Citrus Sinensis ID: 040576


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-
MSVRLKFTKTTEASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
cEEEEccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccccEEHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEEHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccc
cccEEEcccHHHHHHHHHHccccccccEHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHcccccEEHHHHHHHHHccccHHHHHHHHHHHHccccEHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEEcEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEEc
msvrlkftktteASLSLDKFIKsqknlpktppklwanepkpkftdtdnqrlpivdlshpilqklescstVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSsvslsvlffdgiqepdafmCNTIMKSFLMLNDPFGALSFYYEKMMAKFVehnhytfpllgKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDarkvfedgpvwdlVTWNSMIDGYVKNREVGFARelfdfmperdiftwNSMISGyvdvgdmeaanglfdlmpfrdvvsWNCMIDGYakignvtsarncfdrMCMRNVVSWNILLALYVRCKDYCECLRLFDrmirgdakpneASLMSVLTACANMGVIDIGQWIHSYIQKcrikpdvlLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMekrgptpndatFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLgraglmrdseelvsklpmeagPALWGALLSACSTHSNSELGKIVAQHLmeleprdpgpyvlLSNIyasegkwdeVENLRRIMKEKELEKAVgsslvhpgefasesivencpphrkCIVYSMLGEIGAQMKMCRRDVASQISIQ
msvrlkftktteaslsldkfiksqknlpktppklwanepkpkftdtdnqrlpiVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIyasegkwdeVENLRRIMKEKELEKAVGSSLVHPGEfasesivencppHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
MSVRLKFTKTTEASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRvlkklctslssvslsvlFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
**************************************************LPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMF***********DATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIM************LVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCR**********
*********TTEASLSLDKFIKSQKNLPKTPPKLW*******************DLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
********KTTEASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
MSVRLKFTKTTEASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVRLKFTKTTEASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSHPILQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNREVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQISIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query641 2.2.26 [Sep-21-2011]
Q9LS72600 Pentatricopeptide repeat- yes no 0.875 0.935 0.384 1e-117
Q9LN01741 Pentatricopeptide repeat- no no 0.881 0.762 0.373 1e-115
Q9SJZ3681 Pentatricopeptide repeat- no no 0.893 0.841 0.343 1e-105
O22137613 Pentatricopeptide repeat- no no 0.831 0.869 0.367 1e-102
Q9FHR3550 Putative pentatricopeptid no no 0.845 0.985 0.358 1e-102
Q9FI80646 Pentatricopeptide repeat- no no 0.828 0.821 0.340 1e-102
Q9SY02781 Pentatricopeptide repeat- no no 0.681 0.559 0.416 1e-102
O49399545 Pentatricopeptide repeat- no no 0.778 0.915 0.365 1e-101
O82380738 Pentatricopeptide repeat- no no 0.920 0.799 0.327 1e-101
Q9LTV8694 Pentatricopeptide repeat- no no 0.817 0.755 0.355 1e-100
>sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protein At3g29230 OS=Arabidopsis thaliana GN=PCMP-E27 PE=2 SV=1 Back     alignment and function desciption
 Score =  421 bits (1082), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/567 (38%), Positives = 346/567 (61%), Gaps = 6/567 (1%)

Query: 61  LQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPD 120
           LQ L  C+ + +  Q+H Q++   L +D   A +++  L +     +L+V  F+ +QEP+
Sbjct: 23  LQDLPKCANLNQVKQLHAQIIRRNLHEDLHIAPKLISAL-SLCRQTNLAVRVFNQVQEPN 81

Query: 121 AFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVH 180
             +CN+++++    + P+ A  F + +M    +  +++T+P L K C+G   L   K +H
Sbjct: 82  VHLCNSLIRAHAQNSQPYQAF-FVFSEMQRFGLFADNFTYPFLLKACSGQSWLPVVKMMH 140

Query: 181 ARIVKCGFELDLFVRNSLIHMYSVCGE--VLDARKVFEDGPVWDLVTWNSMIDGYVKNRE 238
             I K G   D++V N+LI  YS CG   V DA K+FE     D V+WNSM+ G VK  E
Sbjct: 141 NHIEKLGLSSDIYVPNALIDCYSRCGGLGVRDAMKLFEKMSERDTVSWNSMLGGLVKAGE 200

Query: 239 VGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKI 298
           +  AR LFD MP+RD+ +WN+M+ GY    +M  A  LF+ MP R+ VSW+ M+ GY+K 
Sbjct: 201 LRDARRLFDEMPQRDLISWNTMLDGYARCREMSKAFELFEKMPERNTVSWSTMVMGYSKA 260

Query: 299 GNVTSARNCFDRMCM--RNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMS 356
           G++  AR  FD+M +  +NVV+W I++A Y       E  RL D+M+    K + A+++S
Sbjct: 261 GDMEMARVMFDKMPLPAKNVVTWTIIIAGYAEKGLLKEADRLVDQMVASGLKFDAAAVIS 320

Query: 357 VLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKN 416
           +L AC   G++ +G  IHS +++  +  +  +  +LL MYAKCG +  A +VF+++ +K+
Sbjct: 321 ILAACTESGLLSLGMRIHSILKRSNLGSNAYVLNALLDMYAKCGNLKKAFDVFNDIPKKD 380

Query: 417 VVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFD 476
           +VSWN+M+ G G+HG G++A+E+F  M + G  P+  TFI VL +C HAG++ EG  YF 
Sbjct: 381 LVSWNTMLHGLGVHGHGKEAIELFSRMRREGIRPDKVTFIAVLCSCNHAGLIDEGIDYFY 440

Query: 477 LMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNS 536
            M+++Y + P+VEHYGC+VDLLGR G ++++ ++V  +PME    +WGALL AC  H+  
Sbjct: 441 SMEKVYDLVPQVEHYGCLVDLLGRVGRLKEAIKVVQTMPMEPNVVIWGALLGACRMHNEV 500

Query: 537 ELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHP 596
           ++ K V  +L++L+P DPG Y LLSNIYA+   W+ V ++R  MK   +EK  G+S V  
Sbjct: 501 DIAKEVLDNLVKLDPCDPGNYSLLSNIYAAAEDWEGVADIRSKMKSMGVEKPSGASSVEL 560

Query: 597 GEFASESIVENCPPHRKCIVYSMLGEI 623
            +   E  V +    +   +Y MLG +
Sbjct: 561 EDGIHEFTVFDKSHPKSDQIYQMLGSL 587





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 Back     alignment and function description
>sp|O22137|PP202_ARATH Pentatricopeptide repeat-containing protein At2g45350, chloroplastic OS=Arabidopsis thaliana GN=CRR4 PE=3 SV=2 Back     alignment and function description
>sp|Q9FHR3|PP403_ARATH Putative pentatricopeptide repeat-containing protein At5g37570 OS=Arabidopsis thaliana GN=PCMP-E37 PE=3 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|O49399|PP321_ARATH Pentatricopeptide repeat-containing protein At4g18840 OS=Arabidopsis thaliana GN=PCMP-E101 PE=3 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
225427280719 PREDICTED: pentatricopeptide repeat-cont 0.978 0.872 0.661 0.0
224126363617 predicted protein [Populus trichocarpa] 0.948 0.985 0.625 0.0
356513796595 PREDICTED: pentatricopeptide repeat-cont 0.887 0.956 0.605 0.0
297742136461 unnamed protein product [Vitis vinifera] 0.692 0.963 0.724 0.0
255575758518 pentatricopeptide repeat-containing prot 0.775 0.959 0.642 0.0
414884999557 TPA: hypothetical protein ZEAMMB73_34374 0.630 0.725 0.565 1e-138
326530660613 predicted protein [Hordeum vulgare subsp 0.669 0.699 0.533 1e-135
359485688585 PREDICTED: pentatricopeptide repeat-cont 0.851 0.933 0.437 1e-133
147807930585 hypothetical protein VITISV_032407 [Viti 0.851 0.933 0.436 1e-133
357118977604 PREDICTED: pentatricopeptide repeat-cont 0.687 0.730 0.524 1e-133
>gi|225427280|ref|XP_002278897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/633 (66%), Positives = 513/633 (81%), Gaps = 6/633 (0%)

Query: 1   MSVRLKFTKTTE--ASLSLDKFIKSQKNLPKTPPKLWANEPKPKFTDTDNQRLPIVDLSH 58
           M VR K +  T   +SLSL+KF+KS+KNL K PP+LW++       + D+Q LPI+ LSH
Sbjct: 1   MGVRFKPSHPTVRLSSLSLEKFLKSRKNLFKAPPRLWSDHGH-GLPEEDDQPLPILKLSH 59

Query: 59  PILQKLESC-STVKEFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQ 117
           PIL+ LESC  + KEF+QIHTQL+VSGL Q   AA R +K LC+   SV  +V  F+G++
Sbjct: 60  PILRTLESCCGSTKEFNQIHTQLIVSGLLQQPLAAGRAVKTLCSFPDSVQHAVSLFEGLE 119

Query: 118 EPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGK 177
           EPDAF+CNTIM++++ +NDP+ AL FYYE+M+ K V  NHYTFPLL KVC  I S+ +G+
Sbjct: 120 EPDAFICNTIMRTYVNVNDPYTALGFYYEQMVRKCVAPNHYTFPLLVKVCWEIGSIGDGE 179

Query: 178 KVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMIDGYVKNR 237
           K+HARI+K GFELDLFVRNSLIHMYSVCG + DAR +FE   + DLVTWNSMIDGYVKN 
Sbjct: 180 KIHARILKFGFELDLFVRNSLIHMYSVCGRIGDARAMFEVCSISDLVTWNSMIDGYVKNG 239

Query: 238 EVGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAK 297
           E+G ARELF+ MPERD+F+WNSMI+GYV  GDM AA  LF+ MPFRD+VSWNCMIDGYA+
Sbjct: 240 EIGAARELFEEMPERDLFSWNSMIAGYVGNGDMTAAEDLFNKMPFRDIVSWNCMIDGYAQ 299

Query: 298 IGNVTSARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSV 357
           + N+  A   F+ M  RNVVSWNI+LALYVR KDY ECLR+FD+M+ G+  PNEA+L+SV
Sbjct: 300 VQNMEIACELFNWMPYRNVVSWNIMLALYVRIKDYDECLRMFDKMM-GETMPNEATLVSV 358

Query: 358 LTACANMGVIDIGQWIHSYIQKCR-IKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKN 416
           LTACA++G +D G+WIHSYI+  R I+PDVLLST+LLTMYAKCG MDLAR+VFD M+ ++
Sbjct: 359 LTACAHLGRLDRGKWIHSYIKNNRVIEPDVLLSTALLTMYAKCGAMDLARDVFDKMSNRS 418

Query: 417 VVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFD 476
           VVSWNSMIMGYGMHGQ +KALEMF++MEKRGP PNDATFICVLSAC H+GM+LEGWWYFD
Sbjct: 419 VVSWNSMIMGYGMHGQADKALEMFLDMEKRGPMPNDATFICVLSACAHSGMILEGWWYFD 478

Query: 477 LMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNS 536
           LM+R YKIEPKVEHYGCMVDLLGRAGLM+D EEL+ K+PME G ALWGALLSAC THSNS
Sbjct: 479 LMRRAYKIEPKVEHYGCMVDLLGRAGLMKDLEELIRKMPMEGGTALWGALLSACRTHSNS 538

Query: 537 ELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHP 596
           EL +IVA+ L+ELEPRD GPY+LLSNIYA+EGKWD+VE +R++MKE+ L K  G S VH 
Sbjct: 539 ELAEIVAKRLIELEPRDIGPYLLLSNIYAAEGKWDDVEIVRKMMKERGLTKTTGFSWVHI 598

Query: 597 GEFASESIVENCPPHRKCIVYSMLGEIGAQMKM 629
            EF ++S VE    HRK ++YS+L ++  QMK+
Sbjct: 599 EEFGTQSFVEKASVHRKSMMYSILSDMATQMKL 631




