Citrus Sinensis ID: 040221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 225446672 | 133 | PREDICTED: probable endopeptidase p60-li | 0.823 | 0.879 | 0.579 | 2e-31 | |
| 42565395 | 132 | cell wall hydrolase, partial [Hyacinthus | 0.838 | 0.901 | 0.475 | 3e-21 | |
| 116778927 | 148 | unknown [Picea sitchensis] gi|148908768| | 0.922 | 0.885 | 0.420 | 4e-21 | |
| 116791072 | 152 | unknown [Picea sitchensis] | 0.922 | 0.861 | 0.416 | 8e-21 | |
| 302143455 | 94 | unnamed protein product [Vitis vinifera] | 0.654 | 0.989 | 0.539 | 3e-20 | |
| 116783392 | 150 | unknown [Picea sitchensis] | 0.816 | 0.773 | 0.410 | 9e-17 | |
| 302758198 | 161 | hypothetical protein SELMODRAFT_438219 [ | 0.823 | 0.726 | 0.330 | 8e-09 | |
| 302758692 | 161 | hypothetical protein SELMODRAFT_438100 [ | 0.823 | 0.726 | 0.314 | 1e-08 | |
| 313122909 | 366 | cell wall-associated hydrolase [Lactobac | 0.288 | 0.112 | 0.634 | 7e-08 | |
| 116513351 | 379 | cell wall-associated hydrolase [Lactobac | 0.338 | 0.126 | 0.562 | 7e-08 |
| >gi|225446672|ref|XP_002281964.1| PREDICTED: probable endopeptidase p60-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 140 bits (353), Expect = 2e-31, Method: Compositional matrix adjust.
Identities = 73/126 (57%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
Query: 18 DGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPP-Q 76
+G G +EAAVAKTAGF VFSGIA+SILKALN N N N + E +QP P +
Sbjct: 16 NGEGHSKEAAVAKTAGFFVFSGIAMSILKALNSCN-NDNNKLLTHSVTEPSQPTDPSHSR 74
Query: 77 QPIVTKPSICTEKSEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAG 136
+PI ++ E ++ +T++IV+GDTLWGLSRK+GVSIDAIKEANGL+GDTIYAG
Sbjct: 75 EPIF-------KEKEVRESTQKTIDIVKGDTLWGLSRKHGVSIDAIKEANGLTGDTIYAG 127
Query: 137 KKLIIP 142
KKL+IP
Sbjct: 128 KKLVIP 133
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|42565395|gb|AAS20972.1| cell wall hydrolase, partial [Hyacinthus orientalis] | Back alignment and taxonomy information |
|---|
| >gi|116778927|gb|ABK21059.1| unknown [Picea sitchensis] gi|148908768|gb|ABR17490.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|116791072|gb|ABK25848.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|302143455|emb|CBI22016.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|116783392|gb|ABK22923.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|302758198|ref|XP_002962522.1| hypothetical protein SELMODRAFT_438219 [Selaginella moellendorffii] gi|300169383|gb|EFJ35985.1| hypothetical protein SELMODRAFT_438219 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302758692|ref|XP_002962769.1| hypothetical protein SELMODRAFT_438100 [Selaginella moellendorffii] gi|300169630|gb|EFJ36232.1| hypothetical protein SELMODRAFT_438100 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|313122909|ref|YP_004033168.1| cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312279472|gb|ADQ60191.1| Cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ND02] | Back alignment and taxonomy information |
|---|
| >gi|116513351|ref|YP_812257.1| cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|116092666|gb|ABJ57819.1| Cell wall-associated hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| UNIPROTKB|Q722W8 | 477 | iap "Protein P60" [Listeria mo | 0.640 | 0.190 | 0.368 | 1.3e-09 | |
| UNIPROTKB|Q81WS5 | 265 | BAS3606 "Putative cell wall hy | 0.387 | 0.207 | 0.431 | 1.2e-07 | |
| TIGR_CMR|BA_3893 | 265 | BA_3893 "cell wall hydrolase, | 0.387 | 0.207 | 0.431 | 1.2e-07 | |
| TIGR_CMR|CHY_0674 | 274 | CHY_0674 "putative cell-wall a | 0.309 | 0.160 | 0.431 | 2.2e-06 | |
| ZFIN|ZDB-GENE-060929-1094 | 211 | lysmd1 "LysM, putative peptido | 0.373 | 0.251 | 0.446 | 5.4e-05 | |
| UNIPROTKB|Q1JQA8 | 215 | LYSMD2 "LysM and putative pept | 0.267 | 0.176 | 0.538 | 7e-05 | |
| UNIPROTKB|F1MNB9 | 225 | LYSMD1 "LysM and putative pept | 0.295 | 0.186 | 0.488 | 0.00014 | |
| UNIPROTKB|E2RD13 | 227 | LYSMD1 "Uncharacterized protei | 0.295 | 0.185 | 0.488 | 0.00014 | |
| UNIPROTKB|F1SSY1 | 227 | LYSMD1 "Uncharacterized protei | 0.295 | 0.185 | 0.488 | 0.00014 | |
| UNIPROTKB|Q9KV14 | 581 | VC_0344 "N-acetylmuramoyl-L-al | 0.295 | 0.072 | 0.428 | 0.00041 |
| UNIPROTKB|Q722W8 iap "Protein P60" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] | Back alignment and assigned GO terms |
|---|
Score = 133 (51.9 bits), Expect = 1.3e-09, Sum P(2) = 1.3e-09
Identities = 35/95 (36%), Positives = 43/95 (45%)
Query: 50 PLNKNRNETT--QPQPIAESTXXXXXXXXXXXVTKPSICTEKSEPEPASCRTVEIVR-GD 106
P + + ETT Q P AE T P + K P T V+ GD
Sbjct: 150 PTQEVKKETTIQQAAPAAE-TKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGD 208
Query: 107 TLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLII 141
T+W LS KYGVS+ I N LS +IY G+KL I
Sbjct: 209 TIWALSVKYGVSVQDIMSWNNLSSSSIYVGQKLAI 243
|
|
| UNIPROTKB|Q81WS5 BAS3606 "Putative cell wall hydrolase" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3893 BA_3893 "cell wall hydrolase, putative" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0674 CHY_0674 "putative cell-wall associated endopeptidase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-1094 lysmd1 "LysM, putative peptidoglycan-binding, domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1JQA8 LYSMD2 "LysM and putative peptidoglycan-binding domain-containing protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MNB9 LYSMD1 "LysM and putative peptidoglycan-binding domain-containing protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RD13 LYSMD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSY1 LYSMD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KV14 VC_0344 "N-acetylmuramoyl-L-alanine amidase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00018780001 | SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (128 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| pfam01476 | 43 | pfam01476, LysM, LysM domain | 4e-15 | |
| cd00118 | 45 | cd00118, LysM, Lysine Motif is a small domain invo | 5e-13 | |
| smart00257 | 44 | smart00257, LysM, Lysin motif | 5e-11 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 5e-09 | |
| COG1388 | 124 | COG1388, LytE, FOG: LysM repeat [Cell envelope bio | 2e-08 | |
| PRK06347 | 592 | PRK06347, PRK06347, autolysin; Reviewed | 3e-07 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 5e-07 | |
| TIGR02899 | 44 | TIGR02899, spore_safA, spore coat assembly protein | 6e-06 | |
| PRK06347 | 592 | PRK06347, PRK06347, autolysin; Reviewed | 1e-05 | |
| PRK14125 | 103 | PRK14125, PRK14125, cell division suppressor prote | 2e-05 | |
| PRK06347 | 592 | PRK06347, PRK06347, autolysin; Reviewed | 3e-05 | |
| PRK06347 | 592 | PRK06347, PRK06347, autolysin; Reviewed | 1e-04 | |
| PRK11198 | 147 | PRK11198, PRK11198, LysM domain/BON superfamily pr | 6e-04 |
| >gnl|CDD|144899 pfam01476, LysM, LysM domain | Back alignment and domain information |
|---|
Score = 64.3 bits (158), Expect = 4e-15
Identities = 17/41 (41%), Positives = 30/41 (73%)
Query: 102 IVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142
+ +GDTL ++++YG++++ + E NGLS +Y G+KL IP
Sbjct: 3 VKKGDTLSSIAKRYGITVEELAELNGLSSPNLYVGQKLKIP 43
|
The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known. Length = 43 |
| >gnl|CDD|212030 cd00118, LysM, Lysine Motif is a small domain involved in binding peptidoglycan | Back alignment and domain information |
|---|
| >gnl|CDD|197609 smart00257, LysM, Lysin motif | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224306 COG1388, LytE, FOG: LysM repeat [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131945 TIGR02899, spore_safA, spore coat assembly protein SafA | Back alignment and domain information |
|---|
| >gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184523 PRK14125, PRK14125, cell division suppressor protein YneA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180536 PRK06347, PRK06347, autolysin; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236880 PRK11198, PRK11198, LysM domain/BON superfamily protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| PRK06347 | 592 | autolysin; Reviewed | 99.88 | |
| PRK10783 | 456 | mltD membrane-bound lytic murein transglycosylase | 99.84 | |
| PRK06347 | 592 | autolysin; Reviewed | 99.83 | |
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 99.74 | |
| COG1388 | 124 | LytE FOG: LysM repeat [Cell envelope biogenesis, o | 99.59 | |
| PF01476 | 44 | LysM: LysM domain; InterPro: IPR018392 This domain | 99.58 | |
| PRK10783 | 456 | mltD membrane-bound lytic murein transglycosylase | 99.52 | |
| PRK14125 | 103 | cell division suppressor protein YneA; Provisional | 99.35 | |
| TIGR02899 | 44 | spore_safA spore coat assembly protein SafA. in wh | 99.27 | |
| cd00118 | 46 | LysM Lysin domain, found in a variety of enzymes i | 99.27 | |
| TIGR02907 | 338 | spore_VI_D stage VI sporulation protein D. SpoVID, | 99.26 | |
| PRK10871 | 319 | nlpD lipoprotein NlpD; Provisional | 99.19 | |
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 99.1 | |
| smart00257 | 44 | LysM Lysin motif. | 98.97 | |
| PF01476 | 44 | LysM: LysM domain; InterPro: IPR018392 This domain | 98.97 | |
| PRK11198 | 147 | LysM domain/BON superfamily protein; Provisional | 98.88 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 98.64 | |
| PRK14125 | 103 | cell division suppressor protein YneA; Provisional | 98.52 | |
| TIGR02899 | 44 | spore_safA spore coat assembly protein SafA. in wh | 98.46 | |
| cd00118 | 46 | LysM Lysin domain, found in a variety of enzymes i | 98.46 | |
| TIGR02907 | 338 | spore_VI_D stage VI sporulation protein D. SpoVID, | 98.25 | |
| PRK10871 | 319 | nlpD lipoprotein NlpD; Provisional | 98.24 | |
| PF04225 | 85 | OapA: Opacity-associated protein A LysM-like domai | 98.09 | |
| smart00257 | 44 | LysM Lysin motif. | 97.97 | |
| COG1388 | 124 | LytE FOG: LysM repeat [Cell envelope biogenesis, o | 97.96 | |
| COG1652 | 269 | XkdP Uncharacterized protein containing LysM domai | 97.91 | |
| TIGR03505 | 74 | FimV_core FimV N-terminal domain. This region is f | 97.84 | |
| PRK11198 | 147 | LysM domain/BON superfamily protein; Provisional | 97.59 | |
| PRK10190 | 310 | L,D-transpeptidase; Provisional | 97.48 | |
| PRK10260 | 306 | L,D-transpeptidase; Provisional | 97.48 | |
| PF05489 | 60 | Phage_tail_X: Phage Tail Protein X; InterPro: IPR0 | 96.82 | |
| PRK11649 | 439 | putative peptidase; Provisional | 96.74 | |
| COG3170 | 755 | FimV Tfp pilus assembly protein FimV [Cell motilit | 96.69 | |
| TIGR03505 | 74 | FimV_core FimV N-terminal domain. This region is f | 95.9 | |
| COG3061 | 242 | OapA Cell envelope opacity-associated protein A [C | 95.86 | |
| PRK10190 | 310 | L,D-transpeptidase; Provisional | 95.7 | |
| PRK10260 | 306 | L,D-transpeptidase; Provisional | 95.4 | |
| PRK11649 | 439 | putative peptidase; Provisional | 93.93 | |
| PF04225 | 85 | OapA: Opacity-associated protein A LysM-like domai | 93.81 | |
| COG4784 | 479 | Putative Zn-dependent protease [General function p | 93.36 | |
| COG1652 | 269 | XkdP Uncharacterized protein containing LysM domai | 92.71 | |
| KOG2850 | 186 | consensus Predicted peptidoglycan-binding protein, | 92.58 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 91.72 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 90.34 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 89.1 | |
| PF05489 | 60 | Phage_tail_X: Phage Tail Protein X; InterPro: IPR0 | 87.93 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 85.89 | |
| COG4254 | 339 | Uncharacterized protein conserved in bacteria [Fun | 85.48 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 83.77 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 83.07 | |
| COG2963 | 116 | Transposase and inactivated derivatives [DNA repli | 81.21 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 80.33 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 80.16 | |
| COG5004 | 70 | P2-like prophage tail protein X [General function | 80.16 |
| >PRK06347 autolysin; Reviewed | Back alignment and domain information |
|---|
Probab=99.88 E-value=3e-22 Score=166.44 Aligned_cols=115 Identities=23% Similarity=0.340 Sum_probs=92.8
Q ss_pred CCccCCCCCCCCHHHHHHHhcccccCCCCHHHHHHhCCCCCCCCCCCCcEEecCCCCCCCCCCCCCccCCCCcccCCCCC
Q 040221 13 VPAENDGSGDGREAAVAKTAGFVVFSGIAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSEP 92 (142)
Q Consensus 13 ~p~~~~~~~~~~~~~iA~~~~~~~~~gvs~~~L~~~N~l~~~~l~~Gq~l~vp~~~~~~~~~~~~~~~~~~~~~~~~~~~ 92 (142)
....|.+..||+++.||++| ||++++|++||++..+.|++||.|+||........... . ......
T Consensus 478 ~~~~YtVk~GDTL~sIAkky------gVSv~~L~~~N~l~s~~L~~GQ~L~Ip~~~~~s~~~t~--~-------~s~~~~ 542 (592)
T PRK06347 478 NAKVYTVAKGDSLWRIANNN------KVTIANLKSWNNLKSDFIYPGQKLKVSAGSTTNNTNTA--K-------PSTNKP 542 (592)
T ss_pred cceeeeecCCCCHHHHHHHH------CCCHHHHHHhcCCCcccccCCcEEEEecCccccccccc--C-------CccCCc
Confidence 34578999999999999999 99999999999998888999999999976422110000 0 000111
Q ss_pred CCCCceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221 93 EPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142 (142)
Q Consensus 93 ~~~~~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP 142 (142)
......+|+|++|||||.||++||+++++|++||+|..+.|++||.|.|+
T Consensus 543 ~~~~~~~Y~Vk~GDTL~sIA~KygvSv~~L~~~N~L~~~~L~~GQ~L~I~ 592 (592)
T PRK06347 543 SNSTVKTYTVKKGDSLWAISRQYKTTVDNIKAWNKLTSNMIHVGQKLTIK 592 (592)
T ss_pred cCccceeeecCCCCcHHHHHHHhCCCHHHHHHhcCCCcccCCCCCEEecC
Confidence 12346789999999999999999999999999999998889999999986
|
|
| >PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional | Back alignment and domain information |
|---|
| >PRK06347 autolysin; Reviewed | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >COG1388 LytE FOG: LysM repeat [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF01476 LysM: LysM domain; InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation [] | Back alignment and domain information |
|---|
| >PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional | Back alignment and domain information |
|---|
| >PRK14125 cell division suppressor protein YneA; Provisional | Back alignment and domain information |
|---|
| >TIGR02899 spore_safA spore coat assembly protein SafA | Back alignment and domain information |
|---|
| >cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation | Back alignment and domain information |
|---|
| >TIGR02907 spore_VI_D stage VI sporulation protein D | Back alignment and domain information |
|---|
| >PRK10871 nlpD lipoprotein NlpD; Provisional | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >smart00257 LysM Lysin motif | Back alignment and domain information |
|---|
| >PF01476 LysM: LysM domain; InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation [] | Back alignment and domain information |
|---|
| >PRK11198 LysM domain/BON superfamily protein; Provisional | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14125 cell division suppressor protein YneA; Provisional | Back alignment and domain information |
|---|
| >TIGR02899 spore_safA spore coat assembly protein SafA | Back alignment and domain information |
|---|
| >cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation | Back alignment and domain information |
|---|
| >TIGR02907 spore_VI_D stage VI sporulation protein D | Back alignment and domain information |
|---|
| >PRK10871 nlpD lipoprotein NlpD; Provisional | Back alignment and domain information |
|---|
| >PF04225 OapA: Opacity-associated protein A LysM-like domain; InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein | Back alignment and domain information |
|---|
| >smart00257 LysM Lysin motif | Back alignment and domain information |
|---|
| >COG1388 LytE FOG: LysM repeat [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03505 FimV_core FimV N-terminal domain | Back alignment and domain information |
|---|
| >PRK11198 LysM domain/BON superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK10190 L,D-transpeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK10260 L,D-transpeptidase; Provisional | Back alignment and domain information |
|---|
| >PF05489 Phage_tail_X: Phage Tail Protein X; InterPro: IPR008861 This entry is represented by Bacteriophage P2, GpX | Back alignment and domain information |
|---|
| >PRK11649 putative peptidase; Provisional | Back alignment and domain information |
|---|
| >COG3170 FimV Tfp pilus assembly protein FimV [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03505 FimV_core FimV N-terminal domain | Back alignment and domain information |
|---|
| >COG3061 OapA Cell envelope opacity-associated protein A [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10190 L,D-transpeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK10260 L,D-transpeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK11649 putative peptidase; Provisional | Back alignment and domain information |
|---|
| >PF04225 OapA: Opacity-associated protein A LysM-like domain; InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein | Back alignment and domain information |
|---|
| >COG4784 Putative Zn-dependent protease [General function prediction only] | Back alignment and domain information |
|---|
| >COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2850 consensus Predicted peptidoglycan-binding protein, contains LysM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PF05489 Phage_tail_X: Phage Tail Protein X; InterPro: IPR008861 This entry is represented by Bacteriophage P2, GpX | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >COG4254 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >COG5004 P2-like prophage tail protein X [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 142 | ||||
| 2djp_A | 77 | The Solution Structure Of The Lysm Domain Of Human | 1e-04 |
| >pdb|2DJP|A Chain A, The Solution Structure Of The Lysm Domain Of Human Hypothetical Protein Sb145 Length = 77 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 2djp_A | 77 | Hypothetical protein SB145; LYSM, structural genom | 4e-14 | |
| 2l9y_A | 167 | CVNH-LYSM lectin; carbohydrate, sugar binding prot | 3e-12 | |
| 2l9y_A | 167 | CVNH-LYSM lectin; carbohydrate, sugar binding prot | 3e-07 | |
| 1e0g_A | 48 | Membrane-bound lytic murein transglycosylase D; ce | 1e-10 | |
| 4eby_A | 212 | Chitin elicitor receptor kinase 1; pathogen-associ | 1e-07 | |
| 4eby_A | 212 | Chitin elicitor receptor kinase 1; pathogen-associ | 4e-05 | |
| 4eby_A | 212 | Chitin elicitor receptor kinase 1; pathogen-associ | 6e-04 | |
| 1y7m_A | 164 | Hypothetical protein BSU14040; surface mutagenesis | 6e-05 |
| >2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
Score = 62.1 bits (151), Expect = 4e-14
Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
Query: 90 SEPEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGL-SGDTIYAGKKLIIP 142
P ++ GDTL GL+ KYGV+++ IK AN L + D+I+ K L IP
Sbjct: 8 CSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIP 61
|
| >2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Length = 167 | Back alignment and structure |
|---|
| >2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} Length = 167 | Back alignment and structure |
|---|
| >1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 Length = 48 | Back alignment and structure |
|---|
| >4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 | Back alignment and structure |
|---|
| >4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 | Back alignment and structure |
|---|
| >4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* Length = 212 | Back alignment and structure |
|---|
| >1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1 Length = 164 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 4eby_A | 212 | Chitin elicitor receptor kinase 1; pathogen-associ | 99.87 | |
| 4eby_A | 212 | Chitin elicitor receptor kinase 1; pathogen-associ | 99.86 | |
| 2djp_A | 77 | Hypothetical protein SB145; LYSM, structural genom | 99.59 | |
| 1e0g_A | 48 | Membrane-bound lytic murein transglycosylase D; ce | 99.55 | |
| 2gu1_A | 361 | Zinc peptidase; alpha/beta, beta barrel, structura | 99.47 | |
| 2l9y_A | 167 | CVNH-LYSM lectin; carbohydrate, sugar binding prot | 99.45 | |
| 2l9y_A | 167 | CVNH-LYSM lectin; carbohydrate, sugar binding prot | 99.45 | |
| 1e0g_A | 48 | Membrane-bound lytic murein transglycosylase D; ce | 98.84 | |
| 2gu1_A | 361 | Zinc peptidase; alpha/beta, beta barrel, structura | 98.82 | |
| 2djp_A | 77 | Hypothetical protein SB145; LYSM, structural genom | 98.81 | |
| 4a1k_A | 165 | Putative L, D-transpeptidase YKUD; transferase, pe | 97.94 | |
| 3slu_A | 371 | M23 peptidase domain protein; outer membrane, hydr | 97.65 | |
| 3slu_A | 371 | M23 peptidase domain protein; outer membrane, hydr | 97.07 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 87.78 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 85.25 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 84.85 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 84.27 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 83.4 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 81.6 |
| >4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* | Back alignment and structure |
|---|
Probab=99.87 E-value=5.1e-22 Score=146.32 Aligned_cols=106 Identities=16% Similarity=0.103 Sum_probs=86.3
Q ss_pred ccCCCCCCCCHHHHH-HHhcccccCC--CCHHHHHHhCCCCCCCCCCCCcEEecCCCCCCCCCCCCCccCCCCcccCCCC
Q 040221 15 AENDGSGDGREAAVA-KTAGFVVFSG--IAISILKALNPLNKNRNETTQPQPIAESTQPIQPPPQQPIVTKPSICTEKSE 91 (142)
Q Consensus 15 ~~~~~~~~~~~~~iA-~~~~~~~~~g--vs~~~L~~~N~l~~~~l~~Gq~l~vp~~~~~~~~~~~~~~~~~~~~~~~~~~ 91 (142)
..|+++.|||++.|| ++| + +++++|+++|++..+.|.+||.|.||..+.+... ...
T Consensus 79 ~~Y~V~~GDTL~~IA~~~y------~~lvt~~~L~~~N~~~~~~l~~Gq~L~IP~~~~~~~~---------------~~~ 137 (212)
T 4eby_A 79 FSYSVRQEDTYERVAISNY------ANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDE---------------SVS 137 (212)
T ss_dssp EEEECCTTCCHHHHHHTTT------TTSSCHHHHHHHCCSCTTCCCTTCEEEEEEECCCCCT---------------TTC
T ss_pred eEEEecCCCcHHHHHHHhc------CCCCCHHHHHHhcCCCcccCCCCCEEEEcCCCcCCCc---------------ccc
Confidence 568899999999999 799 9 9999999999977789999999999976532110 000
Q ss_pred CCCCCceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221 92 PEPASCRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142 (142)
Q Consensus 92 ~~~~~~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP 142 (142)
.......+|+|++|||||.||++||+++++|++||++.+..+..|+ |.||
T Consensus 138 ~~~~~~~~Y~V~~GDTL~~IA~~fgvsv~~L~~~N~~~~~~~~~g~-l~IP 187 (212)
T 4eby_A 138 KDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGI-VYVP 187 (212)
T ss_dssp SSCCCEEEEECCTTCCHHHHHHHHTSCHHHHHHHSTTCCTTSCSSE-EEEE
T ss_pred cCCCCeEEEEECCCCcHHHHHHHHCcCHHHHHHhcCCCccCCCCCE-EEec
Confidence 1123347899999999999999999999999999988766566665 8887
|
| >4eby_A Chitin elicitor receptor kinase 1; pathogen-associated molecular patterns, pattern recognition receptors, LYSM, lysine chitin oligomer; HET: NAG BMA; 1.65A {Arabidopsis thaliana} PDB: 4ebz_A* | Back alignment and structure |
|---|
| >2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 | Back alignment and structure |
|---|
| >2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >2l9y_A CVNH-LYSM lectin; carbohydrate, sugar binding protein; NMR {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >1e0g_A Membrane-bound lytic murein transglycosylase D; cell WALL, hydrolase, glycosidase, lipoprotein, outer membrane, multigene family; NMR {Escherichia coli} SCOP: d.7.1.1 | Back alignment and structure |
|---|
| >2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2djp_A Hypothetical protein SB145; LYSM, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a1k_A Putative L, D-transpeptidase YKUD; transferase, peptidoglycan synthesis; HET: CME; 1.75A {Bacillus subtilis} PDB: 4a1j_A 4a1i_A* 1y7m_A 3zqd_A 4a52_A* | Back alignment and structure |
|---|
| >3slu_A M23 peptidase domain protein; outer membrane, hydrolase; 2.41A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3slu_A M23 peptidase domain protein; outer membrane, hydrolase; 2.41A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1e0ga_ | 48 | d.7.1.1 (A:) Membrane-bound lytic murein transclyc | 2e-13 | |
| d1y7ma2 | 48 | d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-term | 5e-12 |
| >d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} Length = 48 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LysM domain superfamily: LysM domain family: LysM domain domain: Membrane-bound lytic murein transclycosylase D, MltD species: Escherichia coli [TaxId: 562]
Score = 58.5 bits (142), Expect = 2e-13
Identities = 11/44 (25%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Query: 99 TVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142
T + +GD+L +++++GV+I + N + + G KL +
Sbjct: 4 TYRVRKGDSLSSIAKRHGVNIKDVMRWNSDT-ANLQPGDKLTLF 46
|
| >d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 48 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d1e0ga_ | 48 | Membrane-bound lytic murein transclycosylase D, Ml | 99.7 | |
| d1y7ma2 | 48 | Hypothetical protein YkuD, N-terminal domain {Baci | 99.67 | |
| d1y7ma2 | 48 | Hypothetical protein YkuD, N-terminal domain {Baci | 99.15 | |
| d1e0ga_ | 48 | Membrane-bound lytic murein transclycosylase D, Ml | 99.14 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 93.82 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 85.57 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 81.13 |
| >d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LysM domain superfamily: LysM domain family: LysM domain domain: Membrane-bound lytic murein transclycosylase D, MltD species: Escherichia coli [TaxId: 562]
Probab=99.70 E-value=7.2e-18 Score=94.79 Aligned_cols=45 Identities=24% Similarity=0.406 Sum_probs=41.9
Q ss_pred ceEEEecCCCcHHHHHHHhCCCHHHHHHHhCCCCCCCCCCCEEecC
Q 040221 97 CRTVEIVRGDTLWGLSRKYGVSIDAIKEANGLSGDTIYAGKKLIIP 142 (142)
Q Consensus 97 ~~~y~V~~GDTl~~IA~rygvs~~~L~~~N~l~~~~l~~Gq~L~IP 142 (142)
..+|+|++|||||.||++||+++++|++||++.+ .|++||+|.||
T Consensus 2 ~v~y~V~~GDTl~~IA~~y~vs~~~i~~~N~l~~-~l~~Gq~L~i~ 46 (48)
T d1e0ga_ 2 SITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTA-NLQPGDKLTLF 46 (48)
T ss_dssp CCEEEECTTCCHHHHHHHHTCCHHHHHHHCSCGG-GCCTTEEEECC
T ss_pred cEEEEECCCCCHHHHHHHHCCCHHHHHHHcCCcc-cCcCCCEEEEE
Confidence 3589999999999999999999999999999864 69999999997
|
| >d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e0ga_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|