Score = 63.9 bits (154), Expect = 2e-10, Method: Composition-based stats.
Identities = 31/56 (55%), Positives = 41/56 (73%)
Query: 56 EVKRLGSIAGPMVAVNLSQYSLQVISVMMVGHLGELFLSSTAIAISFSAVTGFSLL 111
E+KR+ +A PM V ++QY L VISVM+ GH GEL LS A+A SF+ VTGFS++
Sbjct: 27 ELKRVSRLAAPMATVTIAQYLLPVISVMVAGHNGELQLSGVALANSFTNVTGFSIM 82
Efflux carrier for plant-derived alkaloids, antibiotics, heavy metal and other toxic compounds. Involved in cadmium detoxification. Requires probably a proton-motive force for the efflux.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GXM8|MATE7_ARATH MATE efflux family protein 7 OS=Arabidopsis thaliana GN=DTXL3 PE=2 SV=1
Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.
Mus musculus (taxid: 10090)
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|15223961|ref|NP_177270.1| MATE efflux family protein [Arabidopsis thaliana] gi|12323428|gb|AAG51691.1|AC016972_10 hypothetical protein; 49518-51504 [Arabidopsis thaliana] gi|332197044|gb|AEE35165.1| MATE efflux family protein [Arabidopsis thaliana]
The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. MATE has also been identified as a large multigene family in plants, where the proteins are linked to disease resistance. A number of family members are involved in the synthesis of peptidoglycan components in bacteria. This subfamily, which is restricted to eukaryotes, contains vertebrate solute transporters responsible for secretion of cationic drugs across the brush border membranes, yeast proteins located in the vacuole membrane, and plant proteins involved in disease resistance and iron homeostatis under osmotic stress. Length = 436
>gnl|CDD|240536 cd13131, MATE_NorM_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Vibrio cholerae NorM
Score = 42.1 bits (100), Expect = 1e-05
Identities = 13/47 (27%), Positives = 26/47 (55%)
Query: 56 EVKRLGSIAGPMVAVNLSQYSLQVISVMMVGHLGELFLSSTAIAISF 102
E++ L +A P++ L+Q ++ + +M G LG L++ A+ S
Sbjct: 1 ELRALLRLALPILIAQLAQMAMGFVDTVMAGRLGADDLAAVALGSSL 47
The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Vibrio cholerae NorM and functions most likely as a multidrug efflux pump, removing xenobiotics from the interior of the cell. The pump utilizes a cation gradient across the membrane to facilitate the export process. NorM appears to bind monovalent cations in an outward-facing conformation and may subsequently cycle through an inward-facing and outward-facing conformation to capture and release its substrate. Length = 435
The MATE family consists of probable efflux proteins including a functionally characterized multi drug efflux system from Vibrio parahaemolyticus, a putative ethionine resistance protein of Saccharomyces cerevisiae, and the functionally uncharacterized DNA damage-inducible protein F (DinF) of E. coli. These proteins have 12 probable TMS.
>PF01554 MatE: MatE; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters
These proteins mediate resistance to a wide range of cationic dyes, fluroquinolones, aminoglycosides and other structurally diverse antibodies and drugs. MATE proteins are found in bacteria, archaea and eukaryotes. These proteins are predicted to have 12 alpha-helical transmembrane regions, some of the animal proteins may have an additional C-terminal helix. ; GO: 0015238 drug transmembrane transporter activity, 0015297 antiporter activity, 0006855 drug transmembrane transport, 0055085 transmembrane transport, 0016020 membrane; PDB: 3MKU_B 3MKT_B.
>PRK10367 DNA-damage-inducible SOS response protein; Provisional
>PF01943 Polysacc_synt: Polysaccharide biosynthesis protein; InterPro: IPR002797 Members of this family are integral membrane proteins [], and many are implicated in the production of polysaccharide
The family includes RfbX part of the O antigen biosynthesis operon [], and SpoVB from Bacillus subtilis (Q00758 from SWISSPROT), which is involved in spore cortex biosynthesis [].; GO: 0000271 polysaccharide biosynthetic process, 0016020 membrane
>PRK10189 MATE family multidrug exporter; Provisional
The MATE family consists of probable efflux proteins including a functionally characterized multi drug efflux system from Vibrio parahaemolyticus, a putative ethionine resistance protein of Saccharomyces cerevisiae, and the functionally uncharacterized DNA damage-inducible protein F (DinF) of E. coli. These proteins have 12 probable TMS.
This model represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions. Although frequently listed as a virulence protein, it is not restricted to pathogens and it is an essential protein in Sinorhizobium meliloti. In a number of species its gene is adjacent to that of the uridylyltransferase GlnD, the signal-transducing enzyme that performs the key modification to the nitrogen regulatory protein PII.
SpoVB is the stage V sporulation protein B of the bacterial endopore formation program in Bacillus subtilis and various other Firmcutes. It is nearly universal among endospore-formers. Paralogs with rather high sequence similarity to SpoVB exist, including YkvU in B. subtilis and a number of proteins in the genus Clostridium. Member sequences for the seed alignment were chosen to select those proteins, no more than one to a genome, closest to B. subtilis SpoVB in a neighbor joining tree.
This model represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions. Although frequently listed as a virulence protein, it is not restricted to pathogens and it is an essential protein in Sinorhizobium meliloti. In a number of species its gene is adjacent to that of the uridylyltransferase GlnD, the signal-transducing enzyme that performs the key modification to the nitrogen regulatory protein PII.
>PF03023 MVIN: MviN-like protein; InterPro: IPR004268 This entry represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions
Although frequently listed as a virulence protein, it is not restricted to pathogens and it is an essential protein in Sinorhizobium meliloti. In a number of species its gene is adjacent to that of the uridylyltransferase GlnD, the signal-transducing enzyme that performs the key modification to the nitrogen regulatory protein PII []. Disruption of the MviN open reading frame results in flagellar structures that contain only the basal body and hook complex that lack the flagellum; suggesting that MviN might be involved in flagellin export or assembly []. Genome comparison studies led to MviN being predicted to be a peptidoglycan lipid II flippase though currently there is no direct evidence to support this annotation [].
>TIGR02900 spore_V_B stage V sporulation protein B
SpoVB is the stage V sporulation protein B of the bacterial endopore formation program in Bacillus subtilis and various other Firmcutes. It is nearly universal among endospore-formers. Paralogs with rather high sequence similarity to SpoVB exist, including YkvU in B. subtilis and a number of proteins in the genus Clostridium. Member sequences for the seed alignment were chosen to select those proteins, no more than one to a genome, closest to B. subtilis SpoVB in a neighbor joining tree.
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only]