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224126363|ref|XP_002329535.1| predicted protein [Populus trichocarpa] gi|222870244|gb|EEF07375.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513796|ref|XP_003525595.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Back     alignment and taxonomy information
>gi|297742136|emb|CBI33923.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575758|ref|XP_002528778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531781|gb|EEF33600.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|414884999|tpg|DAA61013.1| TPA: hypothetical protein ZEAMMB73_343744 [Zea mays] Back     alignment and taxonomy information
>gi|326530660|dbj|BAK01128.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|359485688|ref|XP_002275048.2| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] gi|297739328|emb|CBI28979.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807930|emb|CAN62155.1| hypothetical protein VITISV_032407 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357118977|ref|XP_003561223.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
TAIR|locus:2094812600 AT3G29230 "AT3G29230" [Arabido 0.875 0.935 0.379 9.2e-107
TAIR|locus:2151694550 AT5G37570 "AT5G37570" [Arabido 0.840 0.98 0.349 5.9e-96
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.681 0.559 0.416 6.1e-94
TAIR|locus:2054966555 AHG11 "ABA hypersensitive germ 0.786 0.908 0.349 1.1e-92
TAIR|locus:2121055559 AT4G38010 "AT4G38010" [Arabido 0.833 0.955 0.354 4e-90
TAIR|locus:2010012474 AT1G13410 "AT1G13410" [Arabido 0.619 0.837 0.408 5e-89
TAIR|locus:2012295705 AT1G09410 [Arabidopsis thalian 0.627 0.570 0.394 5.4e-86
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.673 0.582 0.396 2.1e-84
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.861 0.635 0.316 1.4e-80
TAIR|locus:2027554704 AT1G56690 [Arabidopsis thalian 0.613 0.558 0.391 2.2e-80
TAIR|locus:2094812 AT3G29230 "AT3G29230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1056 (376.8 bits), Expect = 9.2e-107, P = 9.2e-107
 Identities = 215/567 (37%), Positives = 338/567 (59%)

Query:    61 LQKLESCSTVKEFHQIHTQLLVSGLSQDSFAASRXXXXXXXXXXXXXXXXXFFDGIQEPD 120
             LQ L  C+ + +  Q+H Q++   L +D   A +                 F + +QEP+
Sbjct:    23 LQDLPKCANLNQVKQLHAQIIRRNLHEDLHIAPKLISALSLCRQTNLAVRVF-NQVQEPN 81

Query:   121 AFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKVH 180
               +CN+++++    + P+ A  F + +M    +  +++T+P L K C+G   L   K +H
Sbjct:    82 VHLCNSLIRAHAQNSQPYQAF-FVFSEMQRFGLFADNFTYPFLLKACSGQSWLPVVKMMH 140

Query:   181 ARIVKCGFELDLFVRNSLIHMYSVCGE--VLDARKVFEDGPVWDLVTWNSMIDGYVKNRE 238
               I K G   D++V N+LI  YS CG   V DA K+FE     D V+WNSM+ G VK  E
Sbjct:   141 NHIEKLGLSSDIYVPNALIDCYSRCGGLGVRDAMKLFEKMSERDTVSWNSMLGGLVKAGE 200

Query:   239 VGFARELFDFMPERDIFTWNSMISGYVDVGDMEAANGLFDLMPFRDVVSWNCMIDGYAKI 298
             +  AR LFD MP+RD+ +WN+M+ GY    +M  A  LF+ MP R+ VSW+ M+ GY+K 
Sbjct:   201 LRDARRLFDEMPQRDLISWNTMLDGYARCREMSKAFELFEKMPERNTVSWSTMVMGYSKA 260

Query:   299 GNVTSARNCFDRMCM--RNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMS 356
             G++  AR  FD+M +  +NVV+W I++A Y       E  RL D+M+    K + A+++S
Sbjct:   261 GDMEMARVMFDKMPLPAKNVVTWTIIIAGYAEKGLLKEADRLVDQMVASGLKFDAAAVIS 320

Query:   357 VLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKN 416
             +L AC   G++ +G  IHS +++  +  +  +  +LL MYAKCG +  A +VF+++ +K+
Sbjct:   321 ILAACTESGLLSLGMRIHSILKRSNLGSNAYVLNALLDMYAKCGNLKKAFDVFNDIPKKD 380

Query:   417 VVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFD 476
             +VSWN+M+ G G+HG G++A+E+F  M + G  P+  TFI VL +C HAG++ EG  YF 
Sbjct:   381 LVSWNTMLHGLGVHGHGKEAIELFSRMRREGIRPDKVTFIAVLCSCNHAGLIDEGIDYFY 440

Query:   477 LMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNS 536
              M+++Y + P+VEHYGC+VDLLGR G ++++ ++V  +PME    +WGALL AC  H+  
Sbjct:   441 SMEKVYDLVPQVEHYGCLVDLLGRVGRLKEAIKVVQTMPMEPNVVIWGALLGACRMHNEV 500

Query:   537 ELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHP 596
             ++ K V  +L++L+P DPG Y LLSNIYA+   W+ V ++R  MK   +EK  G+S V  
Sbjct:   501 DIAKEVLDNLVKLDPCDPGNYSLLSNIYAAAEDWEGVADIRSKMKSMGVEKPSGASSVEL 560

Query:   597 GEFASESIVENCPPHRKCIVYSMLGEI 623
              +   E  V +    +   +Y MLG +
Sbjct:   561 EDGIHEFTVFDKSHPKSDQIYQMLGSL 587


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2151694 AT5G37570 "AT5G37570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054966 AHG11 "ABA hypersensitive germination 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121055 AT4G38010 "AT4G38010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010012 AT1G13410 "AT1G13410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012295 AT1G09410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027554 AT1G56690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LS72PP261_ARATHNo assigned EC number0.38440.87510.935yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-107
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-89
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-59
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-42
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-39
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-35
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-27
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-07
pfam0153531 pfam01535, PPR, PPR repeat 3e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
pfam1285434 pfam12854, PPR_1, PPR repeat 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  342 bits (879), Expect = e-107
 Identities = 180/495 (36%), Positives = 271/495 (54%), Gaps = 17/495 (3%)

Query: 111 LFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGI 170
           L FD +   D    N ++  +    +    L  ++  M    V+ +  T   +   C  +
Sbjct: 243 LVFDRMPRRDCISWNAMISGYFENGECLEGLELFF-TMRELSVDPDLMTITSVISACELL 301

Query: 171 RSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMI 230
              R G+++H  +VK GF +D+ V NSLI MY   G   +A KVF      D V+W +MI
Sbjct: 302 GDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMI 361

Query: 231 DGYVKNREVGFARELFDFMPER----DIFTWNSMISGYVDVGDMEAANGLFDLMP----F 282
            GY KN     A E +  M +     D  T  S++S    +GD++    L +L       
Sbjct: 362 SGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLI 421

Query: 283 RDVVSWNCMIDGYAKIGNVTSARNCFDRMCMRNVVSWNILLA---LYVRCKDYCECLRLF 339
             VV  N +I+ Y+K   +  A   F  +  ++V+SW  ++A   L  RC    E L  F
Sbjct: 422 SYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRC---FEALIFF 478

Query: 340 DRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKC 399
            +M+    KPN  +L++ L+ACA +G +  G+ IH+++ +  I  D  L  +LL +Y +C
Sbjct: 479 RQML-LTLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRC 537

Query: 400 GVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVL 459
           G M+ A N F N  EK+VVSWN ++ GY  HG+G  A+E+F  M + G  P++ TFI +L
Sbjct: 538 GRMNYAWNQF-NSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLL 596

Query: 460 SACTHAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAG 519
            AC+ +GMV +G  YF  M+  Y I P ++HY C+VDLLGRAG + ++   ++K+P+   
Sbjct: 597 CACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPD 656

Query: 520 PALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRI 579
           PA+WGALL+AC  H + ELG++ AQH+ EL+P   G Y+LL N+YA  GKWDEV  +R+ 
Sbjct: 657 PAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKT 716

Query: 580 MKEKELEKAVGSSLV 594
           M+E  L    G S V
Sbjct: 717 MRENGLTVDPGCSWV 731


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 641
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
KOG2076895 consensus RNA polymerase III transcription factor 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.7
KOG2003840 consensus TPR repeat-containing protein [General f 99.7
KOG2003840 consensus TPR repeat-containing protein [General f 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.65
KOG1126638 consensus DNA-binding cell division cycle control 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
KOG2076 895 consensus RNA polymerase III transcription factor 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.61
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG0547606 consensus Translocase of outer mitochondrial membr 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG0547606 consensus Translocase of outer mitochondrial membr 99.56
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.53
KOG1915677 consensus Cell cycle control protein (crooked neck 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.53
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.48
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.48
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG2376652 consensus Signal recognition particle, subunit Srp 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.39
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.36
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.36
KOG1129478 consensus TPR repeat-containing protein [General f 99.3
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.29
PRK12370553 invasion protein regulator; Provisional 99.28
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
PRK11189296 lipoprotein NlpI; Provisional 99.25
PF1304150 PPR_2: PPR repeat family 99.21
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.21
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.2
PF1304150 PPR_2: PPR repeat family 99.2
PRK12370553 invasion protein regulator; Provisional 99.2
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.19
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.17
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.16
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.14
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.14
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.14
PRK11189296 lipoprotein NlpI; Provisional 99.1
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.09
KOG2376652 consensus Signal recognition particle, subunit Srp 99.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.07
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.06
KOG1125579 consensus TPR repeat-containing protein [General f 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.04
KOG1129478 consensus TPR repeat-containing protein [General f 99.04
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.02
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.0
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.99
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.98
PRK15359144 type III secretion system chaperone protein SscB; 98.95
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.89
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.89
PRK10370198 formate-dependent nitrite reductase complex subuni 98.88
PRK04841903 transcriptional regulator MalT; Provisional 98.87
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.85
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.84
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.78
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.73
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.7
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.67
PRK15359144 type III secretion system chaperone protein SscB; 98.62
PLN02789320 farnesyltranstransferase 98.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.61
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
PRK04841 903 transcriptional regulator MalT; Provisional 98.6
PLN02789320 farnesyltranstransferase 98.6
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.58
PF1285434 PPR_1: PPR repeat 98.57
KOG1125579 consensus TPR repeat-containing protein [General f 98.57
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.54
KOG1128777 consensus Uncharacterized conserved protein, conta 98.54
PF1285434 PPR_1: PPR repeat 98.5
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.46
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.45
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.45
KOG0553304 consensus TPR repeat-containing protein [General f 98.44
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.43
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.42
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.39
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.39
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.33
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.31
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.13
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.05
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.02
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.02
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.01
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.99
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.98
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.95
PF1337173 TPR_9: Tetratricopeptide repeat 97.95
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.94
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
PRK15331165 chaperone protein SicA; Provisional 97.92
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.91
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.85
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.83
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.83
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.7
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.69
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.68
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.66
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.63
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.59
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.59
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.58
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.56
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.52
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.52
PRK10803263 tol-pal system protein YbgF; Provisional 97.51
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.5
COG4700251 Uncharacterized protein conserved in bacteria cont 97.49
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.49
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.48
PF1343134 TPR_17: Tetratricopeptide repeat 97.47
KOG20411189 consensus WD40 repeat protein [General function pr 97.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.35
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.31
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.29
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.27
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.27
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.22
PF12688120 TPR_5: Tetratrico peptide repeat 97.19
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.19
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.19
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.15
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.14
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.11
COG3898531 Uncharacterized membrane-bound protein [Function u 97.07
PF12688120 TPR_5: Tetratrico peptide repeat 97.06
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.02
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.0
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.98
COG4700251 Uncharacterized protein conserved in bacteria cont 96.98
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.98
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.97
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.97
PF1342844 TPR_14: Tetratricopeptide repeat 96.97
PF1342844 TPR_14: Tetratricopeptide repeat 96.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.88
PRK10803263 tol-pal system protein YbgF; Provisional 96.86
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.83
KOG4555175 consensus TPR repeat-containing protein [Function 96.77
PF1337173 TPR_9: Tetratricopeptide repeat 96.77
KOG20411189 consensus WD40 repeat protein [General function pr 96.76
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.71
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.66
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.6
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.47
PF13512142 TPR_18: Tetratricopeptide repeat 96.44
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.39
PRK11906458 transcriptional regulator; Provisional 96.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.13
KOG4234271 consensus TPR repeat-containing protein [General f 96.12
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.08
KOG1585308 consensus Protein required for fusion of vesicles 96.03
COG3898531 Uncharacterized membrane-bound protein [Function u 96.02
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 95.94
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.83
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.79
KOG4648 536 consensus Uncharacterized conserved protein, conta 95.68
PRK15331165 chaperone protein SicA; Provisional 95.52
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.48
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.48
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.45
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.44
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.4
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.34
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.25
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.23
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.21
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.17
PRK11906458 transcriptional regulator; Provisional 95.16
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.14
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.11
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.1
PF13512142 TPR_18: Tetratricopeptide repeat 95.09
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.09
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.03
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.03
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.98
smart00299140 CLH Clathrin heavy chain repeat homology. 94.98
smart00299140 CLH Clathrin heavy chain repeat homology. 94.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.79
KOG3941406 consensus Intermediate in Toll signal transduction 94.74
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.73
KOG1258577 consensus mRNA processing protein [RNA processing 94.72
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.66
KOG3941406 consensus Intermediate in Toll signal transduction 94.63
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.19
KOG4234271 consensus TPR repeat-containing protein [General f 94.14
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.0
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.68
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.55
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.42
PRK11619 644 lytic murein transglycosylase; Provisional 93.42
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.38
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.34
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.33
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.32
KOG4555175 consensus TPR repeat-containing protein [Function 93.31
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.26
KOG1585308 consensus Protein required for fusion of vesicles 93.18
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.89
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.87
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 92.8
PRK09687280 putative lyase; Provisional 92.72
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.32
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.25
KOG1586288 consensus Protein required for fusion of vesicles 92.22
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.18
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.14
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.04
KOG1586288 consensus Protein required for fusion of vesicles 91.92
KOG3364149 consensus Membrane protein involved in organellar 91.92
COG3629280 DnrI DNA-binding transcriptional activator of the 91.74
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.72
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 91.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.71
PRK10941269 hypothetical protein; Provisional 91.54
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.52
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.51
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.4
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.2
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.58
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.46
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.27
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.17
COG3947361 Response regulator containing CheY-like receiver a 90.16
KOG1550552 consensus Extracellular protein SEL-1 and related 90.01
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.92
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.86
COG2976207 Uncharacterized protein conserved in bacteria [Fun 89.16
KOG2610491 consensus Uncharacterized conserved protein [Funct 89.06
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 88.88
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.88
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.71
PRK09687280 putative lyase; Provisional 88.62
COG1747 711 Uncharacterized N-terminal domain of the transcrip 88.27
COG3629280 DnrI DNA-binding transcriptional activator of the 87.78
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.57
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.79
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 86.59
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.18
PF1343134 TPR_17: Tetratricopeptide repeat 86.06
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 85.94
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.68
PRK12798421 chemotaxis protein; Reviewed 85.65
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.44
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.34
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 85.02
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.91
COG4455273 ImpE Protein of avirulence locus involved in tempe 84.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.74
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 84.56
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 84.47
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.28
KOG1550552 consensus Extracellular protein SEL-1 and related 84.24
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.97
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 83.62
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.29
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.8
KOG4570418 consensus Uncharacterized conserved protein [Funct 82.42
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 82.19
PRK11619644 lytic murein transglycosylase; Provisional 81.57
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.13
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.08
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 80.98
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 80.33
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.19
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 80.07
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-85  Score=732.99  Aligned_cols=553  Identities=34%  Similarity=0.595  Sum_probs=531.8

Q ss_pred             HHHHHHHHHHHhCCCCChhHHHHHHHHHhhcCCChHHHHHhhhcCCCCCcccHHHHHHHHHcCCCchhHHHHHHHHHHhc
Q 040576           72 EFHQIHTQLLVSGLSQDSFAASRVLKKLCTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAK  151 (641)
Q Consensus        72 ~~~~~~~~~~~~g~~~~~~~~~~ll~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~m~~~  151 (641)
                      .+.++|..+.+.|+.||..++|.+|. +|++.|+++.|.++|++|++||.++||+||.+|++.|++++|+++|. .|...
T Consensus       205 ~~~~~~~~~~~~g~~~~~~~~n~Li~-~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~-~M~~~  282 (857)
T PLN03077        205 RGREVHAHVVRFGFELDVDVVNALIT-MYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFF-TMREL  282 (857)
T ss_pred             hHHHHHHHHHHcCCCcccchHhHHHH-HHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHH-HHHHc
Confidence            33444444455555556666678888 78999999999999999999999999999999999999999999999 99999


Q ss_pred             CCCCCcchHHHHHHHHhcCCCchhHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCCHHHHHHHHhcCCCCCeeHHHHHHH
Q 040576          152 FVEHNHYTFPLLGKVCAGIRSLREGKKVHARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWDLVTWNSMID  231 (641)
Q Consensus       152 ~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~  231 (641)
                      |+.||..||+.++.+|++.|+++.|.+++..|.+.|+.||..+|++||.+|+++|++++|.++|++|..+|.++||++|.
T Consensus       283 g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~  362 (857)
T PLN03077        283 SVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMIS  362 (857)
T ss_pred             CCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCChHHHHHHHhhC----CCCCchhHHHHHHHHhcCCChHHHHHHHhhcCC----CCchHHHHHHHHHHhcCChHH
Q 040576          232 GYVKNREVGFARELFDFM----PERDIFTWNSMISGYVDVGDMEAANGLFDLMPF----RDVVSWNCMIDGYAKIGNVTS  303 (641)
Q Consensus       232 ~~~~~g~~~~A~~~~~~m----~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~----~~~~~~~~li~~~~~~~~~~~  303 (641)
                      +|++.|++++|+++|++|    ..||..||+.++.+|++.|+++.|.++++.+.+    ++..+|+.|+++|+++|++++
T Consensus       363 ~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~  442 (857)
T PLN03077        363 GYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDK  442 (857)
T ss_pred             HHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHH
Confidence            999999999999999999    679999999999999999999999999999975    568999999999999999999


Q ss_pred             HHHHHHhcCCCCcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHcCCC
Q 040576          304 ARNCFDRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIK  383 (641)
Q Consensus       304 A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~  383 (641)
                      |.++|++|.++|+.+||.+|.+|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|+++.+.+++..+.+.|+.
T Consensus       443 A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~  521 (857)
T PLN03077        443 ALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIG  521 (857)
T ss_pred             HHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999986 69999999999999999999999999999999999999


Q ss_pred             CchhHHHHHHHHHHhcCCHHHHHHHHhhcCCCChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q 040576          384 PDVLLSTSLLTMYAKCGVMDLARNVFDNMTEKNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACT  463 (641)
Q Consensus       384 ~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~  463 (641)
                      ++..++++|+++|+++|++++|.++|+.+ .+|..+||+||.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|+
T Consensus       522 ~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~  600 (857)
T PLN03077        522 FDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACS  600 (857)
T ss_pred             ccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHh
Confidence            99999999999999999999999999999 99999999999999999999999999999999999999999999999999


Q ss_pred             hhccHHHHHHHHHHhHHhhCCCCchHHHHHHHHHHhhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHH
Q 040576          464 HAGMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELGKIVA  543 (641)
Q Consensus       464 ~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~  543 (641)
                      +.|++++|.++|+.|.+.+|+.|+..+|++++++|++.|++++|.+++++|+.+|+..+|++|+.+|..+|+.+.|+.+.
T Consensus       601 ~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a  680 (857)
T PLN03077        601 RSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAA  680 (857)
T ss_pred             hcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHH
Confidence            99999999999999996699999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCchHHHHHHHHHhcCChHHHHHHHHHhhhCCCcccCceEEE----EeeeeecccccccCCCCchhhHHHH
Q 040576          544 QHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLV----HPGEFASESIVENCPPHRKCIVYSM  619 (641)
Q Consensus       544 ~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~----~~~~~~~~~~~~~~p~~~~~~~~~~  619 (641)
                      +++++++|+++..|..|+++|+..|+|++|.++++.|+++|++|.||+||+    .+|.|.++  ++.||+..+  ||..
T Consensus       681 ~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~--d~~h~~~~~--i~~~  756 (857)
T PLN03077        681 QHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTD--DESHPQIKE--INTV  756 (857)
T ss_pred             HHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecC--CCCCcchHH--HHHH
Confidence            999999999999999999999999999999999999999999999999999    89999999  999999999  9999


Q ss_pred             HHHHHHHHHhhhc
Q 040576          620 LGEIGAQMKMCRR  632 (641)
Q Consensus       620 l~~l~~~~~~~~~  632 (641)
                      |+.|..+|++.+=
T Consensus       757 l~~l~~~~~~~g~  769 (857)
T PLN03077        757 LEGFYEKMKASGL  769 (857)
T ss_pred             HHHHHHHHHhCCc
Confidence            9999999988764



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 65.6 bits (158), Expect = 3e-11
 Identities = 32/302 (10%), Positives = 87/302 (28%), Gaps = 9/302 (2%)

Query: 348 KPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLLSTSLLTMYAKCGVMDLARN 407
            P E  L  +L        +D+ Q       + ++        +          + LA +
Sbjct: 89  SPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHH 148

Query: 408 VFDNMTEK-------NVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLS 460
           +      +        +  +N++++G+   G  ++ + +   ++  G TP+  ++   L 
Sbjct: 149 LLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQ 208

Query: 461 ACTHAGMVLEGWW-YFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKLPMEAG 519
                           + M +   ++ +      ++    RA +++   ++     +   
Sbjct: 209 CMGRQDQDAGTIERCLEQMSQ-EGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQ 267

Query: 520 PALWGALLSACSTHSNSELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRI 579
                            +      +  + L+         L    AS      VE     
Sbjct: 268 LPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKPTLP 327

Query: 580 MKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIVYSMLGEIGAQMKMCRRDVASQIS 639
            KE +  +    +L    E A    +       +  VY     +   + +       ++ 
Sbjct: 328 SKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYPFLCLLDEREVVRML 387

Query: 640 IQ 641
           +Q
Sbjct: 388 LQ 389


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.63
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.61
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.59
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.59
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.56
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.5
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.43
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.4
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.38
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.38
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.36
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.25
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.24
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.2
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.18
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.12
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.02
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.01
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.99
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.97
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.96
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.93
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.92
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.89
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.84
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.81
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.81
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.81
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.81
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.79
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.78
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.75
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.74
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.74
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.73
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.73
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.72
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.71
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.7
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.67
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.65
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.58
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.53
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.51
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.49
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.49
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.48
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.47
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.44
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.44
3k9i_A117 BH0479 protein; putative protein binding protein, 98.44
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.43
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.42
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.41
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.4
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.39
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.39
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.39
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.38
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.32
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.27
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.27
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.25
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.24
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.22
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.22
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.17
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.12
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.07
3k9i_A117 BH0479 protein; putative protein binding protein, 98.06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.06
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.04
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.01
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.9
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.85
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.81
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.71
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.63
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.53
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.39
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.29
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.27
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.26
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.21
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.17
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.14
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.09
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.02
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.99
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.99
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.97
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.69
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.59
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.57
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.49
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.39
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.34
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.34
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.96
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.83
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.79
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.74
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.37
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.54
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.32
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.98
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 90.81
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 90.45
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 89.72
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.67
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.84
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.72
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.94
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 87.87
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.81
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 87.64
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 87.64
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.87
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 86.6
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.59
2p58_C116 Putative type III secretion protein YSCG; type III 86.21
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 86.21
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 85.48
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.24
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.85
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 83.72
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.56
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 82.27
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.12
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.09
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 81.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.23
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.07
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.9e-44  Score=391.05  Aligned_cols=490  Identities=9%  Similarity=-0.004  Sum_probs=408.9

Q ss_pred             hhcCCChHHHHHhhhcCCCCCcccHHHHHHHHHcCCCchhHHHHHHHHHHhcCCCCCcchHHHHHHHHhcCCCchhHHHH
Q 040576          100 CTSLSSVSLSVLFFDGIQEPDAFMCNTIMKSFLMLNDPFGALSFYYEKMMAKFVEHNHYTFPLLGKVCAGIRSLREGKKV  179 (641)
Q Consensus       100 ~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~  179 (641)
                      +.+.|.+..+...++.++.+++..|+.++..+.+.|++++|+.+|+ .|..  ..|+..++..++.+|.+.|++++|..+
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~-~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~  139 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGE-KVLD--ITGNPNDAFWLAQVYCCTGDYARAKCL  139 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHH-HHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHH-HHHh--hCCCchHHHHHHHHHHHcCcHHHHHHH
Confidence            3456777888888999888999999999999999999999999999 7764  467889999999999999999999999


Q ss_pred             HHHHHHhCCCCChhHHHHHHHHHHhcCCHHHHHHHHhcCCCCC-------------------eeHHHHHHHHHHhCCChH
Q 040576          180 HARIVKCGFELDLFVRNSLIHMYSVCGEVLDARKVFEDGPVWD-------------------LVTWNSMIDGYVKNREVG  240 (641)
Q Consensus       180 ~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~-------------------~~~~~~li~~~~~~g~~~  240 (641)
                      ++.+...  +++..+++.++.+|.++|++++|.++|++..+.+                   ..+|+.++.+|.+.|+++
T Consensus       140 ~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  217 (597)
T 2xpi_A          140 LTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFD  217 (597)
T ss_dssp             HHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHH
Confidence            9987643  6789999999999999999999999999754443                   789999999999999999


Q ss_pred             HHHHHHhhC--CCCC-chhHHHHHHHHhcCCChHHHHHH---HhhcCCCC----chHHHHHHHHHHhcCChHHHHHHHHh
Q 040576          241 FARELFDFM--PERD-IFTWNSMISGYVDVGDMEAANGL---FDLMPFRD----VVSWNCMIDGYAKIGNVTSARNCFDR  310 (641)
Q Consensus       241 ~A~~~~~~m--~~~~-~~~~~~ll~~~~~~g~~~~a~~~---~~~~~~~~----~~~~~~li~~~~~~~~~~~A~~~~~~  310 (641)
                      +|+++|++|  ..|+ ...+..+...+...+..+.+...   +..+...+    ..+|+.++..|.+.|++++|.++|++
T Consensus       218 ~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~  297 (597)
T 2xpi_A          218 RAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSS  297 (597)
T ss_dssp             HHHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHH
Confidence            999999999  3343 44555555544444332222111   22222222    45567778899999999999999999


Q ss_pred             cCC--CCcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCchhH
Q 040576          311 MCM--RNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCRIKPDVLL  388 (641)
Q Consensus       311 ~~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~  388 (641)
                      +..  +++.+|+.++.+|.+.|++++|+++|++|.+.+ +.+..++..++.++.+.|++++|..+++.+.+.. +.+..+
T Consensus       298 ~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~  375 (597)
T 2xpi_A          298 INGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVT  375 (597)
T ss_dssp             STTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHH
T ss_pred             hhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHH
Confidence            966  789999999999999999999999999999865 3366789999999999999999999999998764 567889


Q ss_pred             HHHHHHHHHhcCCHHHHHHHHhhcCC---CChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhh
Q 040576          389 STSLLTMYAKCGVMDLARNVFDNMTE---KNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHA  465 (641)
Q Consensus       389 ~~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~  465 (641)
                      ++.++.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|+++|++|.+.+ +.+..++..++.+|.+.
T Consensus       376 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~  454 (597)
T 2xpi_A          376 WLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQL  454 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHc
Confidence            99999999999999999999998863   567899999999999999999999999999874 34788999999999999


Q ss_pred             ccHHHHHHHHHHhHHhhCCCCchHHHHHHHHHHhhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHHHHHHhcCCH
Q 040576          466 GMVLEGWWYFDLMQRIYKIEPKVEHYGCMVDLLGRAGLMRDSEELVSKL-------PMEAG--PALWGALLSACSTHSNS  536 (641)
Q Consensus       466 g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~-------~~~~~--~~~~~~l~~~~~~~g~~  536 (641)
                      |++++|.++|+++.+.  .+.+..+|..++.+|.+.|++++|+++|+++       +..|+  ..+|..++.+|...|++
T Consensus       455 g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~  532 (597)
T 2xpi_A          455 GNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMY  532 (597)
T ss_dssp             TCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCH
T ss_pred             CCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCH
Confidence            9999999999999882  2346889999999999999999999999987       34677  78999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCCchHHHHHHHHHhcCChHHHHHHHHHhhhCCCcccCceEEEEeeeeecccccccCCCCchhhH
Q 040576          537 ELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCIV  616 (641)
Q Consensus       537 ~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~  616 (641)
                      ++|...++++++.+|+++.+|..++.+|.+.|++++|.+.++++                        .+++|++..  .
T Consensus       533 ~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~------------------------l~~~p~~~~--~  586 (597)
T 2xpi_A          533 DAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHES------------------------LAISPNEIM--A  586 (597)
T ss_dssp             HHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHH------------------------HHHCTTCHH--H
T ss_pred             HHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHH------------------------HhcCCCChH--H
Confidence            99999999999999999999999999999999999999999999                        788999999  9


Q ss_pred             HHHHHHHHH
Q 040576          617 YSMLGEIGA  625 (641)
Q Consensus       617 ~~~l~~l~~  625 (641)
                      +..|++++.
T Consensus       587 ~~~l~~~~~  595 (597)
T 2xpi_A          587 SDLLKRALE  595 (597)
T ss_dssp             HHHHHHTTC
T ss_pred             HHHHHHHHh
Confidence            999888653



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 641
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-07
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.7 bits (117), Expect = 6e-07
 Identities = 32/345 (9%), Positives = 104/345 (30%), Gaps = 25/345 (7%)

Query: 253 DIFTWNSMISGYVDVGDMEAANGLFD----LMPFRDVVSWNCMIDGYAKIGNVTSARNCF 308
           +      + S +     ++ +           P     +++ + + Y + G +  A   +
Sbjct: 32  NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKERGQLQEAIEHY 90

Query: 309 DRMCMRNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVID 368
                      +  + L        +        +       +   +          +  
Sbjct: 91  RHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGR 150

Query: 369 IGQWIHSYIQKCRIKPDVLLSTSLL-TMYAKCGVMDLARNVFDNMTE---KNVVSWNSMI 424
           + +    Y++    +P+  ++ S L  ++   G + LA + F+         + ++ ++ 
Sbjct: 151 LEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLG 210

Query: 425 MGYGMHGQGEKALEMFMEMEKRGPTPNDATFICVLSACTHAGMVLEGWWYFD----LMQR 480
                    ++A+  ++      P               +   V       D      +R
Sbjct: 211 NVLKEARIFDRAVAAYLRALSLSPNHAVVHG--------NLACVYYEQGLIDLAIDTYRR 262

Query: 481 IYKIEPK-VEHYGCMVDLLGRAGLMRDSEELVSKLPMEAGPALWGALLSACSTHSNSELG 539
             +++P   + Y  + + L   G + ++E+  +                A        + 
Sbjct: 263 AIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIE 322

Query: 540 KIVA--QHLMELEPRDPGPYVLLSNIYASEGKWDE-VENLRRIMK 581
           + V   +  +E+ P     +  L+++   +GK  E + + +  ++
Sbjct: 323 EAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR 367


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.25
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.16
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.12
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.07
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.06
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.86
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.69
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.67
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.58
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.58
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.4
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.37
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.37
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.32
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.09
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.04
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.9
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.61
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.54
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.4
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.24
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.21
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.21
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.52
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.86
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.83
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.67
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.5
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.01
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 85.93
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=8.6e-23  Score=205.07  Aligned_cols=367  Identities=10%  Similarity=0.051  Sum_probs=271.9

Q ss_pred             HHHHhCCChHHHHHHHhhC---CCCCchhHHHHHHHHhcCCChHHHHHHHhhcCC--CC-chHHHHHHHHHHhcCChHHH
Q 040576          231 DGYVKNREVGFARELFDFM---PERDIFTWNSMISGYVDVGDMEAANGLFDLMPF--RD-VVSWNCMIDGYAKIGNVTSA  304 (641)
Q Consensus       231 ~~~~~~g~~~~A~~~~~~m---~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~--~~-~~~~~~li~~~~~~~~~~~A  304 (641)
                      ..+.+.|++++|++.|+++   .+.+...+..+..++.+.|++++|...++++.+  |+ ..++..+...|.+.|++++|
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccc
Confidence            3444555555555555555   222344555555556666666666666665543  22 45666677777777777777


Q ss_pred             HHHHHhcCC---CCcchHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHcC
Q 040576          305 RNCFDRMCM---RNVVSWNILLALYVRCKDYCECLRLFDRMIRGDAKPNEASLMSVLTACANMGVIDIGQWIHSYIQKCR  381 (641)
Q Consensus       305 ~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~  381 (641)
                      +..+.....   .+...+..........+....+............ ................+....+...+.......
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (388)
T d1w3ba_          87 IEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ  165 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccchhhhhHHHHHHhhccC
Confidence            777776632   2333444445555556666666665555554332 333344445555667777777777777766654


Q ss_pred             CCCchhHHHHHHHHHHhcCCHHHHHHHHhhcCC---CChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHH
Q 040576          382 IKPDVLLSTSLLTMYAKCGVMDLARNVFDNMTE---KNVVSWNSMIMGYGMHGQGEKALEMFMEMEKRGPTPNDATFICV  458 (641)
Q Consensus       382 ~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~l  458 (641)
                       +.+...+..+...+...|++++|...+++..+   .+..+|..+...+...|++++|+..+++....+ ..+...+..+
T Consensus       166 -~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l  243 (388)
T d1w3ba_         166 -PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNL  243 (388)
T ss_dssp             -TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHH
T ss_pred             -cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHH
Confidence             44566777788888889999999998887653   456688889999999999999999999988864 3356677888


Q ss_pred             HHHHHhhccHHHHHHHHHHhHHhhCCCCc-hHHHHHHHHHHhhcCCHHHHHHHHHhC--CCCCCHHHHHHHHHHHHhcCC
Q 040576          459 LSACTHAGMVLEGWWYFDLMQRIYKIEPK-VEHYGCMVDLLGRAGLMRDSEELVSKL--PMEAGPALWGALLSACSTHSN  535 (641)
Q Consensus       459 l~~~~~~g~~~~a~~~~~~~~~~~~~~p~-~~~~~~li~~~~~~g~~~~A~~~~~~~--~~~~~~~~~~~l~~~~~~~g~  535 (641)
                      ...+.+.|++++|...|+++.+   +.|+ ...+..+..++...|++++|++.++..  ..+.+...+..+...+...|+
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~---~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  320 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIE---LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN  320 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHH---TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHCCCHHHHHHHHHHHHH---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCC
Confidence            8899999999999999999887   4454 678888999999999999999999876  234567788888899999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCchHHHHHHHHHhcCChHHHHHHHHHhhhCCCcccCceEEEEeeeeecccccccCCCCchhh
Q 040576          536 SELGKIVAQHLMELEPRDPGPYVLLSNIYASEGKWDEVENLRRIMKEKELEKAVGSSLVHPGEFASESIVENCPPHRKCI  615 (641)
Q Consensus       536 ~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  615 (641)
                      +++|+..+++++++.|+++.++..++.+|.+.|++++|++.++++                        .+++|++.+  
T Consensus       321 ~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a------------------------l~l~P~~~~--  374 (388)
T d1w3ba_         321 IEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEA------------------------IRISPTFAD--  374 (388)
T ss_dssp             HHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHH------------------------HTTCTTCHH--
T ss_pred             HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHH------------------------HHhCCCCHH--
Confidence            999999999999999999999999999999999999999999998                        788999999  


Q ss_pred             HHHHHHHHHHHHHh
Q 040576          616 VYSMLGEIGAQMKM  629 (641)
Q Consensus       616 ~~~~l~~l~~~~~~  629 (641)
                      ++..||.++.++++
T Consensus       375 a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         375 AYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHcCC
Confidence            99999999888763



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure