Citrus Sinensis ID: 040874

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQNQ
ccccccEEEcccccHHHHHHHHccccccccccEEEEcHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEcccEEEEEcccccccccccccccHHHHccccccccEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccc
cccHHHHHHHHccHHHHHHHHHccccccccccEEEccHHHHHHHHHccccccccHHHcHcHHHHcccccccccccEEEEEEEccEEEEEEccHHHHHccccccccHHHHHcHHHcccEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcc
mnlcasidgifnnlslpfnkvkAKSASYMAADLvsvgdpwlSFAIEKRLiepiaggedqdwfKCLSHKWKRTRGKIWAAPYRWGAMMIAYKkskfrkhdlapiedwkdlwrpelagrismvnspREVIGSVLKYMGasynsnnidsqvagGKVAVQQNLALLQNQ
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIepiaggedqdWFKCLshkwkrtrgkiwaapyrWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAgrismvnsprEVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQNQ
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKvavqqnlallqnq
***CASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAV**********
*NLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALL***
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQNQ
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQN*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLCASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
P44731 350 Spermidine/putrescine-bin yes no 0.745 0.351 0.242 0.0003
>sp|P44731|POTD2_HAEIN Spermidine/putrescine-binding periplasmic protein 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potD-A PE=3 SV=2 Back     alignment and function desciption
 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 5/128 (3%)

Query: 18  FNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRG--K 75
           + K+K    +    DLV     +++  I++++++PI   +  +  +   H   +      
Sbjct: 67  YAKLKLTQNTGSGYDLVFPSSYYVNKMIKEKMLQPIDQSKLTNIHQIPKHLLNKEFDPEN 126

Query: 76  IWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYM 135
            ++ PY +G   I     +    D   I  W DLW+PE  G++ M +  REV    L   
Sbjct: 127 KYSLPYVYGLTGIEVNADEI---DPKTITSWADLWKPEFKGKVLMTSDAREVFHVALLLD 183

Query: 136 GASYNSNN 143
           G S N+ N
Sbjct: 184 GKSPNTTN 191
Required for the activity of the bacterial periplasmic transport system of putrescine and spermidine. Polyamine binding protein.
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (taxid: 71421)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
224074577 424 predicted protein [Populus trichocarpa] 0.981 0.382 0.647 5e-57
225427562 553 PREDICTED: uncharacterized protein LOC10 0.993 0.296 0.628 2e-56
147822062 875 hypothetical protein VITISV_021806 [Viti 0.993 0.187 0.582 1e-55
356559069 552 PREDICTED: uncharacterized protein LOC10 0.975 0.291 0.622 2e-54
255557729 507 transporter, putative [Ricinus communis] 0.987 0.321 0.605 5e-54
449455671 549 PREDICTED: uncharacterized protein LOC10 0.969 0.291 0.614 5e-54
297846532 522 hypothetical protein ARALYDRAFT_473635 [ 0.975 0.308 0.598 1e-53
28393765 524 unknown protein [Arabidopsis thaliana] 0.969 0.305 0.596 8e-53
357517389 786 RING-H2 finger protein ATL5F [Medicago t 0.975 0.204 0.581 1e-52
30692516 524 putrescine-binding periplasmic protein-l 0.969 0.305 0.596 1e-52
>gi|224074577|ref|XP_002304393.1| predicted protein [Populus trichocarpa] gi|222841825|gb|EEE79372.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 132/173 (76%), Gaps = 11/173 (6%)

Query: 4   CASIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFK 63
             S++ IF+++S  FNK      S +A+D+VSVGD WLSFAI+  +IEP+ G E+QDWFK
Sbjct: 58  LGSLENIFSDISASFNKRNIGPMSTVASDIVSVGDSWLSFAIKNAIIEPVRGVEEQDWFK 117

Query: 64  CLSHKWK-----------RTRGKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRP 112
            LS KWK              G+IWAAPYRWG+M+IAYKKSKF++H LAPIEDW DLWRP
Sbjct: 118 GLSDKWKVYLRRNHEGEIDPEGEIWAAPYRWGSMVIAYKKSKFQEHKLAPIEDWADLWRP 177

Query: 113 ELAGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGKVAVQQNLALLQNQ 165
           ELAGRISMV+SPREV+GSVLKYMGASYN+ NID QV GGK AVQQNLALL  Q
Sbjct: 178 ELAGRISMVDSPREVVGSVLKYMGASYNTKNIDLQVPGGKNAVQQNLALLGKQ 230

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427562|ref|XP_002266662.1| PREDICTED: uncharacterized protein LOC100242504 [Vitis vinifera] gi|296085502|emb|CBI29234.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822062|emb|CAN68081.1| hypothetical protein VITISV_021806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559069|ref|XP_003547824.1| PREDICTED: uncharacterized protein LOC100781794 [Glycine max] Back     alignment and taxonomy information
>gi|255557729|ref|XP_002519894.1| transporter, putative [Ricinus communis] gi|223540940|gb|EEF42498.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449455671|ref|XP_004145575.1| PREDICTED: uncharacterized protein LOC101211357 [Cucumis sativus] gi|449485058|ref|XP_004157059.1| PREDICTED: uncharacterized protein LOC101230567 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297846532|ref|XP_002891147.1| hypothetical protein ARALYDRAFT_473635 [Arabidopsis lyrata subsp. lyrata] gi|297336989|gb|EFH67406.1| hypothetical protein ARALYDRAFT_473635 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|28393765|gb|AAO42292.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357517389|ref|XP_003628983.1| RING-H2 finger protein ATL5F [Medicago truncatula] gi|355523005|gb|AET03459.1| RING-H2 finger protein ATL5F [Medicago truncatula] Back     alignment and taxonomy information
>gi|30692516|ref|NP_174426.2| putrescine-binding periplasmic protein-like protein [Arabidopsis thaliana] gi|51536594|gb|AAU05535.1| At1g31410 [Arabidopsis thaliana] gi|332193231|gb|AEE31352.1| putrescine-binding periplasmic protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
TAIR|locus:2206194 524 AT1G31410 [Arabidopsis thalian 0.890 0.280 0.607 3.3e-47
TIGR_CMR|BA_1300 345 BA_1300 "spermidine/putrescine 0.381 0.182 0.426 9.9e-07
UNIPROTKB|Q9KS37 345 VC1424 "Spermidine/putrescine 0.751 0.359 0.274 0.0003
TIGR_CMR|VC_1424 345 VC_1424 "spermidine/putrescine 0.751 0.359 0.274 0.0003
TIGR_CMR|CPS_2036 342 CPS_2036 "spermidine/putrescin 0.757 0.365 0.208 0.00048
UNIPROTKB|P31133 370 potF "putrescine ABC transport 0.806 0.359 0.238 0.00074
UNIPROTKB|P0AFK9 348 potD "putrescine / spermidine 0.387 0.183 0.318 0.00093
TAIR|locus:2206194 AT1G31410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 494 (179.0 bits), Expect = 3.3e-47, P = 3.3e-47
 Identities = 96/158 (60%), Positives = 120/158 (75%)

Query:     6 SIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCL 65
             +++ IF +LS P    K  +AS  AAD++S+GD WLSFAI+++LIEP+ G EDQDW+K L
Sbjct:   153 NLEEIFFDLSKPSKNGKKGAASTAAADMISIGDSWLSFAIKEKLIEPMKGIEDQDWYKGL 212

Query:    66 SHKWK---RTR--------GKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPEL 114
             S KWK   R          G+ WA PYRWG M+IAYKKSKF+ + LAPIEDW DLWRPEL
Sbjct:   213 SDKWKIYLRRNYAGEKAPDGETWAVPYRWGTMVIAYKKSKFQNYKLAPIEDWADLWRPEL 272

Query:   115 AGRISMVNSPREVIGSVLKYMGASYNSNNIDSQVAGGK 152
             AGRI+MVNSPREV+G+VLKYM ASYN+ ++DSQV GG+
Sbjct:   273 AGRIAMVNSPREVVGAVLKYMRASYNTTDLDSQVPGGR 310
GO:0005215 "transporter activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
TIGR_CMR|BA_1300 BA_1300 "spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KS37 VC1424 "Spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1424 VC_1424 "spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2036 CPS_2036 "spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P31133 potF "putrescine ABC transporter - periplasmic binding protein" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P0AFK9 potD "putrescine / spermidine ABC transporter - periplasmic binding protein" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
COG0687 363 COG0687, PotD, Spermidine/putrescine-binding perip 3e-17
pfam13343 239 pfam13343, SBP_bac_6, Bacterial extracellular solu 2e-09
PRK09501 348 PRK09501, potD, spermidine/putrescine ABC transpor 3e-05
PRK10682 370 PRK10682, PRK10682, putrescine transporter subunit 0.001
>gnl|CDD|223759 COG0687, PotD, Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
 Score = 76.7 bits (189), Expect = 3e-17
 Identities = 35/148 (23%), Positives = 63/148 (42%), Gaps = 21/148 (14%)

Query: 10  IFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKW 69
            F++      K+KA    Y   D+V     +++  I++ L++P+    D+       +  
Sbjct: 63  TFDSNEEMLAKLKAGGGGY---DVVVPSGYFVARLIKEGLLQPL----DKSKLPNWKNLD 115

Query: 70  KRTR-------GKIWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPE-----LAGR 117
                      G  ++ PY WG   IAY   K +  D  P   W DL+ PE         
Sbjct: 116 PEFLNPPKFDPGNKYSVPYFWGTTGIAYNTDKVK--DAPPPTSWADLFDPEKFPGLKGKG 173

Query: 118 ISMVNSPREVIGSVLKYMGASYNSNNID 145
           +++++  REV G+ L  +G S N+ + +
Sbjct: 174 VALLDDDREVFGAALALLGKSPNTTDPE 201

Length = 363
>gnl|CDD|222057 pfam13343, SBP_bac_6, Bacterial extracellular solute-binding protein Back     alignment and domain information
>gnl|CDD|181913 PRK09501, potD, spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182645 PRK10682, PRK10682, putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
COG0687 363 PotD Spermidine/putrescine-binding periplasmic pro 99.95
PRK09501 348 potD spermidine/putrescine ABC transporter peripla 99.93
PRK10682 370 putrescine transporter subunit: periplasmic-bindin 99.89
TIGR03227 367 PhnS 2-aminoethylphosphonate ABC transporter, peri 99.76
TIGR01276 309 thiB thiamine ABC transporter, periplasmic binding 99.71
TIGR03261 334 phnS2 putative 2-aminoethylphosphonate ABC transpo 99.7
PF13343 242 SBP_bac_6: Bacterial extracellular solute-binding 99.65
PRK15046 349 2-aminoethylphosphonate ABC transporter substrate- 99.64
PRK11205 330 tbpA thiamine transporter substrate binding subuni 99.63
TIGR01254 304 sfuA ABC transporter periplasmic binding protein, 99.62
PRK11622 401 hypothetical protein; Provisional 99.61
PF13416 281 SBP_bac_8: Bacterial extracellular solute-binding 99.48
COG2182 420 MalE Maltose-binding periplasmic proteins/domains 99.23
TIGR03850 437 bind_CPR_0540 carbohydrate ABC transporter substra 99.22
TIGR03851 450 chitin_NgcE carbohydrate ABC transporter, N-acetyl 99.21
COG1840 299 AfuA ABC-type Fe3+ transport system, periplasmic c 99.2
PRK09474 396 malE maltose ABC transporter periplasmic protein; 99.18
COG4143 336 TbpA ABC-type thiamine transport system, periplasm 99.15
PRK10974 438 glycerol-3-phosphate transporter periplasmic bindi 99.03
COG1653 433 UgpB ABC-type sugar transport system, periplasmic 98.88
PF02030 493 Lipoprotein_8: Hypothetical lipoprotein (MG045 fam 98.84
PF01547 315 SBP_bac_1: Bacterial extracellular solute-binding 98.6
TIGR00971 315 3a0106s03 sulfate/thiosulfate-binding protein. Thi 98.4
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 98.18
PRK10752 329 sulfate transporter subunit; Provisional 98.17
PRK10852 338 thiosulfate transporter subunit; Provisional 98.17
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 98.13
COG4134 384 ABC-type uncharacterized transport system, peripla 97.9
PRK10677257 modA molybdate transporter periplasmic protein; Pr 97.25
COG1613 348 Sbp ABC-type sulfate transport system, periplasmic 93.45
COG0725258 ModA ABC-type molybdate transport system, periplas 93.15
TIGR03730 273 tungstate_WtpA tungstate ABC transporter binding p 89.85
PRK04168 334 molybdate ABC transporter periplasmic substrate-bi 89.67
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.95  E-value=1.7e-27  Score=194.93  Aligned_cols=149  Identities=26%  Similarity=0.459  Sum_probs=132.5

Q ss_pred             ccccccCCCchHHHHHHhhcCCCCCccEEEeChHHHHHHHHcCcccccCCCCCcchhcccccccc----cCCCceEeeee
Q 040874            6 SIDGIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWK----RTRGKIWAAPY   81 (165)
Q Consensus         6 ~v~~~~~~~~~~~~kl~a~~~~~~~~Dv~~~~~~~~~~~~~~gll~pld~~~~~~~~~~i~~~~~----~~~g~~y~vP~   81 (165)
                      -++++|+|++++.+|++++..+   |||++++..++.+++++|+|+|||.+++ +|++++.+.+.    .++|+.|+|||
T Consensus        59 V~~~~~~sne~~~ak~~~g~~~---~Dvv~~s~~~~~~~~~~gll~~lD~skl-~n~~~l~~~~~~~~~~d~g~~y~vPy  134 (363)
T COG0687          59 VVYDTFDSNEEMLAKLKAGGGG---YDVVVPSGYFVARLIKEGLLQPLDKSKL-PNWKNLDPEFLNPPKFDPGNKYSVPY  134 (363)
T ss_pred             EEEEecCCcHHHHHHHHcCCCC---ceEEEeCHHHHHHHHHcCCcccCChhhC-cCccccCHHHhccccCCCCCEeeeeE
Confidence            3567889999999999999874   9999999999999999999999999997 88888888764    35788999999


Q ss_pred             eecceEEEEechhcccCCCCCCCCHHHhcCcc----cCCc-eeeecChHHHHHHHHHHhCCCCCCCChH-HHhcchh-hh
Q 040874           82 RWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPE----LAGR-ISMVNSPREVIGSVLKYMGASYNSNNID-SQVAGGK-VA  154 (165)
Q Consensus        82 ~~~~~~i~YN~~~v~~~g~~~p~sw~dL~d~~----~kgk-i~~~d~~~~~~~~al~~~G~~~~~~~~~-~~~a~~~-~~  154 (165)
                      .||+++|+||+++++.  .++|+||++||+++    +||+ +.+.|+++.++.+++.++|.++|..+++ +.+|.++ .+
T Consensus       135 ~~g~t~i~Yn~~~~~~--~~~~~sW~~l~d~~~~~~~k~~~~~~~d~~~~~~~~al~~lg~~~n~~~~~~~~~a~~~L~~  212 (363)
T COG0687         135 FWGTTGIAYNTDKVKD--APPPTSWADLFDPEKFPGLKGKGVALLDDDREVFGAALALLGKSPNTTDPEDLKKAFDLLDK  212 (363)
T ss_pred             EeeeeEEEEeccccCC--CCCCccHHHHhCchhhHHHhCCceEEecChHHHHHHHHHHcCCCCCCCCHHHHHHHHHHHHH
Confidence            9999999999999982  13789999999997    7998 8999999999999999999999888886 8899888 89


Q ss_pred             hhh-hHH
Q 040874          155 VQQ-NLA  160 (165)
Q Consensus       155 lk~-~v~  160 (165)
                      +|| ++.
T Consensus       213 ~kp~~~~  219 (363)
T COG0687         213 LKPVNVY  219 (363)
T ss_pred             hCcccEE
Confidence            999 443

>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information
>PF13343 SBP_bac_6: Bacterial extracellular solute-binding protein; PDB: 2QRY_D 1XVX_A 1SI1_A 1SI0_A 1Q35_A 1Y9U_A 2OWS_A 2OWT_A 2VP1_A 2VOZ_A Back     alignment and domain information
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>PRK11622 hypothetical protein; Provisional Back     alignment and domain information
>PF13416 SBP_bac_8: Bacterial extracellular solute-binding protein; PDB: 2FNC_A 1ELJ_A 3TTM_B 3TTK_C 2W7Y_A 3RPW_A 2GHB_C 2GHA_A 1POY_3 1POT_A Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03850 bind_CPR_0540 carbohydrate ABC transporter substrate-binding protein, CPR_0540 family Back     alignment and domain information
>TIGR03851 chitin_NgcE carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02030 Lipoprotein_8: Hypothetical lipoprotein (MG045 family) Back     alignment and domain information
>PF01547 SBP_bac_1: Bacterial extracellular solute-binding protein; InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate/thiosulfate-binding protein Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03730 tungstate_WtpA tungstate ABC transporter binding protein WtpA Back     alignment and domain information
>PRK04168 molybdate ABC transporter periplasmic substrate-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
4gl0_A 333 Putative SpermidinePUTRESCINE ABC TRANSPORTER FROM 7e-06
4eqb_A 330 1.5 Angstrom Crystal Structure Of SpermidinePUTRESC 9e-06
3ttk_A 345 Crystal Structure Of Apo-Spud Length = 345 2e-05
3ttm_A 346 Crystal Structure Of Spud In Complex With Putrescin 2e-05
1a99_A 344 Putrescine Receptor (Potf) From E. Coli Length = 34 1e-04
1pot_A 325 Spermidine/putrescine-binding Protein Complexed Wit 2e-04
1poy_1 323 SpermidinePUTRESCINE-Binding Protein Complexed With 2e-04
>pdb|4GL0|A Chain A, Putative SpermidinePUTRESCINE ABC TRANSPORTER FROM LISTERIA Monocytogenes Length = 333 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)
Query: 77  WAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMG 136
           ++ PY WG + I Y K  F   +    + W  L+ PEL  +I +++  REV G  L  +G
Sbjct: 108 YSXPYFWGTLGIIYNKEXFPDKNF---DTWNALFDPELKNQILLIDGAREVXGLGLNSLG 164
Query: 137 ASYNSNN 143
            S N  N
Sbjct: 165 YSLNDTN 171
>pdb|4EQB|A Chain A, 1.5 Angstrom Crystal Structure Of SpermidinePUTRESCINE ABC Transporter Substrate-Binding Protein From Streptococcus Pneumoniae Strain Canada Mdr_19a In Complex With Calcium And Hepes. Length = 330 Back     alignment and structure
>pdb|3TTK|A Chain A, Crystal Structure Of Apo-Spud Length = 345 Back     alignment and structure
>pdb|3TTM|A Chain A, Crystal Structure Of Spud In Complex With Putrescine Length = 346 Back     alignment and structure
>pdb|1A99|A Chain A, Putrescine Receptor (Potf) From E. Coli Length = 344 Back     alignment and structure
>pdb|1POT|A Chain A, Spermidine/putrescine-binding Protein Complexed With Spermidine (monomer Form) Length = 325 Back     alignment and structure
>pdb|1POY|1 Chain 1, SpermidinePUTRESCINE-Binding Protein Complexed With Spermidine (Dimer Form) Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
4eqb_A 330 Spermidine/putrescine ABC superfamily ATP binding 4e-21
2v84_A 343 Spermidine/putrescine ABC transporter, periplasmi 5e-21
1pot_A 325 POTD, spermidine/putrescine-binding protein; polya 5e-21
3ttn_A 340 Polyamine transport protein; polyamine binding pro 7e-18
3ttm_A 346 Polyamine transport protein; polyamine binding, pu 1e-17
1a99_A 344 POTF, putrescine-binding protein; transport, perip 1e-17
4edp_A 351 ABC transporter, substrate-binding protein; clostr 9e-17
3pu5_A 333 Extracellular solute-binding protein; structural g 2e-14
3rpw_A 365 ABC transporter; structural genomics, PSI-biology, 9e-14
3thi_A 371 Protein (thiaminase I); thiamin degradation, trans 6e-06
2z8f_A 412 Galacto-N-biose/lacto-N-biose I transporter subst 4e-04
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Length = 330 Back     alignment and structure
 Score = 86.5 bits (215), Expect = 4e-21
 Identities = 29/132 (21%), Positives = 55/132 (41%), Gaps = 17/132 (12%)

Query: 20  KVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKRTRGKIW-- 77
           K+K    +Y   D+    +  ++   ++ L+ P+    D    + + +       + +  
Sbjct: 50  KIKQGGTTY---DIAIPSEYMINKMKDEDLLVPL----DYSKIEGIENIGPEFLNQSFDP 102

Query: 78  ----AAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLK 133
               + PY WG + I Y ++   +      E W DLW+ E    I + +  REV+G  L 
Sbjct: 103 GNKFSIPYFWGTLGIVYNETMVDE----APEHWDDLWKLEYKNSIMLFDGAREVLGLGLN 158

Query: 134 YMGASYNSNNID 145
            +G S NS +  
Sbjct: 159 SLGYSLNSKDPQ 170
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Length = 343 Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Length = 325 Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Length = 340 Back     alignment and structure
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Length = 346 Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Length = 344 Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Length = 351 Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Length = 333 Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Length = 365 Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Length = 371 Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter subst binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Length = 412 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
4gl0_A 333 LMO0810 protein; structural genomics, IDP05673, sp 99.93
4eqb_A 330 Spermidine/putrescine ABC superfamily ATP binding 99.91
3ttm_A 346 Polyamine transport protein; polyamine binding, pu 99.88
3ttn_A 340 Polyamine transport protein; polyamine binding pro 99.87
1pot_A 325 POTD, spermidine/putrescine-binding protein; polya 99.86
4i1d_A 324 ABC transporter substrate-binding protein; structu 99.85
4euo_A 320 ABC transporter, substrate binding protein (polya; 99.82
2v84_A 343 Spermidine/putrescine ABC transporter, periplasmi 99.81
1a99_A 344 POTF, putrescine-binding protein; transport, perip 99.79
3pu5_A 333 Extracellular solute-binding protein; structural g 99.78
3rpw_A 365 ABC transporter; structural genomics, PSI-biology, 99.78
4edp_A 351 ABC transporter, substrate-binding protein; clostr 99.67
2qry_A 330 Thiamine-binding periplasmic protein; thiamin bind 99.55
3e13_X 322 Putative iron-uptake ABC transport system, peripla 99.54
2pt1_A 334 Iron transport protein; C-clamp, iron-binding prot 99.53
1xvx_A 312 YFUA; periplasmic iron binding protein, iron bindi 99.52
1q35_A 320 Iron binding protein FBPA; metal binding protein; 99.48
1nnf_A 309 Iron-utilization periplasmic protein; iron-binding 99.48
3c9h_A 355 ABC transporter, substrate binding protein; struct 99.46
3k01_A 412 Acarbose/maltose binding protein GACH; ABC transpo 99.45
2voz_A 346 FUTA2, periplasmic iron-binding protein; ferric bi 99.44
1elj_A 381 Maltodextrin-binding protein; protein-carbohydrate 99.44
2gha_A 382 Maltose ABC transporter, periplasmic maltose-BIND 99.42
2heu_A 401 Sugar ABC transporter, sugar-binding protein; peri 99.42
3quf_A 414 Extracellular solute-binding protein, family 1; st 99.41
2zyo_A 397 Solute-binding protein; open form, sugar binding p 99.38
1y9u_A 323 Putative iron binding protein; periplasmic binding 99.38
2uvj_A 408 TOGB, ABC type periplasmic sugar-binding protein; 99.38
3uor_A 458 ABC transporter sugar binding protein; ALFA/beta p 99.36
1mh3_A 421 Maltose binding-A1 homeodomain protein chimera; MA 99.36
4hs7_A 420 Bacterial extracellular solute-binding protein, P; 99.36
4g68_A 456 ABC transporter; transport protein; HET: XYS; 1.80 99.34
2gh9_A 386 Maltose/maltodextrin-binding protein; MBP, maltose 99.34
3csg_A 461 MBP, maltose-binding protein monobody YS1 fusion, 99.33
1urs_A 402 Maltose-binding protein; maltodextrin-binding prot 99.33
4hw8_A 420 Bacterial extracellular solute-binding protein, P; 99.33
2z8f_A 412 Galacto-N-biose/lacto-N-biose I transporter subst 99.33
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 99.32
1y4c_A 494 Maltose binding protein fused with designed helica 99.32
1hsj_A 487 Fusion protein consisting of staphylococcus access 99.31
2zxt_A 465 Maltose-binding periplasmic protein, linker, MITO 99.31
2xd3_A 416 MALX, maltose/maltodextrin-binding protein; solute 99.31
2vgq_A 477 Maltose-binding periplasmic protein, mitochondrial 99.31
2xz3_A 463 Maltose ABC transporter periplasmic protein, ENVE 99.31
3oo8_A 415 ABC transporter binding protein ACBH; class 2 SBP 99.3
4exk_A 487 Maltose-binding periplasmic protein, uncharacteri 99.29
4dxb_A 637 RG13, maltose-binding periplasmic protein, beta-la 99.28
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.28
3mq9_A 471 Bone marrow stromal antigen 2 fused to maltose-BI 99.28
3iot_A 449 Maltose-binding protein, huntingtin fusion protei; 99.27
4b3n_A 602 Maltose-binding periplasmic protein, tripartite mo 99.27
3ob4_A 500 Conglutin, maltose ABC transporter periplasmic pro 99.26
1eu8_A 409 Trehalose/maltose binding protein; protein-carbohy 99.26
1r6z_P 509 Chimera of maltose-binding periplasmic protein AN 99.25
4gqo_A 433 LMO0859 protein; virulence, pathogenesis, vaccine 99.25
3n94_A 475 Fusion protein of maltose-binding periplasmic Pro 99.25
3oai_A 507 Maltose-binding periplasmic protein, myelin prote; 99.24
2b3f_A 400 Glucose-binding protein; protein-carbohydrate comp 99.24
3i3v_A 405 Probable secreted solute-binding lipoprotein; tran 99.24
3h3g_A 539 Fusion protein of maltose-binding periplasmic DOM 99.22
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 99.22
3py7_A 523 Maltose-binding periplasmic protein,paxillin LD1, 99.22
3mp6_A 522 MBP, SGF29, maltose-binding periplasmic protein, l 99.2
4aq4_A 419 SN-glycerol-3-phosphate-binding periplasmic prote; 99.2
3thi_A 371 Protein (thiaminase I); thiamin degradation, trans 99.18
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfa 99.18
3osr_A 653 Maltose-binding periplasmic protein, green fluore 99.17
3h4z_A 568 Maltose-binding periplasmic protein fused with Al 99.17
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 99.11
3osq_A 661 Maltose-binding periplasmic protein, green fluore 99.1
2w7y_A 430 FCSSBP, probable sugar ABC transporter, sugar-bind 99.02
3vlv_A 502 ALGQ1; sugar binding protein, alginate; HET: MAW L 98.93
3omb_A 535 Extracellular solute-binding protein, family 1; PS 98.92
3a09_A 490 ALGQ1; sugar binding protein, alginate; HET: MAW B 98.9
1sbp_A 310 Sulfate-binding protein; 1.70A {Salmonella typhimu 98.83
3cg1_A 296 UPF0100 protein PF0080; ABC transporter, binding p 98.41
3cfx_A 296 UPF0100 protein MA_0280; ABC transporter, binding 98.35
3cij_A 295 UPF0100 protein AF_0094; archaeal periplasmic bind 98.31
3cfz_A 292 UPF0100 protein MJ1186; ABC transporter, binding p 98.22
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding 98.08
1atg_A231 MODA, periplasmic molybdate-binding protein; tungs 97.92
3r26_A237 Molybdate-binding periplasmic protein; protein bin 97.82
3gzg_A253 Molybdate-binding periplasmic protein; permease; m 97.62
3k6v_A 354 Solute-binding protein MA_0280; MODA, molybdate, p 90.69
>4gl0_A LMO0810 protein; structural genomics, IDP05673, spermidine, putrescine, ABC transporter, niaid; HET: MSE PGE PG4; 1.92A {Listeria monocytogenes} Back     alignment and structure
Probab=99.93  E-value=7.3e-26  Score=180.62  Aligned_cols=147  Identities=25%  Similarity=0.419  Sum_probs=127.8

Q ss_pred             cccCCCchHHHHHHhhcCCCCCccEEEeChHHHHHHHHcCcccccCCCCCcchhccccccccc---CCCceEeeeeeecc
Q 040874            9 GIFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKR---TRGKIWAAPYRWGA   85 (165)
Q Consensus         9 ~~~~~~~~~~~kl~a~~~~~~~~Dv~~~~~~~~~~~~~~gll~pld~~~~~~~~~~i~~~~~~---~~g~~y~vP~~~~~   85 (165)
                      ..+++++++++||+++..   .+||+++++.++.+++++|+|+||+.+.+ +|++++.+.+..   ++|+.|++||.+++
T Consensus        41 ~~~~s~e~~~~kl~ag~~---~~DVv~~~~~~~~~~~~~gll~~ld~~~~-~n~~~~~~~~~~~~~~~~~~y~vp~~~~~  116 (333)
T 4gl0_A           41 QTFDSNEAMMTKIEQGGT---TFDIAVPSDYAISKMKEENLLIPLDHSKL-PNEKYLDPRFMDLSFDDDNKYSMPYFWGT  116 (333)
T ss_dssp             EEESCHHHHHHHHHTCSS---CCSEECCBHHHHHHHHHTTCBCCCCGGGC-GGGGGBCGGGSSCGGGGGGSSEEEEEEEE
T ss_pred             EeCCCHHHHHHHHHcCCC---CCeEEEeCHHHHHHHHHcCCccccccccc-cccccCCHHHhhhccCCCCceEeceeeee
Confidence            457888999999998754   69999999999999999999999999886 788888777642   56778999999999


Q ss_pred             eEEEEechhcccCCCCCCCCHHHhcCcccCCceeeecChHHHHHHHHHHhCCCCCCCChH-HHhcchh-hhhhhhHHhh
Q 040874           86 MMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNID-SQVAGGK-VAVQQNLALL  162 (165)
Q Consensus        86 ~~i~YN~~~v~~~g~~~p~sw~dL~d~~~kgki~~~d~~~~~~~~al~~~G~~~~~~~~~-~~~a~~~-~~lk~~v~~~  162 (165)
                      ++|+||+++|++   .+|+||+|||+|+|+||+++.+.++..+++++.++|.+++...++ +..+... .++++++..|
T Consensus       117 ~~i~yn~~~~~~---~~~~sw~dl~dp~~kg~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  192 (333)
T 4gl0_A          117 LGIIYNKEMFPD---KNFDTWNALFDPELKNQILLIDGAREVMGLGLNSLGYSLNDTNKAHLQAARDKLETMTPNVKAI  192 (333)
T ss_dssp             EEEEEETTTCTT---CCTTSGGGGGCGGGTTCEEEESCHHHHHHHHHHHTTCCTTCCCHHHHHHHHHHHHHHGGGEEEE
T ss_pred             eeeeechhhccc---CCcccHHhhcCHHhhhccccCCcHHHHHHHHHHHHhhcccCCCHHHHHHHHHHHHhhcccccee
Confidence            999999999986   378999999999999999999999999999999999999998886 6666665 7778876554
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} SCOP: c.94.1.1 PDB: 1y4t_A Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, perip binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein, iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 3od7_A 3odb_A 1qvs_A 2o6a_A 2o68_A 3kn8_A 3kn7_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genom MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose-BIND protein; periplasmic binding protein, MBP, maltotriose; HET: MLR; 1.60A {Thermotoga maritima} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>3quf_A Extracellular solute-binding protein, family 1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Bifidobacterium longum subsp} Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A 3u1o_A Back     alignment and structure
>3uor_A ABC transporter sugar binding protein; ALFA/beta protein, periplasmic-binding protein, maltose, SUG binding protein; 2.20A {Xanthomonas axonopodis PV} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>4hs7_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: P33; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>4g68_A ABC transporter; transport protein; HET: XYS; 1.80A {Caldanaerobius} PDB: 4g68_B* Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermoph protein, periplasmic binding protein, sugar binding protein; HET: MLR; 1.95A {Thermus thermophilus} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>4hw8_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MAL; 2.25A {Staphylococcus aureus subsp} PDB: 4hs7_A* Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter subst binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, MITO intermembrane space import AND...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>2xz3_A Maltose ABC transporter periplasmic protein, ENVE glycoprotein; viral protein, viral membrane fusion, hairpin, chimera; HET: MAL; 1.95A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>3oo8_A ABC transporter binding protein ACBH; class 2 SBP fold, ABC transporter extracellular solute bindi protein, D-galactose binding; 1.60A {Actinoplanes} PDB: 3oo6_A* 3oo7_A 3oo9_A 3ooa_A Back     alignment and structure
>4exk_A Maltose-binding periplasmic protein, uncharacteri protein chimera; MCSG, pcsep, MBP-fused target, structural genomics; HET: MTT; 1.28A {Escherichia coli} PDB: 3g7v_A* 3g7w_A* 3sev_A* 3ser_A* 3sew_A* 3set_A* 3ses_A* 3seu_A* 3sex_A* 3sey_A* 3q27_A* 3q28_A* 3q26_A* 3q25_A* 3q29_A* 1nmu_A* 2ok2_A* 3pgf_A* 1t0k_A* 3rum_A* ... Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>4b3n_A Maltose-binding periplasmic protein, tripartite motif-containing protein 5; sugar binding protein-ligase complex; HET: MAL MES; 3.30A {Escherichia coli} PDB: 2lm3_A Back     alignment and structure
>3ob4_A Conglutin, maltose ABC transporter periplasmic protein, ARAH; alpha-amylase inhibitors (AAI), lipid transfer (LT) and SEED (SS) protein family; HET: MLR; 2.71A {Escherichia coli} Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein AN argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 Back     alignment and structure
>4gqo_A LMO0859 protein; virulence, pathogenesis, vaccine candidate, center for struc genomics of infectious diseases, csgid, niaid; HET: MSE PGE; 2.10A {Listeria monocytogenes} Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3py7_A Maltose-binding periplasmic protein,paxillin LD1, chimera; viral protein; HET: MLR; 2.29A {Escherichia coli} Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>4aq4_A SN-glycerol-3-phosphate-binding periplasmic prote; diester-binding protein; HET: G3P; 1.80A {Escherichia coli} Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>3osr_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 2.00A {Escherichia coli} Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3osq_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 1.90A {Escherichia coli} Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>3vlv_A ALGQ1; sugar binding protein, alginate; HET: MAW LGU; 1.50A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 3vlu_A* 3vlw_A* 1y3n_A* 1y3p_A* 1y3q_A 1j1n_A* 1kwh_A Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>3a09_A ALGQ1; sugar binding protein, alginate; HET: MAW BEM MAV; 1.40A {Sphingomonas} PDB: 1y3p_A* 1y3q_A 1y3n_A* 3vlv_A* 3vlu_A* 3vlw_A* 1j1n_A* 1kwh_A Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, LIGA unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic BIN protein, ABC transporter, transport protein, ligand, metal- protein; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1pota_ 322 c.94.1.1 (A:) Spermidine/putrescine-binding protei 3e-06
d3thia_ 362 c.94.1.1 (A:) Thiaminase I {Paenibacillus thiamino 1e-04
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Spermidine/putrescine-binding protein PotD
species: Escherichia coli [TaxId: 562]

 Score = 43.6 bits (101), Expect = 3e-06
 Identities = 29/130 (22%), Positives = 49/130 (37%), Gaps = 7/130 (5%)

Query: 18  FNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQ--DWFKCLSHKWKRTRGK 75
           + K+K       A DLV     ++    ++ +I+ I   +                    
Sbjct: 41  YAKLKTYKDG--AYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFSNLDPDMLNKPFDPNN 98

Query: 76  IWAAPYRWGAMMIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYM 135
            ++ PY WGA  I          D   +  W DLW+PE  G + + +  REV    L+ +
Sbjct: 99  DYSIPYIWGATAIGVNGDAV---DPKSVTSWADLWKPEYKGSLLLTDDAREVFQMALRKL 155

Query: 136 GASYNSNNID 145
           G S N+ +  
Sbjct: 156 GYSGNTTDPK 165
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1pota_ 322 Spermidine/putrescine-binding protein PotD {Escher 99.81
d1xvxa_ 311 Ferric-binding protein FbpA {Yersinia enterocoliti 99.54
d1a99a_ 341 Putrescine receptor (PotF) {Escherichia coli [TaxI 99.52
d1q35a_ 318 Ferric-binding protein FbpA {Mannheimia haemolytic 99.49
d1elja_ 380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 99.35
d1y4ta_ 317 Ferric-binding protein FbpA {Campylobacter jejuni 99.34
d1nnfa_ 308 Ferric-binding protein FbpA {Haemophilus influenza 99.26
d1laxa_ 369 D-maltodextrin-binding protein, MBP {Escherichia c 99.23
d1ursa_ 367 D-maltodextrin-binding protein, MBP {Alicyclobacil 99.21
d1y9ua_ 318 Ferric-binding protein FbpA {Bordetella pertussis 99.1
d1eu8a_ 407 D-maltodextrin-binding protein, MBP {Archaeon Ther 99.04
d3thia_ 362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 98.98
d1j1na_ 492 Alginate-binding periplasmic protein AlgQ2 {Sphing 98.81
d1sbpa_ 309 Sulphate-binding protein {Salmonella typhimurium [ 97.89
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinel 94.33
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli 94.09
d2onsa1 311 Molybdate-binding protein, ModA {Archaeoglobus ful 89.36
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Spermidine/putrescine-binding protein PotD
species: Escherichia coli [TaxId: 562]

Probab=99.81  E-value=5.7e-20  Score=143.38  Aligned_cols=147  Identities=22%  Similarity=0.384  Sum_probs=120.2

Q ss_pred             ccCCCchHHHHHHhhcCCCCCccEEEeChHHHHHHHHcCcccccCCCCCcchhccccccccc---CCCceEeeeeeecce
Q 040874           10 IFNNLSLPFNKVKAKSASYMAADLVSVGDPWLSFAIEKRLIEPIAGGEDQDWFKCLSHKWKR---TRGKIWAAPYRWGAM   86 (165)
Q Consensus        10 ~~~~~~~~~~kl~a~~~~~~~~Dv~~~~~~~~~~~~~~gll~pld~~~~~~~~~~i~~~~~~---~~g~~y~vP~~~~~~   86 (165)
                      .+++.+++.++|+++..+  ++||++++..++.++++.|+++||+.... ++++.+.+.+..   .+|+.|++|+.+++.
T Consensus        33 ~~~~~~~~~~~l~a~~~~--~~Dvv~~~~~~~~~~~~~g~~~~ld~~~~-~~~~~~~~~~~~~~~~~g~~~~~P~~~~~~  109 (322)
T d1pota_          33 TYESNETMYAKLKTYKDG--AYDLVVPSTYYVDKMRKEGMIQKIDKSKL-TNFSNLDPDMLNKPFDPNNDYSIPYIWGAT  109 (322)
T ss_dssp             EESCHHHHHHHHTTCSSS--CSSBBCCBGGGHHHHHHHTCBCCCCTTSC-TTGGGBCGGGSCCTTSTTCSSCEEEEEEEE
T ss_pred             eCCCHHHHHHHHHhcCCC--CCeEEEeChHHHHHHHhCCcccccchhhc-chhhccChhhhccccCCCCceEeeeeeeee
Confidence            456667888999987653  78999999999999999999999998764 677777776643   467789999999999


Q ss_pred             EEEEechhcccCCCCCCCCHHHhcCcccCCceeeecChHHHHHHHHHHhCCCCCCCChH-HHhcchh-hhhhhhHHhh
Q 040874           87 MIAYKKSKFRKHDLAPIEDWKDLWRPELAGRISMVNSPREVIGSVLKYMGASYNSNNID-SQVAGGK-VAVQQNLALL  162 (165)
Q Consensus        87 ~i~YN~~~v~~~g~~~p~sw~dL~d~~~kgki~~~d~~~~~~~~al~~~G~~~~~~~~~-~~~a~~~-~~lk~~v~~~  162 (165)
                      +++||++++++   .+|+||+|||+++++|++++.+.+...++.+..+.+.+.....+. ....... .++++++..|
T Consensus       110 ~l~Yn~~~~~~---~~p~sw~dl~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (322)
T d1pota_         110 AIGVNGDAVDP---KSVTSWADLWKPEYKGSLLLTDDAREVFQMALRKLGYSGNTTDPKEIEAAYNELKKLMPNVAAF  184 (322)
T ss_dssp             EEEEETTTSCT---TTCCSSGGGGSGGGTTCEEECSCHHHHHHHHHHHTTCCTTCCCHHHHHHHHHHHHHTGGGEEEE
T ss_pred             eeEehhhhcCc---cccCcHHHHhChHhhhcccccCchhhhhHHHHHHhccCccccchhhHHHHHHHHHHhcccccee
Confidence            99999999987   379999999999999999999988888888888887776666654 4444444 6777776654
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure