs=92.8

Q ss_pred             CCccCCCCCCCCHHHHHHHhcccccCCCCHHHHHHhCCCCCCCCCCCCcEEecCCCCCCCCCCCCCccCCCCcccCCCCC
Q 040221           13 VPAENDGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSEP   92 (142)
Q Consensus        13 ~p~~~~~~~~~~~~~iA~~~~~~~~~gvs~~~L~~~N~l~~~~l~~Gq~l~vp~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (142)
                      ....|.+..||+++.||++|      ||++++|++||++..+.|++||.|+||...........  .       ......
T Consensus       478 ~~~~YtVk~GDTL~sIAkky------gVSv~~L~~~N~l~s~~L~~GQ~L~Ip~~~~~s~~~t~--~-------~s~~~~  542 (592)
T PRK06347        478 NAKVYTVAKGDSLWRIANNN------KVTIANLKSWNNLKSDFIYPGQKLKVSAGSTTNNTNTA--K-------PSTNKP  542 (592)
T ss_pred             cceeeeecCCCCHHHHHHHH------CCCHHHHHHhcCCCcccccCCcEEEEecCccccccccc--C-------CccCCc
Confidence            34578999999999999999      99999999999998888999999999976422110000  0       000111


Q ss_pred             CCCCceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221           93 EPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP  142 (142)
Q Consensus        93 ~~~~~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP  142 (142)
                      ......+|+|++|||||.||++||+++++|++||+|..+.|++||.|.|+
T Consensus       543 ~~~~~~~Y~Vk~GDTL~sIA~KygvSv~~L~~~N~L~~~~L~~GQ~L~I~  592 (592)
T PRK06347        543 SNSTVKTYTVKKGDSLWAISRQYKTTVDNIKAWNKLTSNMIHVGQKLTIK  592 (592)
T ss_pred             cCccceeeecCCCCcHHHHHHHhCCCHHHHHHhcCCCcccCCCCCEEecC
Confidence            12346789999999999999999999999999999998889999999986



>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>PRK06347 autolysin; Reviewed Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>COG1388 LytE FOG: LysM repeat [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01476 LysM: LysM domain; InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation [] Back     alignment and domain information
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>PRK14125 cell division suppressor protein YneA; Provisional Back     alignment and domain information
>TIGR02899 spore_safA spore coat assembly protein SafA Back     alignment and domain information
>cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation Back     alignment and domain information
>TIGR02907 spore_VI_D stage VI sporulation protein D Back     alignment and domain information
>PRK10871 nlpD lipoprotein NlpD; Provisional Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>smart00257 LysM Lysin motif Back     alignment and domain information
>PF01476 LysM: LysM domain; InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation [] Back     alignment and domain information
>PRK11198 LysM domain/BON superfamily protein; Provisional Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>PRK14125 cell division suppressor protein YneA; Provisional Back     alignment and domain information
>TIGR02899 spore_safA spore coat assembly protein SafA Back     alignment and domain information
>cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation Back     alignment and domain information
>TIGR02907 spore_VI_D stage VI sporulation protein D Back     alignment and domain information
>PRK10871 nlpD lipoprotein NlpD; Provisional Back     alignment and domain information
>PF04225 OapA: Opacity-associated protein A LysM-like domain; InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein Back     alignment and domain information
>smart00257 LysM Lysin motif Back     alignment and domain information
>COG1388 LytE FOG: LysM repeat [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown] Back     alignment and domain information
>TIGR03505 FimV_core FimV N-terminal domain Back     alignment and domain information
>PRK11198 LysM domain/BON superfamily protein; Provisional Back     alignment and domain information
>PRK10190 L,D-transpeptidase; Provisional Back     alignment and domain information
>PRK10260 L,D-transpeptidase; Provisional Back     alignment and domain information
>PF05489 Phage_tail_X: Phage Tail Protein X; InterPro: IPR008861 This entry is represented by Bacteriophage P2, GpX Back     alignment and domain information
>PRK11649 putative peptidase; Provisional Back     alignment and domain information
>COG3170 FimV Tfp pilus assembly protein FimV [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03505 FimV_core FimV N-terminal domain Back     alignment and domain information
>COG3061 OapA Cell envelope opacity-associated protein A [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10190 L,D-transpeptidase; Provisional Back     alignment and domain information
>PRK10260 L,D-transpeptidase; Provisional Back     alignment and domain information
>PRK11649 putative peptidase; Provisional Back     alignment and domain information
>PF04225 OapA: Opacity-associated protein A LysM-like domain; InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein Back     alignment and domain information
>COG4784 Putative Zn-dependent protease [General function prediction only] Back     alignment and domain information
>COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown] Back     alignment and domain information
>KOG2850 consensus Predicted peptidoglycan-binding protein, contains LysM domain [General function prediction only] Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF05489 Phage_tail_X: Phage Tail Protein X; InterPro: IPR008861 This entry is represented by Bacteriophage P2, GpX Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>COG4254 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>COG5004 P2-like prophage tail protein X [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
2djp_A77 The Solution Structure Of The Lysm Domain Of Human 1e-04
>pdb|2DJP|A Chain A, The Solution Structure Of The Lysm Domain Of Human Hypothetical Protein Sb145 Length = 77 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 105 GDTLWGLSRKYGVSIDAIKEANGL-SGDTIYAGKKLIIP 142 GDTL GL+ KYGV+++ IK AN L + D+I+ K L IP Sbjct: 23 GDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIP 61

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
2djp_A77 Hypothetical protein SB145; LYSM, structural genom 4e-14
2l9y_A167 CVNH-LYSM lectin; carbohydrate, sugar binding prot 3e-12
2l9y_A167 CVNH-LYSM lectin; carbohydrate, sugar binding prot 3e-07
1e0g_A48 Membrane-bound lytic murein transglycosylase D; ce 1e-10
4eby_A212 Chitin elicitor receptor kinase 1; pathogen-associ 1e-07
4eby_A212 Chitin elicitor receptor kinase 1; pathogen-associ 4e-05
4eby_A 212 Chitin elicitor receptor kinase 1; pathogen-associ 6e-04
1y7m_A 164 Hypothetical protein BSU14040; surface mutagenesis 6e-05
>2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
 Score = 62.1 bits (151), Expect = 4e-14
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 90  SEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGL-SGDTIYAGKKLIIP 142
             P        ++  GDTL GL+ KYGV+++ IK AN L + D+I+  K L IP
Sbjct: 8   CSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIP 61


>2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Length = 167 Back     alignment and structure
>2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Length = 167 Back     alignment and structure
>1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 Length = 48 Back     alignment and structure
>4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 Back     alignment and structure
>4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 Back     alignment and structure
>4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 Back     alignment and structure
>1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1 Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
4eby_A212 Chitin elicitor receptor kinase 1; pathogen-associ 99.87
4eby_A212 Chitin elicitor receptor kinase 1; pathogen-associ 99.86
2djp_A77 Hypothetical protein SB145; LYSM, structural genom 99.59
1e0g_A48 Membrane-bound lytic murein transglycosylase D; ce 99.55
2gu1_A 361 Zinc peptidase; alpha/beta, beta barrel, structura 99.47
2l9y_A167 CVNH-LYSM lectin; carbohydrate, sugar binding prot 99.45
2l9y_A167 CVNH-LYSM lectin; carbohydrate, sugar binding prot 99.45
1e0g_A48 Membrane-bound lytic murein transglycosylase D; ce 98.84
2gu1_A 361 Zinc peptidase; alpha/beta, beta barrel, structura 98.82
2djp_A77 Hypothetical protein SB145; LYSM, structural genom 98.81
4a1k_A165 Putative L, D-transpeptidase YKUD; transferase, pe 97.94
3slu_A 371 M23 peptidase domain protein; outer membrane, hydr 97.65
3slu_A 371 M23 peptidase domain protein; outer membrane, hydr 97.07
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 87.78
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 85.25
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 84.85
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 84.27
2jrt_A95 Uncharacterized protein; solution, structure, NESG 83.4
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 81.6
>4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Back     alignment and structure
Probab=99.87  E-value=5.1e-22  Score=146.32  Aligned_cols=106  Identities=16%  Similarity=0.103  Sum_probs=86.3

Q ss_pred             ccCCCCCCCCHHHHH-HHhcccccCC--CCHHHHHHhCCCCCCCCCCCCcEEecCCCCCCCCCCCCCccCCCCcccCCCC
Q 040221           15 AENDGSGDGREAAVA-KTAGFVVFSG--IAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSE   91 (142)
Q Consensus        15 ~~~~~~~~~~~~~iA-~~~~~~~~~g--vs~~~L~~~N~l~~~~l~~Gq~l~vp~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (142)
                      ..|+++.|||++.|| ++|      +  +++++|+++|++..+.|.+||.|.||..+.+...               ...
T Consensus        79 ~~Y~V~~GDTL~~IA~~~y------~~lvt~~~L~~~N~~~~~~l~~Gq~L~IP~~~~~~~~---------------~~~  137 (212)
T 4eby_A           79 FSYSVRQEDTYERVAISNY------ANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDE---------------SVS  137 (212)
T ss_dssp             EEEECCTTCCHHHHHHTTT------TTSSCHHHHHHHCCSCTTCCCTTCEEEEEEECCCCCT---------------TTC
T ss_pred             eEEEecCCCcHHHHHHHhc------CCCCCHHHHHHhcCCCcccCCCCCEEEEcCCCcCCCc---------------ccc
Confidence            568899999999999 799      9  9999999999977789999999999976532110               000


Q ss_pred             CCCCCceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221           92 PEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP  142 (142)
Q Consensus        92 ~~~~~~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP  142 (142)
                      .......+|+|++|||||.||++||+++++|++||++.+..+..|+ |.||
T Consensus       138 ~~~~~~~~Y~V~~GDTL~~IA~~fgvsv~~L~~~N~~~~~~~~~g~-l~IP  187 (212)
T 4eby_A          138 KDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGI-VYVP  187 (212)
T ss_dssp             SSCCCEEEEECCTTCCHHHHHHHHTSCHHHHHHHSTTCCTTSCSSE-EEEE
T ss_pred             cCCCCeEEEEECCCCcHHHHHHHHCcCHHHHHHhcCCCccCCCCCE-EEec
Confidence            1123347899999999999999999999999999988766566665 8887



>4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Back     alignment and structure
>2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 Back     alignment and structure
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Back     alignment and structure
>2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Back     alignment and structure
>1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 Back     alignment and structure
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a1k_A Putative L, D-transpeptidase YKUD; transferase, peptidoglycan synthesis; HET: CME; 1.75A {Bacillus subtilis} PDB: 4a1j_A 4a1i_A* 1y7m_A 3zqd_A 4a52_A* Back     alignment and structure
>3slu_A M23 peptidase domain protein; outer membrane, hydrolase; 2.41A {Neisseria meningitidis} Back     alignment and structure
>3slu_A M23 peptidase domain protein; outer membrane, hydrolase; 2.41A {Neisseria meningitidis} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1e0ga_48 d.7.1.1 (A:) Membrane-bound lytic murein transclyc 2e-13
d1y7ma248 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-term 5e-12
>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} Length = 48 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LysM domain
superfamily: LysM domain
family: LysM domain
domain: Membrane-bound lytic murein transclycosylase D, MltD
species: Escherichia coli [TaxId: 562]
 Score = 58.5 bits (142), Expect = 2e-13
 Identities = 11/44 (25%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 99  TVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142
           T  + +GD+L  +++++GV+I  +   N  +   +  G KL + 
Sbjct: 4   TYRVRKGDSLSSIAKRHGVNIKDVMRWNSDT-ANLQPGDKLTLF 46


>d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 48 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1e0ga_48 Membrane-bound lytic murein transclycosylase D, Ml 99.7
d1y7ma248 Hypothetical protein YkuD, N-terminal domain {Baci 99.67
d1y7ma248 Hypothetical protein YkuD, N-terminal domain {Baci 99.15
d1e0ga_48 Membrane-bound lytic murein transclycosylase D, Ml 99.14
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 93.82
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 85.57
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 81.13
>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LysM domain
superfamily: LysM domain
family: LysM domain
domain: Membrane-bound lytic murein transclycosylase D, MltD
species: Escherichia coli [TaxId: 562]
Probab=99.70  E-value=7.2e-18  Score=94.79  Aligned_cols=45  Identities=24%  Similarity=0.406  Sum_probs=41.9

Q ss_pred             ceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221           97 CRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP  142 (142)
Q Consensus        97 ~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP  142 (142)
                      ..+|+|++|||||.||++||+++++|++||++.+ .|++||+|.||
T Consensus         2 ~v~y~V~~GDTl~~IA~~y~vs~~~i~~~N~l~~-~l~~Gq~L~i~   46 (48)
T d1e0ga_           2 SITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTA-NLQPGDKLTLF   46 (48)
T ss_dssp             CCEEEECTTCCHHHHHHHHTCCHHHHHHHCSCGG-GCCTTEEEECC
T ss_pred             cEEEEECCCCCHHHHHHHHCCCHHHHHHHcCCcc-cCcCCCEEEEE
Confidence            3589999999999999999999999999999864 69999999997



>d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure