Citrus Sinensis ID: 040509

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MKGIVGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
cccHHHHHHHHHHHHHHHHcccEEEEcHHHHHHcccEEEEEEEcccHHHHHHHccccEEEEccccHHHHHHHHHHccccccccccHHHHcccccccHHHHHHHccccccccccccccHHccccccccHHHHccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHEEEccEEEccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHccccEEEEcccccHHHHHHEEcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHccccHcccHHHHccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccEEEEEEEEEEEccEEEEcc
MKGIVGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWssdvlpavkRMSNVAVVVPKSGASLWADLWAipaasrlhktnwrasqwsisidpsmdrillpfkqevipgtspsalETTLVKLPeellkgkpslgtdliagvppaeILARcefleplsEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEfekkdhganatDFLIIVASIVEVSSFEAVYA
mkgivgairsiqesstkfWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
MKGIVGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
*****GAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGT***ALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEA***
*****G*IRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
MKGIVGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
****VGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGIVGAIRSIQESSTKFWYGVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFYEKRKMILCLNKVVANLAEFEKKDHGANATDFLIIVASIVEVSSFEAVYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
255557729 507 transporter, putative [Ricinus communis] 0.743 0.331 0.576 6e-44
147822062 875 hypothetical protein VITISV_021806 [Viti 0.761 0.196 0.527 5e-40
225427562 553 PREDICTED: uncharacterized protein LOC10 0.761 0.311 0.527 2e-39
449455671 549 PREDICTED: uncharacterized protein LOC10 0.769 0.316 0.5 3e-39
224074577 424 predicted protein [Populus trichocarpa] 0.778 0.415 0.502 9e-39
356559069 552 PREDICTED: uncharacterized protein LOC10 0.659 0.269 0.566 5e-38
356560607 508 PREDICTED: uncharacterized protein LOC10 0.659 0.293 0.553 4e-37
115460340 367 Os04g0602200 [Oryza sativa Japonica Grou 0.862 0.531 0.451 5e-37
116310926 537 B0403H10-OSIGBa0105A11.16 [Oryza sativa 0.862 0.363 0.451 7e-37
218195504 537 hypothetical protein OsI_17268 [Oryza sa 0.862 0.363 0.451 7e-37
>gi|255557729|ref|XP_002519894.1| transporter, putative [Ricinus communis] gi|223540940|gb|EEF42498.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 102/177 (57%), Positives = 125/177 (70%), Gaps = 9/177 (5%)

Query: 4   IVGAIRSIQESSTKFWYGVVKLYTLS--EAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVV 61
           + G   ++QE+   F   V    ++   +AFG+ DVWVAVGWSSDVLP  KRMSN+AVVV
Sbjct: 296 VHGGKSAVQENLALFGKQVRLFDSMHYLKAFGVGDVWVAVGWSSDVLPVAKRMSNIAVVV 355

Query: 62  PKSGASLWADLWAIPAASRL--HKTNWRASQWSISIDPSMDRIL-----LPFKQEVIPGT 114
           PKSG+SLWADLWAIPAASRL  ++   R    S  I   ++  L     +PFKQEVIPG 
Sbjct: 356 PKSGSSLWADLWAIPAASRLATNRIGGRVRGPSPLIHQWIEFCLQAARAMPFKQEVIPGA 415

Query: 115 SPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWL 171
           SPSALE+T V++PEEL +GKP L T+LIAGVPP EIL+RCEFLEPLS+A     +WL
Sbjct: 416 SPSALESTPVEVPEELTRGKPRLDTNLIAGVPPPEILSRCEFLEPLSDAQLLDYKWL 472

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147822062|emb|CAN68081.1| hypothetical protein VITISV_021806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427562|ref|XP_002266662.1| PREDICTED: uncharacterized protein LOC100242504 [Vitis vinifera] gi|296085502|emb|CBI29234.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455671|ref|XP_004145575.1| PREDICTED: uncharacterized protein LOC101211357 [Cucumis sativus] gi|449485058|ref|XP_004157059.1| PREDICTED: uncharacterized protein LOC101230567 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074577|ref|XP_002304393.1| predicted protein [Populus trichocarpa] gi|222841825|gb|EEE79372.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356559069|ref|XP_003547824.1| PREDICTED: uncharacterized protein LOC100781794 [Glycine max] Back     alignment and taxonomy information
>gi|356560607|ref|XP_003548582.1| PREDICTED: uncharacterized protein LOC100809061 [Glycine max] Back     alignment and taxonomy information
>gi|115460340|ref|NP_001053770.1| Os04g0602200 [Oryza sativa Japonica Group] gi|113565341|dbj|BAF15684.1| Os04g0602200, partial [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|116310926|emb|CAH67864.1| B0403H10-OSIGBa0105A11.16 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|218195504|gb|EEC77931.1| hypothetical protein OsI_17268 [Oryza sativa Indica Group] gi|222629488|gb|EEE61620.1| hypothetical protein OsJ_16044 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2206194524 AT1G31410 [Arabidopsis thalian 0.615 0.265 0.532 2.4e-35
TAIR|locus:2206194 AT1G31410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 2.4e-35, P = 2.4e-35
 Identities = 82/154 (53%), Positives = 100/154 (64%)

Query:    30 EAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAAS---------- 79
             +AF + DVWV VGWSSDV+P  KRMSNV V+VPKSGA+LWADLWAIPA S          
Sbjct:   334 KAFNVGDVWVTVGWSSDVIPVAKRMSNVTVIVPKSGATLWADLWAIPAVSDSGKEAEQRG 393

Query:    80 -RLHKTNWRASQW-SISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSL 137
              R+   +   +QW    + P+     LPF +EVIPG SPSAL+  LV  PE+  K +  L
Sbjct:   394 GRVRGPSPLINQWIEFCLQPARS---LPFTREVIPGASPSALDGPLVTEPEKTKKDRTKL 450

Query:   138 GTDLIAGVPPAEILARCEFLEPLSEATFDVLRWL 171
              T+L+ GVPP EIL++CEFLEPL EAT    R L
Sbjct:   451 DTNLVTGVPPPEILSKCEFLEPLPEATLSEYRLL 484


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.134   0.406    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      226       226   0.00078  113 3  11 22  0.38    33
                                                     32  0.41    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  613 (65 KB)
  Total size of DFA:  188 KB (2105 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  18.72u 0.12s 18.84t   Elapsed:  00:00:01
  Total cpu time:  18.72u 0.12s 18.84t   Elapsed:  00:00:01
  Start:  Mon May 20 21:10:13 2013   End:  Mon May 20 21:10:14 2013
GO:0005215 "transporter activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007620001
SubName- Full=Chromosome chr2 scaffold_196, whole genome shotgun sequence; (538 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
COG0687363 COG0687, PotD, Spermidine/putrescine-binding perip 2e-07
pfam13343239 pfam13343, SBP_bac_6, Bacterial extracellular solu 6e-05
PRK10682370 PRK10682, PRK10682, putrescine transporter subunit 4e-04
>gnl|CDD|223759 COG0687, PotD, Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
 Score = 50.1 bits (120), Expect = 2e-07
 Identities = 33/144 (22%), Positives = 56/144 (38%), Gaps = 24/144 (16%)

Query: 36  DVWVAVGWSSDVLPA--VKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSI 93
           +V +A+GWS D   A   K  + +  V+PK G+ LW D  AIP  ++ +     A ++  
Sbjct: 234 EVVLAMGWSGDAAAAKAAKNGAPIEFVIPKEGSILWFDNLAIPKGAK-NVDA--AYKF-- 288

Query: 94  SIDPSMDRILLPFKQEVIPGTS--PSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEIL 151
                ++ +L P     +          +     LP+E+         D  A  P AEIL
Sbjct: 289 -----INFLLDPEVAAKLAEFVGYAPPNKAARKLLPKEIK--------DDPAIYPTAEIL 335

Query: 152 ARCEFLEPLSEATFDVL--RWLKF 173
            +    + L      +    W + 
Sbjct: 336 KKLFGQKDLGPEALRLYTKAWQEI 359

Length = 363
>gnl|CDD|222057 pfam13343, SBP_bac_6, Bacterial extracellular solute-binding protein Back     alignment and domain information
>gnl|CDD|182645 PRK10682, PRK10682, putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
PRK09501348 potD spermidine/putrescine ABC transporter peripla 99.92
COG0687363 PotD Spermidine/putrescine-binding periplasmic pro 99.91
PRK10682370 putrescine transporter subunit: periplasmic-bindin 99.9
PRK11622401 hypothetical protein; Provisional 99.53
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transpo 99.49
PF13343242 SBP_bac_6: Bacterial extracellular solute-binding 99.48
TIGR01276309 thiB thiamine ABC transporter, periplasmic binding 99.37
TIGR01254304 sfuA ABC transporter periplasmic binding protein, 99.34
PRK11205330 tbpA thiamine transporter substrate binding subuni 99.31
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, peri 99.15
PF13416281 SBP_bac_8: Bacterial extracellular solute-binding 99.0
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 98.98
COG1840299 AfuA ABC-type Fe3+ transport system, periplasmic c 98.93
PRK15046349 2-aminoethylphosphonate ABC transporter substrate- 98.87
TIGR00971315 3a0106s03 sulfate/thiosulfate-binding protein. Thi 98.54
PRK10752329 sulfate transporter subunit; Provisional 98.45
COG4134384 ABC-type uncharacterized transport system, peripla 98.42
COG4143336 TbpA ABC-type thiamine transport system, periplasm 98.27
PRK10852338 thiosulfate transporter subunit; Provisional 98.19
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 98.08
PRK10677257 modA molybdate transporter periplasmic protein; Pr 97.97
PRK03537188 molybdate ABC transporter periplasmic molybdate-bi 97.89
PRK09474396 malE maltose ABC transporter periplasmic protein; 97.74
PF01547315 SBP_bac_1: Bacterial extracellular solute-binding 97.71
PRK04168334 molybdate ABC transporter periplasmic substrate-bi 97.26
TIGR03850437 bind_CPR_0540 carbohydrate ABC transporter substra 97.23
TIGR03851450 chitin_NgcE carbohydrate ABC transporter, N-acetyl 96.81
COG0725258 ModA ABC-type molybdate transport system, periplas 96.62
PF02030493 Lipoprotein_8: Hypothetical lipoprotein (MG045 fam 96.37
COG1653433 UgpB ABC-type sugar transport system, periplasmic 95.84
PRK10974438 glycerol-3-phosphate transporter periplasmic bindi 95.27
TIGR03730273 tungstate_WtpA tungstate ABC transporter binding p 92.5
COG1613348 Sbp ABC-type sulfate transport system, periplasmic 91.97
COG4150341 CysP ABC-type sulfate transport system, periplasmi 80.28
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information 
Probab=99.92  E-value=3.2e-24  Score=194.68  Aligned_cols=153  Identities=18%  Similarity=0.158  Sum_probs=129.1

Q ss_pred             HHHHHHHhHhhhh--cccchhhHHHHhhcCcEEEEEeccccHHHHHHcCCCeEEEecCCCceeeeeeEEEeCCCCCCCCH
Q 040509            8 IRSIQESSTKFWY--GVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTN   85 (226)
Q Consensus         8 ~~~~~e~l~~~~~--~~~~~~~~~~~l~~GEv~va~~wsgd~~~a~~~~~~i~~v~PkEG~~~w~D~~~Ipk~A~~~~n~   85 (226)
                      ++++.+.++++.+  ..+..+...+.+.+||++++++|+++...++..|.++++++|+||+.+|+|+++|||+++   |+
T Consensus       192 ~~~a~~~l~~l~~~v~~~~~~~~~~~l~~Gev~i~~~w~~~~~~~~~~g~~i~~~~P~eG~~~~~~~~~i~k~a~---n~  268 (348)
T PRK09501        192 IEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAK---NK  268 (348)
T ss_pred             HHHHHHHHHHhhhhhEEEcCcHHHHHHHcCCEEEEEeehHHHHHHHhcCCCceEEecCCCcceEEEeeeEECCCC---CH
Confidence            3444555555443  234445667899999999999999999988888999999999999999999999999999   99


Q ss_pred             HHHHHHHHhhCCCHHhhhccccccccCCCCCCcchhcccCCchhhhcCCCCCCCCcccCCCcHHHhhhceecCCCCHHHH
Q 040509           86 WRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATF  165 (226)
Q Consensus        86 e~A~kFI~nfll~Pe~qa~~~~~e~i~~~s~~~n~aa~~~l~~el~~~~p~~~p~l~~i~P~~e~l~r~e~~~~l~~~~~  165 (226)
                      ++|++|| ||+++||+|+.++  +..++  +++|..+...+++++++     +|   .+||+++.+++++++.++++. .
T Consensus       269 e~A~~Fi-~~llspe~q~~~~--~~~~~--~~~n~~a~~~l~~~~~~-----~~---~~~~~~~~~~~~~~~~~~~~~-~  334 (348)
T PRK09501        269 EGALKLI-NFLLRPDVAKQVA--ETIGY--PTPNLAARKLLSPEVAN-----DK---SLYPDAETIKKGEWQNDVGAA-S  334 (348)
T ss_pred             HHHHHHH-HHHhCHHHHHHHH--HHhCC--CChhHHHHHhCCHHHhc-----CC---CcCcCHHHHhccEEecCCCHH-H
Confidence            9999999 9999999999986  45555  55688888899999987     34   479999999999999999864 6


Q ss_pred             HHHHHHHHHhhc
Q 040509          166 DVLRWLKFLRFY  177 (226)
Q Consensus       166 ~~y~~iW~~i~~  177 (226)
                      ++|+++|++|+.
T Consensus       335 ~~~~~~w~~~~~  346 (348)
T PRK09501        335 SIYEEYYQKLKA  346 (348)
T ss_pred             HHHHHHHHHHhc
Confidence            899999999986

>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>PRK11622 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information
>PF13343 SBP_bac_6: Bacterial extracellular solute-binding protein; PDB: 2QRY_D 1XVX_A 1SI1_A 1SI0_A 1Q35_A 1Y9U_A 2OWS_A 2OWT_A 2VP1_A 2VOZ_A Back     alignment and domain information
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>PF13416 SBP_bac_8: Bacterial extracellular solute-binding protein; PDB: 2FNC_A 1ELJ_A 3TTM_B 3TTK_C 2W7Y_A 3RPW_A 2GHB_C 2GHA_A 1POY_3 1POT_A Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate/thiosulfate-binding protein Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>PRK03537 molybdate ABC transporter periplasmic molybdate-binding protein; Provisional Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PF01547 SBP_bac_1: Bacterial extracellular solute-binding protein; InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK04168 molybdate ABC transporter periplasmic substrate-binding protein; Provisional Back     alignment and domain information
>TIGR03850 bind_CPR_0540 carbohydrate ABC transporter substrate-binding protein, CPR_0540 family Back     alignment and domain information
>TIGR03851 chitin_NgcE carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02030 Lipoprotein_8: Hypothetical lipoprotein (MG045 family) Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>TIGR03730 tungstate_WtpA tungstate ABC transporter binding protein WtpA Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4150 CysP ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
3ttl_A340 Crystal Structure Of Apo-Spue Length = 340 3e-04
3ttn_A340 Crystal Structures Of Polyamine Receptors Spud And 4e-04
>pdb|3TTL|A Chain A, Crystal Structure Of Apo-Spue Length = 340 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 6/51 (11%)
Query: 36  DVWVAVGWSSDVLPAVKRMS------NVAVVVPKSGASLWADLWAIPAASR 80
           ++ VA G+S DV  A  R        ++  V+PK GA+LW DL AIPA ++
Sbjct: 210 NICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAK 260
>pdb|3TTN|A Chain A, Crystal Structures Of Polyamine Receptors Spud And Spue From Pseudomonas Aeruginosa Length = 340 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
4eqb_A330 Spermidine/putrescine ABC superfamily ATP binding 5e-15
1pot_A325 POTD, spermidine/putrescine-binding protein; polya 1e-14
1a99_A344 POTF, putrescine-binding protein; transport, perip 4e-12
3ttn_A340 Polyamine transport protein; polyamine binding pro 5e-12
3ttm_A346 Polyamine transport protein; polyamine binding, pu 6e-12
2v84_A343 Spermidine/putrescine ABC transporter, periplasmi 1e-11
4edp_A351 ABC transporter, substrate-binding protein; clostr 4e-10
3pu5_A333 Extracellular solute-binding protein; structural g 3e-07
3rpw_A365 ABC transporter; structural genomics, PSI-biology, 4e-07
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Length = 330 Back     alignment and structure
 Score = 71.5 bits (176), Expect = 5e-15
 Identities = 28/145 (19%), Positives = 52/145 (35%), Gaps = 28/145 (19%)

Query: 36  DVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISI 95
           +V + V +S +    +++  N+  VVP   ++LW D   IP   + ++ +  A  +    
Sbjct: 202 NVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIPKTVK-NQDS--AYAF---- 254

Query: 96  DPSMDRILLPFKQEVIPGTS-----PSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEI 150
              ++ +L P   E     +      +        LPEE  + K        A  P  E 
Sbjct: 255 ---INFMLKP---ENALQNAEYVGYSTPNLPAKELLPEETKEDK--------AFYPDVET 300

Query: 151 LARCEFLEPLSEATFDVL--RWLKF 173
           +   E  E             +L+F
Sbjct: 301 MKHLEVYEKFDHKWTGKYSDLFLQF 325
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Length = 325 Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Length = 344 Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Length = 340 Back     alignment and structure
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Length = 346 Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Length = 343 Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Length = 351 Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Length = 333 Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
4gl0_A333 LMO0810 protein; structural genomics, IDP05673, sp 99.93
4eqb_A330 Spermidine/putrescine ABC superfamily ATP binding 99.89
3ttm_A346 Polyamine transport protein; polyamine binding, pu 99.88
3ttn_A340 Polyamine transport protein; polyamine binding pro 99.86
1pot_A325 POTD, spermidine/putrescine-binding protein; polya 99.82
1a99_A344 POTF, putrescine-binding protein; transport, perip 99.68
2v84_A343 Spermidine/putrescine ABC transporter, periplasmi 99.66
4euo_A320 ABC transporter, substrate binding protein (polya; 99.53
4i1d_A324 ABC transporter substrate-binding protein; structu 99.49
3pu5_A333 Extracellular solute-binding protein; structural g 99.47
3rpw_A365 ABC transporter; structural genomics, PSI-biology, 99.41
4edp_A351 ABC transporter, substrate-binding protein; clostr 99.26
3c9h_A355 ABC transporter, substrate binding protein; struct 99.17
3cg1_A296 UPF0100 protein PF0080; ABC transporter, binding p 99.07
2qry_A330 Thiamine-binding periplasmic protein; thiamin bind 98.99
3e13_X322 Putative iron-uptake ABC transport system, peripla 98.93
1xvx_A312 YFUA; periplasmic iron binding protein, iron bindi 98.87
1q35_A320 Iron binding protein FBPA; metal binding protein; 98.85
1sbp_A310 Sulfate-binding protein; 1.70A {Salmonella typhimu 98.83
2pt1_A334 Iron transport protein; C-clamp, iron-binding prot 98.79
1y9u_A323 Putative iron binding protein; periplasmic binding 98.78
1nnf_A309 Iron-utilization periplasmic protein; iron-binding 98.78
2voz_A346 FUTA2, periplasmic iron-binding protein; ferric bi 98.77
4hw8_A420 Bacterial extracellular solute-binding protein, P; 98.73
2gha_A382 Maltose ABC transporter, periplasmic maltose-BIND 98.72
2zyo_A397 Solute-binding protein; open form, sugar binding p 98.68
4dxb_A 637 RG13, maltose-binding periplasmic protein, beta-la 98.67
3r26_A237 Molybdate-binding periplasmic protein; protein bin 98.62
3osq_A661 Maltose-binding periplasmic protein, green fluore 98.62
3osr_A 653 Maltose-binding periplasmic protein, green fluore 98.61
2gh9_A386 Maltose/maltodextrin-binding protein; MBP, maltose 98.59
3uor_A458 ABC transporter sugar binding protein; ALFA/beta p 98.59
3oai_A507 Maltose-binding periplasmic protein, myelin prote; 98.58
3ob4_A500 Conglutin, maltose ABC transporter periplasmic pro 98.58
3k01_A412 Acarbose/maltose binding protein GACH; ABC transpo 98.55
3cfx_A296 UPF0100 protein MA_0280; ABC transporter, binding 98.54
3py7_A 523 Maltose-binding periplasmic protein,paxillin LD1, 98.53
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 98.53
3n94_A475 Fusion protein of maltose-binding periplasmic Pro 98.52
3cij_A295 UPF0100 protein AF_0094; archaeal periplasmic bind 98.52
1urs_A402 Maltose-binding protein; maltodextrin-binding prot 98.51
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 98.49
1elj_A381 Maltodextrin-binding protein; protein-carbohydrate 98.48
3quf_A414 Extracellular solute-binding protein, family 1; st 98.47
3mp6_A 522 MBP, SGF29, maltose-binding periplasmic protein, l 98.45
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 98.44
3h4z_A 568 Maltose-binding periplasmic protein fused with Al 98.44
3h3g_A 539 Fusion protein of maltose-binding periplasmic DOM 98.43
1y4c_A494 Maltose binding protein fused with designed helica 98.42
4hs7_A420 Bacterial extracellular solute-binding protein, P; 98.41
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding 98.38
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.36
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.35
3thi_A371 Protein (thiaminase I); thiamin degradation, trans 98.35
2xz3_A463 Maltose ABC transporter periplasmic protein, ENVE 98.35
1atg_A231 MODA, periplasmic molybdate-binding protein; tungs 98.34
1hsj_A487 Fusion protein consisting of staphylococcus access 98.33
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfa 98.32
2vgq_A477 Maltose-binding periplasmic protein, mitochondrial 98.31
2xd3_A416 MALX, maltose/maltodextrin-binding protein; solute 98.3
1r6z_P509 Chimera of maltose-binding periplasmic protein AN 98.27
2b3f_A400 Glucose-binding protein; protein-carbohydrate comp 98.24
3oo8_A415 ABC transporter binding protein ACBH; class 2 SBP 98.2
4exk_A487 Maltose-binding periplasmic protein, uncharacteri 98.16
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 98.13
2zxt_A465 Maltose-binding periplasmic protein, linker, MITO 98.12
4b3n_A 602 Maltose-binding periplasmic protein, tripartite mo 98.12
3gzg_A253 Molybdate-binding periplasmic protein; permease; m 98.12
2heu_A401 Sugar ABC transporter, sugar-binding protein; peri 98.08
3cfz_A292 UPF0100 protein MJ1186; ABC transporter, binding p 98.04
3i3v_A405 Probable secreted solute-binding lipoprotein; tran 98.03
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 98.03
2w7y_A430 FCSSBP, probable sugar ABC transporter, sugar-bind 97.92
2z8f_A412 Galacto-N-biose/lacto-N-biose I transporter subst 97.9
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 97.69
4g68_A456 ABC transporter; transport protein; HET: XYS; 1.80 97.57
3omb_A535 Extracellular solute-binding protein, family 1; PS 97.48
1eu8_A409 Trehalose/maltose binding protein; protein-carbohy 97.38
3a09_A490 ALGQ1; sugar binding protein, alginate; HET: MAW B 97.37
4aq4_A419 SN-glycerol-3-phosphate-binding periplasmic prote; 97.35
2uvj_A408 TOGB, ABC type periplasmic sugar-binding protein; 97.29
3k6v_A354 Solute-binding protein MA_0280; MODA, molybdate, p 97.06
3vlv_A502 ALGQ1; sugar binding protein, alginate; HET: MAW L 96.62
4gqo_A433 LMO0859 protein; virulence, pathogenesis, vaccine 96.22
3muq_A237 Uncharacterized conserved protein; structural geno 92.69
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- 85.35
>4gl0_A LMO0810 protein; structural genomics, IDP05673, spermidine, putrescine, ABC transporter, niaid; HET: MSE PGE PG4; 1.92A {Listeria monocytogenes} Back     alignment and structure
Probab=99.93  E-value=2.4e-26  Score=203.03  Aligned_cols=140  Identities=16%  Similarity=0.185  Sum_probs=126.3

Q ss_pred             ccchhhHHHHhhcCcEEEEEeccccHHHHHHcCCCeEEEecCCCceeeeeeEEEeCCCCCCCCHHHHHHHHHhhCCCHHh
Q 040509           22 VVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTNWRASQWSISIDPSMDR  101 (226)
Q Consensus        22 ~~~~~~~~~~l~~GEv~va~~wsgd~~~a~~~~~~i~~v~PkEG~~~w~D~~~Ipk~A~~~~n~e~A~kFI~nfll~Pe~  101 (226)
                      .+.+++..+.+.+||++|+++|+++...++.++.++.+++|+||+.+|+|+++|||+|+   |+++|++|| |||++||+
T Consensus       191 ~~~~~~~~~~~~~Ge~~~~~~~~~~~~~~~~~~~~~~~~~p~eG~~~~~~~~~I~k~a~---n~e~A~~fi-~fllspe~  266 (333)
T 4gl0_A          191 AIVGDEIKLLMADNEAGVAVTFSGEAAEMLSENEDLEYVIPKDGSNLWFDNMVIPKTAK---NVDGAHKFI-NFMLKPEN  266 (333)
T ss_dssp             EEESTTHHHHTSCC-CCEEEEEHHHHHHHHHHCTTEEEECCSSCEEEEEEEEECBTTCS---CHHHHHHHH-HHHHSHHH
T ss_pred             eecchhhhhhhhccchheehhhhHHHHHHHhhccccccccCCCCCccccceEEEEcCCC---CHHHHHHHH-HHhcCHHH
Confidence            45567888999999999999999999999999999999999999999999999999999   999999999 99999999


Q ss_pred             hhccccccccCCCCCCcchhcccCCchhhhcCCCCCCCCcccCCCcHHHhhhceecCCCCHHHHHHHHHHHHHhhc
Q 040509          102 ILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATFDVLRWLKFLRFY  177 (226)
Q Consensus       102 qa~~~~~e~i~~~s~~~n~aa~~~l~~el~~~~p~~~p~l~~i~P~~e~l~r~e~~~~l~~~~~~~y~~iW~~i~~  177 (226)
                      |+.++  +.++|  .++|..+...++++++++     |   .++|+.+.+++++++.+++++..+.|+++|++||-
T Consensus       267 q~~~~--~~~gy--~~~n~~a~~~l~~~~~~~-----~---~~~p~~~~~~~~~~~~~~~~~~~~~~~~~w~~~K~  330 (333)
T 4gl0_A          267 AAINA--EYVGY--ATPNAKAVELLPKEISSD-----E---RFYPDMDELNNLEVYDNLGKRMLSYYNELFLEFKM  330 (333)
T ss_dssp             HHHHH--HHHCC--BCCBHHHHHHSCHHHHTC-----T---TTSCCGGGGTTEECCCCCCHHHHHHHHHHHHHHHH
T ss_pred             HHHHH--HHhCC--CCccHHHHHhCCHHHHhC-----c---ccCCCHHHHhhCeehhcCCHHHHHHHHHHHHHHHh
Confidence            99997  56677  335778888899999873     4   47999999999999999999999999999999985
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genom MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} SCOP: c.94.1.1 PDB: 1y4t_A Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein, iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, perip binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 3od7_A 3odb_A 1qvs_A 2o6a_A 2o68_A 3kn8_A 3kn7_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>4hw8_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MAL; 2.25A {Staphylococcus aureus subsp} PDB: 4hs7_A* Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose-BIND protein; periplasmic binding protein, MBP, maltotriose; HET: MLR; 1.60A {Thermotoga maritima} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>3osq_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 1.90A {Escherichia coli} Back     alignment and structure
>3osr_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 2.00A {Escherichia coli} Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermoph protein, periplasmic binding protein, sugar binding protein; HET: MLR; 1.95A {Thermus thermophilus} Back     alignment and structure
>3uor_A ABC transporter sugar binding protein; ALFA/beta protein, periplasmic-binding protein, maltose, SUG binding protein; 2.20A {Xanthomonas axonopodis PV} Back     alignment and structure
>3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} Back     alignment and structure
>3ob4_A Conglutin, maltose ABC transporter periplasmic protein, ARAH; alpha-amylase inhibitors (AAI), lipid transfer (LT) and SEED (SS) protein family; HET: MLR; 2.71A {Escherichia coli} Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, LIGA unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3py7_A Maltose-binding periplasmic protein,paxillin LD1, chimera; viral protein; HET: MLR; 2.29A {Escherichia coli} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>3quf_A Extracellular solute-binding protein, family 1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Bifidobacterium longum subsp} Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>4hs7_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: P33; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>2xz3_A Maltose ABC transporter periplasmic protein, ENVE glycoprotein; viral protein, viral membrane fusion, hairpin, chimera; HET: MAL; 1.95A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein AN argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>3oo8_A ABC transporter binding protein ACBH; class 2 SBP fold, ABC transporter extracellular solute bindi protein, D-galactose binding; 1.60A {Actinoplanes} PDB: 3oo6_A* 3oo7_A 3oo9_A 3ooa_A Back     alignment and structure
>4exk_A Maltose-binding periplasmic protein, uncharacteri protein chimera; MCSG, pcsep, MBP-fused target, structural genomics; HET: MTT; 1.28A {Escherichia coli} PDB: 3g7v_A* 3g7w_A* 3sev_A* 3ser_A* 3sew_A* 3set_A* 3ses_A* 3seu_A* 3sex_A* 3sey_A* 3q27_A* 3q28_A* 3q26_A* 3q25_A* 3q29_A* 1nmu_A* 2ok2_A* 3pgf_A* 1t0k_A* 3rum_A* ... Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, MITO intermembrane space import AND...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>4b3n_A Maltose-binding periplasmic protein, tripartite motif-containing protein 5; sugar binding protein-ligase complex; HET: MAL MES; 3.30A {Escherichia coli} PDB: 2lm3_A Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter subst binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4g68_A ABC transporter; transport protein; HET: XYS; 1.80A {Caldanaerobius} PDB: 4g68_B* Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>3a09_A ALGQ1; sugar binding protein, alginate; HET: MAW BEM MAV; 1.40A {Sphingomonas} PDB: 1y3p_A* 1y3q_A 1y3n_A* 3vlv_A* 3vlu_A* 3vlw_A* 1j1n_A* 1kwh_A Back     alignment and structure
>4aq4_A SN-glycerol-3-phosphate-binding periplasmic prote; diester-binding protein; HET: G3P; 1.80A {Escherichia coli} Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A 3u1o_A Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic BIN protein, ABC transporter, transport protein, ligand, metal- protein; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3vlv_A ALGQ1; sugar binding protein, alginate; HET: MAW LGU; 1.50A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 3vlu_A* 3vlw_A* 1y3n_A* 1y3p_A* 1y3q_A 1j1n_A* 1kwh_A Back     alignment and structure
>4gqo_A LMO0859 protein; virulence, pathogenesis, vaccine candidate, center for struc genomics of infectious diseases, csgid, niaid; HET: MSE PGE; 2.10A {Listeria monocytogenes} Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1a99a_341 c.94.1.1 (A:) Putrescine receptor (PotF) {Escheric 1e-05
d1pota_322 c.94.1.1 (A:) Spermidine/putrescine-binding protei 1e-04
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Length = 341 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Putrescine receptor (PotF)
species: Escherichia coli [TaxId: 562]

 Score = 43.2 bits (100), Expect = 1e-05
 Identities = 32/148 (21%), Positives = 56/148 (37%), Gaps = 28/148 (18%)

Query: 36  DVWVAVGWSSDVLPAVKRMS------NVAVVVPKSGASLWADLWAIPAASRLHKTNWRAS 89
           D+ VA+GW+ DV  A  R        NV+  +PK GA  + D++A+PA ++     ++  
Sbjct: 209 DICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFL 268

Query: 90  QWSISIDPSMDRILLPFKQEVIPGTS--PSALETTLVKLPEELLKGKPSLGTDLIAGVPP 147
            +          +L P     I       +A +     +  E+ +             PP
Sbjct: 269 NY----------LLRPDVVAHISDHVFYANANKAATPLVSAEVRENP--------GIYPP 310

Query: 148 AEILARCEFLEPLSEATFDVL--RWLKF 173
           A++ A+   L+        V    W K 
Sbjct: 311 ADVRAKLFTLKVQDPKIDRVRTRAWTKV 338
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1pota_322 Spermidine/putrescine-binding protein PotD {Escher 99.84
d1a99a_341 Putrescine receptor (PotF) {Escherichia coli [TaxI 99.73
d1nnfa_308 Ferric-binding protein FbpA {Haemophilus influenza 98.99
d1xvxa_311 Ferric-binding protein FbpA {Yersinia enterocoliti 98.91
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinel 98.85
d1q35a_318 Ferric-binding protein FbpA {Mannheimia haemolytic 98.81
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli 98.66
d1y9ua_318 Ferric-binding protein FbpA {Bordetella pertussis 98.64
d1y4ta_317 Ferric-binding protein FbpA {Campylobacter jejuni 98.56
d1sbpa_309 Sulphate-binding protein {Salmonella typhimurium [ 98.34
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 98.3
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacil 98.24
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 98.22
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia c 98.0
d2onsa1311 Molybdate-binding protein, ModA {Archaeoglobus ful 97.76
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Ther 97.61
d1j1na_492 Alginate-binding periplasmic protein AlgQ2 {Sphing 96.62
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Spermidine/putrescine-binding protein PotD
species: Escherichia coli [TaxId: 562]

Probab=99.84  E-value=2.9e-21  Score=166.41  Aligned_cols=153  Identities=18%  Similarity=0.152  Sum_probs=128.5

Q ss_pred             HHHHHHHhHhhhh--cccchhhHHHHhhcCcEEEEEeccccHHHHHHcCCCeEEEecCCCceeeeeeEEEeCCCCCCCCH
Q 040509            8 IRSIQESSTKFWY--GVVKLYTLSEAFGIRDVWVAVGWSSDVLPAVKRMSNVAVVVPKSGASLWADLWAIPAASRLHKTN   85 (226)
Q Consensus         8 ~~~~~e~l~~~~~--~~~~~~~~~~~l~~GEv~va~~wsgd~~~a~~~~~~i~~v~PkEG~~~w~D~~~Ipk~A~~~~n~   85 (226)
                      .....+.++++..  ..+.+++..+++.+|++.|++.|++++..+++.+.++++.+|++|+.+|+++++|||+++   |+
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~~~~~~~~~I~k~a~---n~  243 (322)
T d1pota_         167 IEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAK---NK  243 (322)
T ss_dssp             HHHHHHHHHHTGGGEEEECSSCTHHHHHTTSCSEEEEEHHHHHHHHTTSCCEEEECCTTCCEEEEEEEBCBTTCT---TH
T ss_pred             HHHHHHHHHHhccccceeeccccccccccCcEEEEEEechhHHHHHhhccccceeeccCCceeeeeeeEEecCCC---CH
Confidence            3344444444444  234456788999999999999999999999999999999999999999999999999999   99


Q ss_pred             HHHHHHHHhhCCCHHhhhccccccccCCCCCCcchhcccCCchhhhcCCCCCCCCcccCCCcHHHhhhceecCCCCHHHH
Q 040509           86 WRASQWSISIDPSMDRILLPFKQEVIPGTSPSALETTLVKLPEELLKGKPSLGTDLIAGVPPAEILARCEFLEPLSEATF  165 (226)
Q Consensus        86 e~A~kFI~nfll~Pe~qa~~~~~e~i~~~s~~~n~aa~~~l~~el~~~~p~~~p~l~~i~P~~e~l~r~e~~~~l~~~~~  165 (226)
                      ++|++|| |||++||+|++++  +..++  ++++..+...+++++++.     +   .++|+.+.+++.+++.++++. .
T Consensus       244 ~~A~~fi-~fl~s~e~q~~~~--~~~g~--~p~~~~a~~~~~~e~~~~-----~---~~~~~~~~~~~~~~~~~~~~~-~  309 (322)
T d1pota_         244 EGALKLI-NFLLRPDVAKQVA--ETIGY--PTPNLAARKLLSPEVAND-----K---TLYPDAETIKNGEWQNDVGAA-S  309 (322)
T ss_dssp             HHHHHHH-HHHHSHHHHHHHH--HHHCC--CCSBSTTTTTSCHHHHTC-----T---TTSCCHHHHHHSEECCCCGGG-H
T ss_pred             HHHHHHH-HHHcCHHHHHHHH--HHhCC--CCcCHHHHhhCCHHHHhC-----c---ccCCCHHHHhhCchhhcCHHH-H
Confidence            9999999 9999999999997  44455  335777888899999873     3   368999999999999998854 6


Q ss_pred             HHHHHHHHHhhc
Q 040509          166 DVLRWLKFLRFY  177 (226)
Q Consensus       166 ~~y~~iW~~i~~  177 (226)
                      +.|+++|++|+.
T Consensus       310 ~~~~~~~~~~~a  321 (322)
T d1pota_         310 SIYEEYYQKLKA  321 (322)
T ss_dssp             HHHHHHHHHHTT
T ss_pred             HHHHHHHHHHhC
Confidence            889999999975
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure