Citrus Sinensis ID: 040580


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
cEEEHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHcc
cccHHHHHHcccccccHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHccccHHHHHHHHHHHHHcccccEEHHHHHHHHHHcccHHHHHHHHHHHcccccEEHHHHHHHHHHccccHHEEEccc
metfslslhgsfkfkrfnvpshqthpkngDLARKIIRYRKQEGFVDCASLVEdlgrkkkphlAHQLVNTvksegllpdnsTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQvscrnadllPEVYSRAISCFGKQGQLELMENTLKEMVSrgfsvdsatgNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRmseagfhpdlttfNIRAVAFSRMSMFWDLHLSLEHmkhesvgpdlvtYGCVVDAYLDKrlgrnldfglskmnlddspvvstdpyvfeafgkgdfhssSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
metfslslhgsfkfkrfnvpshqthpkngdLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGfsvdsatgNAFIIYYSRFGSLTEMETAYGRLKrsrhlidkegirAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGlskmnlddspvVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVylkkqlrrnqifwny
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQvvweellsssfvlsvqvlsdlMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDlgnllwnllllSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
*****************************DLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFW**
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METFSLSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query412 2.2.26 [Sep-21-2011]
Q9M2A1415 Pentatricopeptide repeat- yes no 0.987 0.980 0.567 1e-136
O23278501 Pentatricopeptide repeat- no no 0.788 0.648 0.266 9e-23
Q9LYZ9819 Pentatricopeptide repeat- no no 0.713 0.358 0.236 2e-14
Q9SCP4447 Pentatricopeptide repeat- no no 0.742 0.684 0.243 8e-12
O64624822 Pentatricopeptide repeat- no no 0.645 0.323 0.219 3e-11
Q5G1S8 1440 Pentatricopeptide repeat- no no 0.682 0.195 0.209 4e-11
Q8L844709 Pentatricopeptide repeat- no no 0.817 0.475 0.198 1e-10
Q8S9D1 831 Pentatricopeptide repeat- no no 0.643 0.318 0.225 1e-10
Q9SQU6486 Pentatricopeptide repeat- no no 0.720 0.611 0.204 3e-10
O65567904 Pentatricopeptide repeat- no no 0.657 0.299 0.201 7e-10
>sp|Q9M2A1|PP263_ARATH Pentatricopeptide repeat-containing protein At3g42630 OS=Arabidopsis thaliana GN=At3g42630 PE=2 SV=2 Back     alignment and function desciption
 Score =  483 bits (1244), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 235/414 (56%), Positives = 307/414 (74%), Gaps = 7/414 (1%)

Query: 6   LSLHGSFKFKRFNVPSHQTHPKNGDLARKIIR-------YRKQEGFVDCASLVEDLGRKK 58
           LSL+ S K +   + S  T      +A+K+I+       + ++   VD A LV+ L +++
Sbjct: 2   LSLNLSLKPQHLKLLSCYTDSSAPSIAKKLIKESKLSRDFSQKIQIVDYAPLVQTLSQRR 61

Query: 59  KPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLS 118
            P +AH++    KS  LLP+  TLCALMLC+A NGFVL A+ +W+E+++S FV  V V+S
Sbjct: 62  LPDVAHEIFLQTKSVNLLPNYRTLCALMLCFAENGFVLRARTIWDEIINSCFVPDVFVVS 121

Query: 119 DLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSR 178
            L+ AY + GCF+E+  I   V+ R++ LLP V S AISCFGK GQLELME  ++EM S+
Sbjct: 122 KLISAYEQFGCFDEVAKITKDVAARHSKLLPVVSSLAISCFGKNGQLELMEGVIEEMDSK 181

Query: 179 GFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFML 238
           G  +++ T N  + YYS FGSL +ME AYGR+K+   +I++E IRAV   YLK+RKF+ L
Sbjct: 182 GVLLEAETANVIVRYYSFFGSLDKMEKAYGRVKKFGIVIEEEEIRAVVLAYLKQRKFYRL 241

Query: 239 GEFLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVA 298
            EFL DVGLGR++LGN+LWN +LLSYA +FKMKSLQREF+ M +AGF PDLTTFNIRA+A
Sbjct: 242 REFLSDVGLGRRNLGNMLWNSVLLSYAADFKMKSLQREFIGMLDAGFSPDLTTFNIRALA 301

Query: 299 FSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVV 358
           FSRM++FWDLHL+LEHM+  ++ PDLVT+GCVVDAY+DKRL RNL+F  ++MNLDDSP+V
Sbjct: 302 FSRMALFWDLHLTLEHMRRLNIVPDLVTFGCVVDAYMDKRLARNLEFVYNRMNLDDSPLV 361

Query: 359 STDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY 412
            TDP  FE  GKGDFH SSEA LEF  ++ WTYRKLI VYLKK+LRR+QIFWNY
Sbjct: 362 LTDPLAFEVLGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 415





Arabidopsis thaliana (taxid: 3702)
>sp|O23278|PP310_ARATH Pentatricopeptide repeat-containing protein At4g14190, chloroplastic OS=Arabidopsis thaliana GN=At4g14190 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=2 SV=1 Back     alignment and function description
>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 Back     alignment and function description
>sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 Back     alignment and function description
>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 Back     alignment and function description
>sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana GN=EMB2750 PE=2 SV=1 Back     alignment and function description
>sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protein At4g30825, chloroplastic OS=Arabidopsis thaliana GN=At4g30825 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
255541504427 pentatricopeptide repeat-containing prot 0.983 0.948 0.665 1e-162
224118746428 predicted protein [Populus trichocarpa] 0.978 0.941 0.678 1e-162
225445658423 PREDICTED: pentatricopeptide repeat-cont 0.987 0.962 0.676 1e-154
449470370388 PREDICTED: pentatricopeptide repeat-cont 0.893 0.948 0.660 1e-138
75223628419 pentatricopeptide repeat protein [Arabid 1.0 0.983 0.577 1e-138
297815394419 pentatricopeptide repeat protein [Arabid 1.0 0.983 0.572 1e-136
42565361415 pentatricopeptide repeat-containing prot 0.987 0.980 0.567 1e-134
75214625424 pentatricopeptide repeat protein [Olimar 0.975 0.948 0.572 1e-133
7523388412 putative protein [Arabidopsis thaliana] 0.987 0.987 0.569 1e-133
75214757411 pentatricopeptide repeat protein [Capsel 0.927 0.929 0.570 1e-127
>gi|255541504|ref|XP_002511816.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548996|gb|EEF50485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/412 (66%), Positives = 338/412 (82%), Gaps = 7/412 (1%)

Query: 8   LHGSFKFK--RFNVPSHQTHPKNGDLARKII-RYRKQEGF----VDCASLVEDLGRKKKP 60
           L GS K K  RF + S Q  P N  LARKII ++++ + F    VDCASLV++L  K+ P
Sbjct: 16  LGGSLKRKMGRFRLFSSQRDPTNRPLARKIIYQWKQDQSFSCKEVDCASLVQNLHSKRTP 75

Query: 61  HLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQVVWEELLSSSFVLSVQVLSDL 120
           HLA +++  +KS+G + +N TL A++LCYA+NG + +AQ +W+ +L+ SF  S+Q++S L
Sbjct: 76  HLAQEILLEMKSQGYVLNNPTLSAILLCYADNGLLPQAQAIWKHMLNGSFTPSIQIVSRL 135

Query: 121 MDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSRGF 180
           +DAY + G FNE+++I+DQ+S  N  LL E YS AISCFGK GQL+LMEN LK+MV RGF
Sbjct: 136 IDAYSKKGHFNEVMNILDQLSYSNFSLLHEAYSLAISCFGKGGQLQLMENALKDMVLRGF 195

Query: 181 SVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGE 240
            VD ATGNAFI YYS  GSLT+ME+AY RLKRSRHL+D+EGIRAVS  Y+KERKF+ LGE
Sbjct: 196 PVDYATGNAFIRYYSIHGSLTDMESAYSRLKRSRHLVDREGIRAVSLAYVKERKFYRLGE 255

Query: 241 FLRDVGLGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFS 300
           FLRDVGLGRKD+GNL+WN LLLS+A NFKMKSLQREF+RM EAGFHPD+TTFNIRA+AFS
Sbjct: 256 FLRDVGLGRKDVGNLIWNFLLLSFAANFKMKSLQREFLRMLEAGFHPDVTTFNIRALAFS 315

Query: 301 RMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVST 360
           RMS+ WDLHL+LEHMKHE V PD+VTYGC+VDAYLD+RLG+NLDF + KMNLD SPV+ T
Sbjct: 316 RMSLLWDLHLTLEHMKHEKVSPDIVTYGCIVDAYLDRRLGKNLDFAIKKMNLDGSPVLLT 375

Query: 361 DPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY 412
           DP+VFE  GKGDFHSS+EAFLEFKRQRKWTYR+L+++YL+KQ R NQIFWNY
Sbjct: 376 DPFVFEVLGKGDFHSSAEAFLEFKRQRKWTYRELVSIYLRKQYRSNQIFWNY 427




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224118746|ref|XP_002331436.1| predicted protein [Populus trichocarpa] gi|222873650|gb|EEF10781.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445658|ref|XP_002265876.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Vitis vinifera] gi|297736023|emb|CBI24061.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470370|ref|XP_004152890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Cucumis sativus] gi|449507537|ref|XP_004163059.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|75223628|gb|ABA18111.1| pentatricopeptide repeat protein [Arabidopsis arenosa] Back     alignment and taxonomy information
>gi|297815394|ref|XP_002875580.1| pentatricopeptide repeat protein [Arabidopsis lyrata subsp. lyrata] gi|297321418|gb|EFH51839.1| pentatricopeptide repeat protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42565361|ref|NP_566863.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546757|sp|Q9M2A1.2|PP263_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g42630 gi|332644221|gb|AEE77742.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|75214625|gb|ABA18097.1| pentatricopeptide repeat protein [Olimarabidopsis pumila] Back     alignment and taxonomy information
>gi|7523388|emb|CAB86446.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|75214757|gb|ABA18107.1| pentatricopeptide repeat protein [Capsella rubella] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
TAIR|locus:2096544415 AT3G42630 [Arabidopsis thalian 0.987 0.980 0.531 4.3e-109
TAIR|locus:2129475501 AT4G14190 "AT4G14190" [Arabido 0.786 0.646 0.256 5.9e-18
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.638 0.321 0.234 1.8e-07
TAIR|locus:2157607709 AT5G42310 [Arabidopsis thalian 0.825 0.479 0.196 2.5e-07
TAIR|locus:505006535904 AT4G30825 "AT4G30825" [Arabido 0.444 0.202 0.198 3.4e-06
TAIR|locus:2116772 1112 PGR3 "AT4G31850" [Arabidopsis 0.550 0.204 0.261 3.4e-06
TAIR|locus:2039558799 AT2G26790 [Arabidopsis thalian 0.160 0.082 0.333 4.2e-06
TAIR|locus:2027166 862 PTAC2 "plastid transcriptional 0.628 0.300 0.200 6.8e-06
TAIR|locus:2019085 763 AT1G74580 "AT1G74580" [Arabido 0.686 0.370 0.214 7.5e-06
TAIR|locus:2081041486 PPR2 "pentatricopeptide repeat 0.783 0.664 0.205 1.1e-05
TAIR|locus:2096544 AT3G42630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1078 (384.5 bits), Expect = 4.3e-109, P = 4.3e-109
 Identities = 220/414 (53%), Positives = 281/414 (67%)

Query:     6 LSLHGSFKFKRFNVPSHQTHPKNGDLARKIIRYRK-QEGF------VDCASLVEDLGRKK 58
             LSL+ S K +   + S  T      +A+K+I+  K    F      VD A LV+ L +++
Sbjct:     2 LSLNLSLKPQHLKLLSCYTDSSAPSIAKKLIKESKLSRDFSQKIQIVDYAPLVQTLSQRR 61

Query:    59 KPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFVLEAQXXXXXXXXXXXXXXXXXXX 118
              P +AH++    KS  LLP+  TLCALMLC+A NGFVL A+                   
Sbjct:    62 LPDVAHEIFLQTKSVNLLPNYRTLCALMLCFAENGFVLRARTIWDEIINSCFVPDVFVVS 121

Query:   119 XXMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEMVSR 178
               + AY + GCF+E+  I   V+ R++ LLP V S AISCFGK GQLELME  ++EM S+
Sbjct:   122 KLISAYEQFGCFDEVAKITKDVAARHSKLLPVVSSLAISCFGKNGQLELMEGVIEEMDSK 181

Query:   179 GFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFML 238
             G  +++ T N  + YYS FGSL +ME AYGR+K+   +I++E IRAV   YLK+RKF+ L
Sbjct:   182 GVLLEAETANVIVRYYSFFGSLDKMEKAYGRVKKFGIVIEEEEIRAVVLAYLKQRKFYRL 241

Query:   239 GEFLRDVGLGRKDXXXXXXXXXXXSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVA 298
              EFL DVGLGR++           SYA +FKMKSLQREF+ M +AGF PDLTTFNIRA+A
Sbjct:   242 REFLSDVGLGRRNLGNMLWNSVLLSYAADFKMKSLQREFIGMLDAGFSPDLTTFNIRALA 301

Query:   299 FSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVV 358
             FSRM++FWDLHL+LEHM+  ++ PDLVT+GCVVDAY+DKRL RNL+F  ++MNLDDSP+V
Sbjct:   302 FSRMALFWDLHLTLEHMRRLNIVPDLVTFGCVVDAYMDKRLARNLEFVYNRMNLDDSPLV 361

Query:   359 STDPYVFEAFGKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY 412
              TDP  FE  GKGDFH SSEA LEF  ++ WTYRKLI VYLKK+LRR+QIFWNY
Sbjct:   362 LTDPLAFEVLGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 415




GO:0005739 "mitochondrion" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2129475 AT4G14190 "AT4G14190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157607 AT5G42310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006535 AT4G30825 "AT4G30825" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039558 AT2G26790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081041 PPR2 "pentatricopeptide repeat 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2A1PP263_ARATHNo assigned EC number0.56760.98780.9807yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-05
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score = 47.9 bits (114), Expect = 7e-06
 Identities = 33/94 (35%), Positives = 44/94 (46%), Gaps = 5/94 (5%)

Query: 249 RKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDL 308
            KD+ +  WN+LL  Y  + K       F RM E+G +PD  TF     A SR  M    
Sbjct: 551 EKDVVS--WNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQG 608

Query: 309 HLSLEHMKHE-SVGPDLVTYGCVVDAYLDKRLGR 341
                 M+ + S+ P+L  Y CVVD  L  R G+
Sbjct: 609 LEYFHSMEEKYSITPNLKHYACVVD--LLGRAGK 640


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 412
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.65
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.6
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.6
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.58
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.57
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.53
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.52
KOG2076 895 consensus RNA polymerase III transcription factor 99.52
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.51
KOG2076 895 consensus RNA polymerase III transcription factor 99.51
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.51
PF1304150 PPR_2: PPR repeat family 99.46
KOG2003840 consensus TPR repeat-containing protein [General f 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.43
KOG1126638 consensus DNA-binding cell division cycle control 99.42
PF1304150 PPR_2: PPR repeat family 99.42
KOG1126638 consensus DNA-binding cell division cycle control 99.42
PRK12370553 invasion protein regulator; Provisional 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.39
PRK12370553 invasion protein regulator; Provisional 99.37
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.32
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.31
KOG2003 840 consensus TPR repeat-containing protein [General f 99.3
KOG1129478 consensus TPR repeat-containing protein [General f 99.29
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.27
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.25
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.21
KOG0547606 consensus Translocase of outer mitochondrial membr 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
KOG1129478 consensus TPR repeat-containing protein [General f 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.14
PRK11189296 lipoprotein NlpI; Provisional 99.14
KOG1915677 consensus Cell cycle control protein (crooked neck 99.12
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.12
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.05
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.05
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.04
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.03
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.02
PRK11189296 lipoprotein NlpI; Provisional 99.02
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.01
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.0
KOG0547606 consensus Translocase of outer mitochondrial membr 98.98
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.9
PF1285434 PPR_1: PPR repeat 98.89
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.88
PF1285434 PPR_1: PPR repeat 98.87
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.84
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.83
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.78
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.78
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
KOG1125579 consensus TPR repeat-containing protein [General f 98.74
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.74
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.73
KOG1128777 consensus Uncharacterized conserved protein, conta 98.7
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.68
PRK04841 903 transcriptional regulator MalT; Provisional 98.66
PRK04841903 transcriptional regulator MalT; Provisional 98.66
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.64
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.63
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.59
PLN02789320 farnesyltranstransferase 98.57
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
PRK15359144 type III secretion system chaperone protein SscB; 98.55
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.54
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.54
KOG1128777 consensus Uncharacterized conserved protein, conta 98.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.52
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.51
PLN02789320 farnesyltranstransferase 98.5
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.45
PRK15359144 type III secretion system chaperone protein SscB; 98.45
KOG1125579 consensus TPR repeat-containing protein [General f 98.44
PRK10370198 formate-dependent nitrite reductase complex subuni 98.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.43
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.41
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.4
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.38
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.35
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.35
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.34
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.33
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.33
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.31
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.3
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.26
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.25
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.25
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.25
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.23
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.22
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.19
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.19
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.18
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.16
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.14
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.11
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.09
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.08
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.04
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.04
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.02
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.0
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.0
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.91
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.88
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.8
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.8
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.77
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.75
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.75
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.68
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.68
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.67
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.61
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.61
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.6
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.5
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.5
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.48
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.31
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.28
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.27
PF12688120 TPR_5: Tetratrico peptide repeat 97.27
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.27
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.26
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.24
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.18
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.17
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.16
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.13
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.1
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.08
PF12688120 TPR_5: Tetratrico peptide repeat 97.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.03
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.03
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.99
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.99
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.95
KOG3941406 consensus Intermediate in Toll signal transduction 96.95
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.94
COG4700251 Uncharacterized protein conserved in bacteria cont 96.93
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.83
COG4700251 Uncharacterized protein conserved in bacteria cont 96.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.8
KOG0553304 consensus TPR repeat-containing protein [General f 96.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.75
KOG3941 406 consensus Intermediate in Toll signal transduction 96.75
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.71
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.66
KOG0553304 consensus TPR repeat-containing protein [General f 96.64
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.64
PRK10803263 tol-pal system protein YbgF; Provisional 96.63
PRK10803263 tol-pal system protein YbgF; Provisional 96.62
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.51
COG3898531 Uncharacterized membrane-bound protein [Function u 96.42
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.39
PF1337173 TPR_9: Tetratricopeptide repeat 96.36
PF1337173 TPR_9: Tetratricopeptide repeat 96.26
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.24
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.23
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.23
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.15
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.12
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.11
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.02
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.95
smart00299140 CLH Clathrin heavy chain repeat homology. 95.89
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.87
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.8
COG3898531 Uncharacterized membrane-bound protein [Function u 95.8
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.74
PRK15331165 chaperone protein SicA; Provisional 95.71
smart00299140 CLH Clathrin heavy chain repeat homology. 95.65
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.6
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.44
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.39
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.36
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.31
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.22
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.2
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.15
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.08
PRK15331165 chaperone protein SicA; Provisional 94.99
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.99
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.98
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.98
PRK11906458 transcriptional regulator; Provisional 94.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.83
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.74
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.7
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.64
KOG4555175 consensus TPR repeat-containing protein [Function 94.55
COG3629280 DnrI DNA-binding transcriptional activator of the 94.47
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.41
KOG1585308 consensus Protein required for fusion of vesicles 94.32
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.25
KOG20411189 consensus WD40 repeat protein [General function pr 94.07
PF1342844 TPR_14: Tetratricopeptide repeat 94.06
PF1342844 TPR_14: Tetratricopeptide repeat 93.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.86
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.8
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.69
COG3629280 DnrI DNA-binding transcriptional activator of the 93.55
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.44
PF13512142 TPR_18: Tetratricopeptide repeat 93.35
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.25
KOG2610491 consensus Uncharacterized conserved protein [Funct 93.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.2
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.99
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.54
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.26
PF13512142 TPR_18: Tetratricopeptide repeat 92.15
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 92.11
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.02
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.0
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.89
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.82
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 91.79
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.57
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.43
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.37
KOG4555175 consensus TPR repeat-containing protein [Function 91.36
COG0457291 NrfG FOG: TPR repeat [General function prediction 91.3
PF13929292 mRNA_stabil: mRNA stabilisation 91.21
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.89
KOG1585308 consensus Protein required for fusion of vesicles 90.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.68
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.44
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.39
PF1343134 TPR_17: Tetratricopeptide repeat 90.0
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.98
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 89.87
PF1343134 TPR_17: Tetratricopeptide repeat 89.79
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.76
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 89.72
PRK11906458 transcriptional regulator; Provisional 89.57
PF13762145 MNE1: Mitochondrial splicing apparatus component 89.21
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.18
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.64
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 87.34
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.28
PRK09687280 putative lyase; Provisional 87.03
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.7
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.44
COG3947361 Response regulator containing CheY-like receiver a 86.07
PRK09687280 putative lyase; Provisional 85.84
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.68
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.64
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.28
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 85.16
PF13762145 MNE1: Mitochondrial splicing apparatus component 84.8
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.62
PF13929292 mRNA_stabil: mRNA stabilisation 84.44
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 84.05
COG4455273 ImpE Protein of avirulence locus involved in tempe 84.05
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.84
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.6
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 83.08
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 82.6
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 82.17
PHA02875413 ankyrin repeat protein; Provisional 81.6
COG4455273 ImpE Protein of avirulence locus involved in tempe 80.99
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.84
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-64  Score=499.08  Aligned_cols=383  Identities=14%  Similarity=0.109  Sum_probs=348.7

Q ss_pred             cccccccccCCCChHHHHHHHHHhhccChhhHHHHHHHHhcCCChhHHHHHHHHHHhcCCCCCHHhHHHHHHHHHhcCCh
Q 040580           16 RFNVPSHQTHPKNGDLARKIIRYRKQEGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFV   95 (412)
Q Consensus        16 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~   95 (412)
                      +..++..|.+.|.+++|..+|+.|..||..+|+.+|.+|++.|+++.|.++|++|.+.|+.||..+|+.||.+|++.|++
T Consensus       409 ~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~v  488 (1060)
T PLN03218        409 HAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKV  488 (1060)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCH
Confidence            34566667777888888888888888888899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCCCcCHHHHHHHHHHHHccCCHHHHHHHHHHHhhcCCCCCHHhHHHHHHHHHhcCChHHHHHHHHHH
Q 040580           96 LEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEM  175 (412)
Q Consensus        96 ~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m  175 (412)
                      ++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.++.||..+|+.+|.+|++.|++++|.++|++|
T Consensus       489 d~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM  568 (1060)
T PLN03218        489 DAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEM  568 (1060)
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HH--CCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcccHHHHHHHHHHHhcCCCCcc
Q 040580          176 VS--RGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLG  253 (412)
Q Consensus       176 ~~--~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~  253 (412)
                      ..  .|+.||..+|+++|.+|++.|++++|.++|+.|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|...+..||
T Consensus       569 ~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD  648 (1060)
T PLN03218        569 KAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPD  648 (1060)
T ss_pred             HHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCC
Confidence            76  6789999999999999999999999999999999999999999999999999999999999999999998888888


Q ss_pred             hHHHHHHHHHHhcCCChHHHHHHHHHHHHcCCCCcHhHHHHHHHHHHccCChhHHHHHHHHHHhCCCCCCHhhHHHHHHH
Q 040580          254 NLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDA  333 (412)
Q Consensus       254 ~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~  333 (412)
                      ..+|+++|.+|++.|++++|.++|++|.+.|+.||..+|++||.+|++.|++++|.++|++|.+.|+.||..+|+.||.+
T Consensus       649 ~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~g  728 (1060)
T PLN03218        649 EVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITA  728 (1060)
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccccchHHHHHHhc-cCCCCCCcccHHHHHHHHhc-CCcccHHHHHHHhcc----CchHHHHHHHHHH
Q 040580          334 YLDKRLGRNLDFGLSKM-NLDDSPVVSTDPYVFEAFGK-GDFHSSSEAFLEFKR----QRKWTYRKLIAVY  398 (412)
Q Consensus       334 ~~~~~~~~~a~~~~~~m-~~~~~p~~~~~~~li~~~~~-~~~~~a~~~~~~~~~----~~~~~~~~l~~~~  398 (412)
                      |++.|++++|.+++++| ..+..||..||+.++.+|++ |+.++|.+++.+|..    ||..+|++++..|
T Consensus       729 y~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc  799 (1060)
T PLN03218        729 LCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLC  799 (1060)
T ss_pred             HHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Confidence            99999999999999999 77889999999999999988 999999999999876    8889999988653



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 68.7 bits (167), Expect = 2e-12
 Identities = 75/453 (16%), Positives = 140/453 (30%), Gaps = 116/453 (25%)

Query: 13  KFKRFNVPSHQTHPKNGDLARKIIRYRKQEGFVDC-------ASLVEDLGRKKKPHLAH- 64
            F ++NV   Q + K   L + ++  R  +  +           +  D+    K      
Sbjct: 125 VFAKYNVSRLQPYLK---LRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMD 181

Query: 65  ------QLVNTVKSEGLLPDNSTLCALMLC----YANNGFVLEAQVVWEE------LLSS 108
                  L N    E +L     L   +       +++   ++ ++   +      L S 
Sbjct: 182 FKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK 241

Query: 109 SFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCR---------NADLLPEVYSRAISCF 159
            +   + VL ++ +A        +  +  + +SC+           D L    +  IS  
Sbjct: 242 PYENCLLVLLNVQNA--------KAWNAFN-LSCKILLTTRFKQVTDFLSAATTTHISLD 292

Query: 160 GKQGQLELMENTLKEMVSRGFSVDSA-------TGNAFIIYYSRFGSLTEMETAYGRLKR 212
                L   E  +K ++ +              T N   +  S          A      
Sbjct: 293 HHSMTLTPDE--VKSLLLKYLDCRPQDLPREVLTTNPRRL--SIIAESIRDGLA--TWDN 346

Query: 213 SRHL-IDK-EGIRAVSFTYLKE---RKFF-MLGEFLRDVGLGRKDLGNLLWNLLLLSYAG 266
            +H+  DK   I   S   L+    RK F  L  F     +    L  L+W  ++     
Sbjct: 347 WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLS-LIWFDVI----K 401

Query: 267 NFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMK--HESVGPDL 324
           +  M  +  +  + S     P  +T +I        S++ +L + LE+    H S+    
Sbjct: 402 SDVMVVVN-KLHKYSLVEKQPKESTISI-------PSIYLELKVKLENEYALHRSI---- 449

Query: 325 VTYGCVVDAYLDKRLGRNLDFGLSKMNLDDSPVVSTDPYVFEAFGKGDFH----SSSEAF 380
                 VD Y    + +  D        DD      D Y +   G    H       E  
Sbjct: 450 ------VDHY---NIPKTFD-------SDDLIPPYLDQYFYSHIG---HHLKNIEHPERM 490

Query: 381 LEFKRQRKW--TYRKLIAVYLKKQLRRNQIFWN 411
             F   R     +R     +L++++R +   WN
Sbjct: 491 TLF---RMVFLDFR-----FLEQKIRHDSTAWN 515


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.82
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.63
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.51
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.47
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.47
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.41
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.41
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.41
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.4
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.36
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.25
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.17
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.17
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.13
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.97
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.97
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.89
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.87
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.87
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.84
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.84
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.75
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.73
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.73
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.71
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.69
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.68
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.66
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.64
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.62
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.58
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.53
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.53
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.45
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.44
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.42
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.4
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.39
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.39
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.33
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.31
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.31
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.31
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.28
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.27
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.26
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.25
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.25
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.17
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.13
3k9i_A117 BH0479 protein; putative protein binding protein, 98.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
3k9i_A117 BH0479 protein; putative protein binding protein, 98.07
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.94
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.9
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.79
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.73
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.71
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.66
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.66
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.65
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.64
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.63
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.62
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.61
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.54
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.52
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.48
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.43
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.23
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.14
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.07
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.04
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.95
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.57
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.55
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.53
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.16
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.99
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.71
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.62
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.51
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.51
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.3
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.93
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.77
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.67
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.53
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.62
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.29
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.83
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.77
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.64
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.55
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.41
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.96
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.88
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 90.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.43
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 89.31
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.19
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 88.97
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 88.96
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 84.91
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.77
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 84.5
2p58_C116 Putative type III secretion protein YSCG; type III 84.07
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 82.53
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.35
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 80.94
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.71
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.6e-36  Score=290.66  Aligned_cols=388  Identities=9%  Similarity=-0.066  Sum_probs=312.0

Q ss_pred             hccccccccccCCCChHHHHHHHHHhhc--cChhhHHHHHHHHhcCCChhHHHHHHHHHHhcCCCCCHHhHHHHHHHHHh
Q 040580           14 FKRFNVPSHQTHPKNGDLARKIIRYRKQ--EGFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYAN   91 (412)
Q Consensus        14 ~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~   91 (412)
                      ..++.++..|.+.|++++|..+|+++..  |+..++..++.+|.+.|++++|..+|+++...  +++..+++.++.+|.+
T Consensus        85 ~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~  162 (597)
T 2xpi_A           85 DYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYLAAFCLVK  162 (597)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHHHHHHHHH
Confidence            3467777788888888888888887753  56677777888888888888888888777543  5677778888888888


Q ss_pred             cCChHHHHHHHHHHHh-C--------------CCCcCHHHHHHHHHHHHccCCHHHHHHHHHHHhhcCC-----------
Q 040580           92 NGFVLEAQVVWEELLS-S--------------SFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNA-----------  145 (412)
Q Consensus        92 ~~~~~~a~~~~~~m~~-~--------------~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~-----------  145 (412)
                      .|++++|.++|+++.. .              +.+++..+|+.++.+|.+.|++++|.++|++|.+.+.           
T Consensus       163 ~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~  242 (597)
T 2xpi_A          163 LYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVS  242 (597)
T ss_dssp             TTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             HhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHH
Confidence            8888888887774322 1              2344677788888888888888888777777754321           


Q ss_pred             -----------------------------------------------------------CCCHHhHHHHHHHHHhcCChH
Q 040580          146 -----------------------------------------------------------DLLPEVYSRAISCFGKQGQLE  166 (412)
Q Consensus       146 -----------------------------------------------------------~~~~~~~~~li~~~~~~g~~~  166 (412)
                                                                                 ++++.+|+.++.+|.+.|+++
T Consensus       243 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  322 (597)
T 2xpi_A          243 NHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFI  322 (597)
T ss_dssp             TTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHH
T ss_pred             hhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHH
Confidence                                                                       256667888888888888888


Q ss_pred             HHHHHHHHHHHCCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcccHHHHHHHHHHHh
Q 040580          167 LMENTLKEMVSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVG  246 (412)
Q Consensus       167 ~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~  246 (412)
                      +|+.+|+++.+.+.. +..++..++.++.+.|++++|..+++.+.+.. +.+..+++.++.+|.+.|++++|.+.|+++.
T Consensus       323 ~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  400 (597)
T 2xpi_A          323 DVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSS  400 (597)
T ss_dssp             HHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHH
Confidence            888888888876432 66778888888888888888888888887543 4578899999999999999999999999875


Q ss_pred             cCCCCcchHHHHHHHHHHhcCCChHHHHHHHHHHHHcCCCCcHhHHHHHHHHHHccCChhHHHHHHHHHHhCCCCCCHhh
Q 040580          247 LGRKDLGNLLWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPDLTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVT  326 (412)
Q Consensus       247 ~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~  326 (412)
                      ...+. +..+|+.++.+|.+.|++++|+.+|+++.+.+ +++..+|..++.+|.+.|++++|.++|+++.+... .+..+
T Consensus       401 ~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~  477 (597)
T 2xpi_A          401 TMDPQ-FGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQ-YDPLL  477 (597)
T ss_dssp             HHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCC-CCHHH
T ss_pred             HhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CChHH
Confidence            54333 45899999999999999999999999998764 45788999999999999999999999999987532 36889


Q ss_pred             HHHHHHHHHhccccchHHHHHHhc-cC----CCCCC--cccHHHHHHHHhc-CCcccHHHHHHHhcc---CchHHHHHHH
Q 040580          327 YGCVVDAYLDKRLGRNLDFGLSKM-NL----DDSPV--VSTDPYVFEAFGK-GDFHSSSEAFLEFKR---QRKWTYRKLI  395 (412)
Q Consensus       327 ~~~li~~~~~~~~~~~a~~~~~~m-~~----~~~p~--~~~~~~li~~~~~-~~~~~a~~~~~~~~~---~~~~~~~~l~  395 (412)
                      |+.+...|.+.|++++|.++++++ ..    +..|+  ..++..+..+|.+ |++++|.+.+.++..   .+..+|..++
T Consensus       478 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~  557 (597)
T 2xpi_A          478 LNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIA  557 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHH
T ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHH
Confidence            999999999999999999999998 44    55677  5688888998877 999999999988654   5889999999


Q ss_pred             HHHHHcCcccccc
Q 040580          396 AVYLKKQLRRNQI  408 (412)
Q Consensus       396 ~~~~~~g~~~~a~  408 (412)
                      .+|.+.|++++|.
T Consensus       558 ~~~~~~g~~~~A~  570 (597)
T 2xpi_A          558 LVYLHKKIPGLAI  570 (597)
T ss_dssp             HHHHHTTCHHHHH
T ss_pred             HHHHHhCCHHHHH
Confidence            9999999999983



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.22
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.21
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.2
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.18
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.03
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.02
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.84
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.48
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.43
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.41
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.27
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.22
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.22
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.18
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.1
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.04
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.85
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.84
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.83
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.77
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.76
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.71
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.68
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.62
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.61
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.5
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.42
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.28
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.9
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.79
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.78
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.04
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.51
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.42
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.65
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.86
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.63
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.03
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.97
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.13
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=6.9e-20  Score=164.48  Aligned_cols=375  Identities=9%  Similarity=-0.063  Sum_probs=300.0

Q ss_pred             ccccccCCCChHHHHHHHHHhhcc---ChhhHHHHHHHHhcCCChhHHHHHHHHHHhcCCCCCHHhHHHHHHHHHhcCCh
Q 040580           19 VPSHQTHPKNGDLARKIIRYRKQE---GFVDCASLVEDLGRKKKPHLAHQLVNTVKSEGLLPDNSTLCALMLCYANNGFV   95 (412)
Q Consensus        19 l~~~~~~~~~~~~A~~~~~~~~~~---~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~   95 (412)
                      +...+.+.|++++|.+.++++.+.   +..++..+...+.+.|++++|...|++..+.. +-+..++..+...+.+.|++
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccc
Confidence            344566889999999999987642   66788889999999999999999999998864 33678899999999999999


Q ss_pred             HHHHHHHHHHHhCCCCcCHHHHHHHHHHHHccCCHHHHHHHHHHHhhcCCCCCHHhHHHHHHHHHhcCChHHHHHHHHHH
Q 040580           96 LEAQVVWEELLSSSFVLSVQVLSDLMDAYGRIGCFNEIISIIDQVSCRNADLLPEVYSRAISCFGKQGQLELMENTLKEM  175 (412)
Q Consensus        96 ~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m  175 (412)
                      ++|...+....+.. +.+..............+....+........... .................+....+...+.+.
T Consensus        84 ~~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (388)
T d1w3ba_          84 QEAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACYLKA  161 (388)
T ss_dssp             HHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHHH
T ss_pred             cccccccccccccc-cccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHHHHh
Confidence            99999999998875 5556666666666667777777776666665554 344556666777778888888888888887


Q ss_pred             HHCCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcccHHHHHHHHHHHhcCCCCcchH
Q 040580          176 VSRGFSVDSATGNAFIIYYSRFGSLTEMETAYGRLKRSRHLIDKEGIRAVSFTYLKERKFFMLGEFLRDVGLGRKDLGNL  255 (412)
Q Consensus       176 ~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~  255 (412)
                      ..... -+...+..+...+...|+++.|...++...+.. +-+...+..+...+...|++++|...+++.....+. +..
T Consensus       162 ~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-~~~  238 (388)
T d1w3ba_         162 IETQP-NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-HAV  238 (388)
T ss_dssp             HHHCT-TCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-CHH
T ss_pred             hccCc-chhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh-HHH
Confidence            76532 245677788888999999999999999988754 336778899999999999999999999986554443 357


Q ss_pred             HHHHHHHHHhcCCChHHHHHHHHHHHHcCCCCc-HhHHHHHHHHHHccCChhHHHHHHHHHHhCCCCCCHhhHHHHHHHH
Q 040580          256 LWNLLLLSYAGNFKMKSLQREFMRMSEAGFHPD-LTTFNIRAVAFSRMSMFWDLHLSLEHMKHESVGPDLVTYGCVVDAY  334 (412)
Q Consensus       256 ~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~  334 (412)
                      .+..+...+.+.|++++|+..|++..+.  .|+ ..++..+...+...|++++|...++...... +.+...+..+...+
T Consensus       239 ~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         239 VHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHH
Confidence            8888999999999999999999998875  454 6788889999999999999999999877643 34677888899999


Q ss_pred             HhccccchHHHHHHhc-cCCCCCCcccHHHHHHHHhc-CCcccHHHHHHHhc---cCchHHHHHHHHHHHHcCc
Q 040580          335 LDKRLGRNLDFGLSKM-NLDDSPVVSTDPYVFEAFGK-GDFHSSSEAFLEFK---RQRKWTYRKLIAVYLKKQL  403 (412)
Q Consensus       335 ~~~~~~~~a~~~~~~m-~~~~~p~~~~~~~li~~~~~-~~~~~a~~~~~~~~---~~~~~~~~~l~~~~~~~g~  403 (412)
                      .+.|++++|.+.+++. ...+ -+...+..+-..|.+ |++++|.+.+.+..   |.++..|..++.+|.+.||
T Consensus       316 ~~~~~~~~A~~~~~~al~~~p-~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVFP-EFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSCT-TCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999997 4332 233445555666766 99999999998754   4568899999999999886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure