Citrus Sinensis ID: 041259


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLSGSKN
cccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccc
cccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccc
mkgknikadlplygTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAyfkagepsEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYfgrmpdfglhpnVAVYTALIDGLCKKNCIERARNLfdempkrdmipdtTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMigrgilpdEILCISLLKKHYERGNMDEAIELQNEMMgrgllsgskn
mkgknikadlplygTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNlfdempkrdmiPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNemmgrgllsgskn
MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLSGSKN
*******ADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERG***********************
***KNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLS****
MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLSGSKN
****NIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGLLSGSKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
P0C894761 Putative pentatricopeptid yes no 1.0 0.337 0.589 3e-84
Q9ZUA2559 Pentatricopeptide repeat- no no 0.968 0.445 0.354 1e-38
Q9LPX2 644 Pentatricopeptide repeat- no no 0.933 0.372 0.347 9e-34
Q9FIX3 747 Pentatricopeptide repeat- no no 0.922 0.317 0.309 3e-33
Q6NQ83 619 Pentatricopeptide repeat- no no 0.821 0.340 0.321 5e-33
Q0WKV3 637 Pentatricopeptide repeat- no no 0.933 0.376 0.334 8e-33
Q9ASZ8 621 Pentatricopeptide repeat- no no 0.933 0.386 0.334 3e-32
Q9SV46851 Pentatricopeptide repeat- no no 0.980 0.296 0.302 5e-32
Q9LR67660 Pentatricopeptide repeat- no no 0.980 0.381 0.343 7e-32
Q9FLJ4 654 Pentatricopeptide repeat- no no 0.929 0.365 0.314 9e-32
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function desciption
 Score =  311 bits (797), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 152/258 (58%), Positives = 196/258 (75%), Gaps = 1/258 (0%)

Query: 1   MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGE 60
           +KG+ IK DL LYGT IWGLC   K E +K++++EMKE G+ AN++I TTLMDAYFK+G 
Sbjct: 498 LKGRGIKPDLLLYGTFIWGLCSLEKIEAAKVVMNEMKECGIKANSLIYTTLMDAYFKSGN 557

Query: 61  PSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMP-DFGLHPNVAVYT 119
           P+E L LLDEM +  IEVTVVTFCVLIDGLCK+ LV +A+DYF R+  DFGL  N A++T
Sbjct: 558 PTEGLHLLDEMKELDIEVTVVTFCVLIDGLCKNKLVSKAVDYFNRISNDFGLQANAAIFT 617

Query: 120 ALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEV 179
           A+IDGLCK N +E A  LF++M ++ ++PD TAYT+L+DG  K  +  EAL L+++M E+
Sbjct: 618 AMIDGLCKDNQVEAATTLFEQMVQKGLVPDRTAYTSLMDGNFKQGNVLEALALRDKMAEI 677

Query: 180 GVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEA 239
           G+ LDL AYTSLVWGLS C  LQ+AR    EMIG GI PDE+LCIS+LKKHYE G +DEA
Sbjct: 678 GMKLDLLAYTSLVWGLSHCNQLQKARSFLEEMIGEGIHPDEVLCISVLKKHYELGCIDEA 737

Query: 240 IELQNEMMGRGLLSGSKN 257
           +ELQ+ +M   LL+   +
Sbjct: 738 VELQSYLMKHQLLTSDND 755





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 Back     alignment and function description
>sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 Back     alignment and function description
>sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 Back     alignment and function description
>sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
224111362 636 predicted protein [Populus trichocarpa] 0.727 0.294 0.665 1e-97
359473521 755 PREDICTED: putative pentatricopeptide re 0.715 0.243 0.622 3e-89
449463537 786 PREDICTED: putative pentatricopeptide re 0.840 0.274 0.613 3e-86
255555533 775 pentatricopeptide repeat-containing prot 0.937 0.310 0.644 2e-85
449481246 822 PREDICTED: LOW QUALITY PROTEIN: putative 0.805 0.251 0.615 6e-84
312190399 1128 unknown [Eutrema parvulum] 1.0 0.227 0.596 9e-84
4038037 1107 hypothetical protein [Arabidopsis thalia 1.0 0.232 0.589 1e-82
334184106 761 tetratricopeptide repeat-containing prot 1.0 0.337 0.589 2e-82
356528166 852 PREDICTED: putative pentatricopeptide re 0.719 0.217 0.560 2e-78
297817834 1010 hypothetical protein ARALYDRAFT_484139 [ 0.953 0.242 0.528 3e-65
>gi|224111362|ref|XP_002315826.1| predicted protein [Populus trichocarpa] gi|222864866|gb|EEF01997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 171/257 (66%), Positives = 212/257 (82%)

Query: 1   MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGE 60
           M+ K+IK D+ L+GTI+WGLC ESK E+ K++++EMKE+G+ AN VI TTLMDAYFKAG 
Sbjct: 368 MREKDIKPDILLWGTIVWGLCSESKLEECKIIMTEMKESGIGANPVIYTTLMDAYFKAGN 427

Query: 61  PSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTA 120
            +EA++LL+EM D   EVTVVTFC LIDGLCK GLV+EAI YFGRMPD  L PNVAVYTA
Sbjct: 428 RTEAINLLEEMRDLGTEVTVVTFCALIDGLCKRGLVQEAIYYFGRMPDHDLQPNVAVYTA 487

Query: 121 LIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVG 180
           LIDGLCK NCI  A+ LFDEM  ++MIPD  AYTA+IDG LKH +F+EALN++N+M E+G
Sbjct: 488 LIDGLCKNNCIGDAKKLFDEMQDKNMIPDKIAYTAMIDGNLKHGNFQEALNMRNKMMEMG 547

Query: 181 VDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAI 240
           ++LDL AYTSLVWGLS+CG +Q+AR    EMIG+GI+PDE LC  LL+KHYE GN+DEAI
Sbjct: 548 IELDLYAYTSLVWGLSQCGQVQQARKFLAEMIGKGIIPDETLCTRLLRKHYELGNIDEAI 607

Query: 241 ELQNEMMGRGLLSGSKN 257
           ELQNE++ +GL+ G+ N
Sbjct: 608 ELQNELVEKGLIHGNSN 624




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359473521|ref|XP_002273398.2| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449463537|ref|XP_004149490.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255555533|ref|XP_002518803.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542184|gb|EEF43728.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449481246|ref|XP_004156125.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At2g02150-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|312190399|gb|ADQ43199.1| unknown [Eutrema parvulum] Back     alignment and taxonomy information
>gi|4038037|gb|AAC97219.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334184106|ref|NP_178323.3| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546751|sp|P0C894.1|PP143_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At2g02150 gi|330250459|gb|AEC05553.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356528166|ref|XP_003532676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Glycine max] Back     alignment and taxonomy information
>gi|297817834|ref|XP_002876800.1| hypothetical protein ARALYDRAFT_484139 [Arabidopsis lyrata subsp. lyrata] gi|297322638|gb|EFH53059.1| hypothetical protein ARALYDRAFT_484139 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2065428559 AT2G01740 "AT2G01740" [Arabido 0.964 0.443 0.355 1.6e-38
TAIR|locus:1009023134 644 AT1G12775 [Arabidopsis thalian 0.941 0.375 0.347 6.9e-33
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.980 0.337 0.309 1.9e-32
TAIR|locus:2077061 619 AT3G22470 "AT3G22470" [Arabido 0.957 0.397 0.321 2.1e-32
TAIR|locus:2034760 637 AT1G12300 [Arabidopsis thalian 0.941 0.379 0.334 3e-32
TAIR|locus:2020808660 AT1G03560 [Arabidopsis thalian 0.980 0.381 0.343 4.5e-32
TAIR|locus:2195047 621 AT1G12620 [Arabidopsis thalian 0.941 0.389 0.334 1.2e-31
TAIR|locus:2163218 654 AT5G61400 "AT5G61400" [Arabido 0.976 0.383 0.314 8.8e-31
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.953 0.335 0.338 1.2e-30
TAIR|locus:2056078867 LOJ "LATERAL ORGAN JUNCTION" [ 0.957 0.283 0.319 1.9e-30
TAIR|locus:2065428 AT2G01740 "AT2G01740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 412 (150.1 bits), Expect = 1.6e-38, P = 1.6e-38
 Identities = 90/253 (35%), Positives = 146/253 (57%)

Query:     1 MKGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGE 60
             M  + ++ D+  YG II GLC   K +++  ++ +M+++ L  + VI TT+M+AYFK+G 
Sbjct:   294 MLNQGMRLDITAYGVIISGLCGNGKLKEATEIVEDMEKSDLVPDMVIFTTMMNAYFKSGR 353

Query:    61 PSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTA 120
                A+++  ++++   E  VV    +IDG+ K+G + EAI YF          N  +YT 
Sbjct:   354 MKAAVNMYHKLIERGFEPDVVALSTMIDGIAKNGQLHEAIVYFCIEK-----ANDVMYTV 408

Query:   121 LIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVG 180
             LID LCK+        LF ++ +  ++PD   YT+ I G  K  +  +A  LK RM + G
Sbjct:   409 LIDALCKEGDFIEVERLFSKISEAGLVPDKFMYTSWIAGLCKQGNLVDAFKLKTRMVQEG 468

Query:   181 VDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAI 240
             + LDL AYT+L++GL+  G + EAR +F EM+  GI PD  +   L++ + + GNM  A 
Sbjct:   469 LLLDLLAYTTLIYGLASKGLMVEARQVFDEMLNSGISPDSAVFDLLIRAYEKEGNMAAAS 528

Query:   241 ELQNEMMGRGLLS 253
             +L  +M  RGL++
Sbjct:   529 DLLLDMQRRGLVT 541


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020808 AT1G03560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195047 AT1G12620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163218 AT5G61400 "AT5G61400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056078 LOJ "LATERAL ORGAN JUNCTION" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.X.6215.1
hypothetical protein (636 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-15
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-15
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-14
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.003
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 83.8 bits (207), Expect = 2e-18
 Identities = 62/243 (25%), Positives = 112/243 (46%), Gaps = 3/243 (1%)

Query: 15  TIIWGLCIESKFEDSKL-LLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLD 73
            ++  +C  S+  D  L +L  ++E GL A+  + TTL+    K+G+      +  EM++
Sbjct: 441 NMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVN 500

Query: 74  SRIEVTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIER 133
           + +E  V TF  LIDG  ++G V +A   +G M    + P+  V+ ALI    +   ++R
Sbjct: 501 AGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDR 560

Query: 134 ARNLFDEM--PKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSL 191
           A ++  EM      + PD     AL+           A  +   + E  +      YT  
Sbjct: 561 AFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIA 620

Query: 192 VWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMMGRGL 251
           V   S+ G    A  ++ +M  +G+ PDE+   +L+      G++D+A E+  +   +G+
Sbjct: 621 VNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGI 680

Query: 252 LSG 254
             G
Sbjct: 681 KLG 683


Length = 1060

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.86
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.71
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.71
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.69
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.68
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.68
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.66
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.66
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.66
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.66
PRK12370553 invasion protein regulator; Provisional 99.65
KOG1126638 consensus DNA-binding cell division cycle control 99.64
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.61
KOG1126638 consensus DNA-binding cell division cycle control 99.61
PRK12370553 invasion protein regulator; Provisional 99.59
PF1304150 PPR_2: PPR repeat family 99.58
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
KOG1129478 consensus TPR repeat-containing protein [General f 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
PRK14574 822 hmsH outer membrane protein; Provisional 99.54
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.53
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.53
PF1304150 PPR_2: PPR repeat family 99.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.48
KOG2003 840 consensus TPR repeat-containing protein [General f 99.47
KOG2076 895 consensus RNA polymerase III transcription factor 99.46
PRK14574 822 hmsH outer membrane protein; Provisional 99.45
PRK11189296 lipoprotein NlpI; Provisional 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.43
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.43
KOG0547606 consensus Translocase of outer mitochondrial membr 99.43
PRK11189296 lipoprotein NlpI; Provisional 99.42
KOG2003 840 consensus TPR repeat-containing protein [General f 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.42
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.35
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.34
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.29
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.26
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.26
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.26
PLN02789320 farnesyltranstransferase 99.25
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.25
KOG0547606 consensus Translocase of outer mitochondrial membr 99.24
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.24
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.21
PF1285434 PPR_1: PPR repeat 99.19
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.19
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.17
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.17
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.16
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG1125579 consensus TPR repeat-containing protein [General f 99.14
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.11
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.09
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.09
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.09
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.08
KOG2076 895 consensus RNA polymerase III transcription factor 99.06
PRK10370198 formate-dependent nitrite reductase complex subuni 99.06
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.06
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.06
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.05
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.05
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.05
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.03
PF1285434 PPR_1: PPR repeat 99.02
PRK10370198 formate-dependent nitrite reductase complex subuni 99.01
PRK15359144 type III secretion system chaperone protein SscB; 98.94
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.91
KOG1915677 consensus Cell cycle control protein (crooked neck 98.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.89
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.89
PLN02789320 farnesyltranstransferase 98.89
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.87
PRK15359144 type III secretion system chaperone protein SscB; 98.85
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.84
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.82
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.81
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.8
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.8
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.78
KOG1125579 consensus TPR repeat-containing protein [General f 98.78
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.73
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.72
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.7
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.7
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.69
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.69
PRK04841 903 transcriptional regulator MalT; Provisional 98.68
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.68
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.68
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.68
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.67
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.66
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.63
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.63
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 98.62
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.62
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.61
PRK04841 903 transcriptional regulator MalT; Provisional 98.6
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.59
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.57
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.55
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.55
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.52
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.49
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.49
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.42
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.42
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.39
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.39
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.39
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.39
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.35
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.35
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.33
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.33
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.32
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.31
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.29
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.28
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.25
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.21
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.2
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.18
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.18
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.14
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.13
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.1
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.09
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.09
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.09
KOG0553304 consensus TPR repeat-containing protein [General f 98.05
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.05
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.04
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.0
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.0
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.98
KOG0553304 consensus TPR repeat-containing protein [General f 97.97
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.97
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.97
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.95
PF12688120 TPR_5: Tetratrico peptide repeat 97.93
PF12688120 TPR_5: Tetratrico peptide repeat 97.91
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.87
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.86
PRK10803263 tol-pal system protein YbgF; Provisional 97.84
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.84
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.81
COG4700251 Uncharacterized protein conserved in bacteria cont 97.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.75
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.71
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.7
COG4700251 Uncharacterized protein conserved in bacteria cont 97.66
PRK10803263 tol-pal system protein YbgF; Provisional 97.65
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.6
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.59
PRK15331165 chaperone protein SicA; Provisional 97.57
PF1337173 TPR_9: Tetratricopeptide repeat 97.56
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.5
PRK15331165 chaperone protein SicA; Provisional 97.49
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.48
PF1337173 TPR_9: Tetratricopeptide repeat 97.46
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.43
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.39
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.3
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.22
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.2
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.14
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.05
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.0
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.99
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.97
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.96
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.93
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.92
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.9
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.86
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.85
smart00299140 CLH Clathrin heavy chain repeat homology. 96.84
KOG3941406 consensus Intermediate in Toll signal transduction 96.76
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.71
KOG3941 406 consensus Intermediate in Toll signal transduction 96.71
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.7
KOG4555175 consensus TPR repeat-containing protein [Function 96.69
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 96.68
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.64
COG3629280 DnrI DNA-binding transcriptional activator of the 96.62
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.62
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.6
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.56
KOG4555175 consensus TPR repeat-containing protein [Function 96.44
smart00299140 CLH Clathrin heavy chain repeat homology. 96.43
KOG4570 418 consensus Uncharacterized conserved protein [Funct 96.33
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 96.31
COG3629280 DnrI DNA-binding transcriptional activator of the 96.29
PF1342844 TPR_14: Tetratricopeptide repeat 96.29
PF1342844 TPR_14: Tetratricopeptide repeat 96.29
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.26
PF13512142 TPR_18: Tetratricopeptide repeat 96.23
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.2
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.2
PRK11906458 transcriptional regulator; Provisional 96.18
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.1
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.06
COG1747 711 Uncharacterized N-terminal domain of the transcrip 96.03
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.03
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.98
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.97
KOG4570 418 consensus Uncharacterized conserved protein [Funct 95.95
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.93
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.77
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.71
KOG1585308 consensus Protein required for fusion of vesicles 95.7
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.64
PRK11906458 transcriptional regulator; Provisional 95.51
KOG1550552 consensus Extracellular protein SEL-1 and related 95.49
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.44
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.41
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.41
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.4
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.26
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 95.16
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.14
PF13512142 TPR_18: Tetratricopeptide repeat 95.1
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.08
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.99
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.98
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.83
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.81
COG3898531 Uncharacterized membrane-bound protein [Function u 94.69
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.69
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.63
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.53
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.52
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.23
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.19
PF1343134 TPR_17: Tetratricopeptide repeat 94.15
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 94.09
PF1343134 TPR_17: Tetratricopeptide repeat 94.08
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.03
KOG1550 552 consensus Extracellular protein SEL-1 and related 93.76
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.7
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.46
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.4
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.39
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.34
KOG1585308 consensus Protein required for fusion of vesicles 93.33
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 93.24
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.19
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.12
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 93.07
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.04
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 93.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.0
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.97
PF13929292 mRNA_stabil: mRNA stabilisation 92.84
COG4455 273 ImpE Protein of avirulence locus involved in tempe 92.73
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.67
COG4455273 ImpE Protein of avirulence locus involved in tempe 92.58
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.49
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.44
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.42
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.36
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 92.24
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.22
PHA02875 413 ankyrin repeat protein; Provisional 91.94
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.65
KOG1941 518 consensus Acetylcholine receptor-associated protei 91.45
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 91.43
PF13762145 MNE1: Mitochondrial splicing apparatus component 91.39
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.22
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.04
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.84
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.7
KOG20411189 consensus WD40 repeat protein [General function pr 90.52
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.39
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.37
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 90.32
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.24
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.85
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.69
PHA02875 413 ankyrin repeat protein; Provisional 89.4
KOG4234271 consensus TPR repeat-containing protein [General f 89.32
PF13929292 mRNA_stabil: mRNA stabilisation 89.23
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.81
KOG1258577 consensus mRNA processing protein [RNA processing 88.48
KOG4234271 consensus TPR repeat-containing protein [General f 88.37
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.27
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 88.21
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 88.16
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 88.11
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 88.08
KOG1258577 consensus mRNA processing protein [RNA processing 88.01
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 87.17
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.91
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 86.86
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.59
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 86.58
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.34
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.01
COG3947361 Response regulator containing CheY-like receiver a 85.19
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 84.98
PRK09687280 putative lyase; Provisional 84.66
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 84.59
PRK10564303 maltose regulon periplasmic protein; Provisional 84.05
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.97
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 83.82
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 83.62
KOG4567370 consensus GTPase-activating protein [General funct 83.43
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.66
PRK09687280 putative lyase; Provisional 81.64
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.63
COG5159 421 RPN6 26S proteasome regulatory complex component [ 81.37
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.17
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.08
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 81.07
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 80.78
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 80.2
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.5e-50  Score=334.49  Aligned_cols=254  Identities=20%  Similarity=0.322  Sum_probs=144.0

Q ss_pred             CCCCCCCChhhHHHHHHHHHhcCChhhHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCChHHHHHHHHHHHh--cCCccc
Q 041259            2 KGKNIKADLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLD--SRIEVT   79 (257)
Q Consensus         2 ~~~g~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~~   79 (257)
                      .+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|..  .|+.||
T Consensus       499 ~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD  578 (1060)
T PLN03218        499 VNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPD  578 (1060)
T ss_pred             HHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCc
Confidence            344555555555555555555555555555555555555555555555555555555555555555555543  344555


Q ss_pred             HHHHHHHHHHHHhcCcHHHHHHHHHhcccCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHhhhCCCCCCHHHHHHHHHH
Q 041259           80 VVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDG  159 (257)
Q Consensus        80 ~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~  159 (257)
                      ..+|+.++.+|++.|++++|.++|+.|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+
T Consensus       579 ~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a  658 (1060)
T PLN03218        579 HITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDV  658 (1060)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            55555555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             HHcccCHHHHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCcHHHHHHHHHHHHhCCCCCcHHHHHHHHHHHHhcCCHHHH
Q 041259          160 YLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYERGNMDEA  239 (257)
Q Consensus       160 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a  239 (257)
                      |++.|++++|.++++.|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|
T Consensus       659 ~~k~G~~eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeA  738 (1060)
T PLN03218        659 AGHAGDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKA  738 (1060)
T ss_pred             HHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHH
Confidence            55555555555555555555555555566666666666666666666666665555566666666666666666666666


Q ss_pred             HHHHHHHHhCCCCCCC
Q 041259          240 IELQNEMMGRGLLSGS  255 (257)
Q Consensus       240 ~~~~~~m~~~~~~~~~  255 (257)
                      .++|++|.+.|+.||.
T Consensus       739 lelf~eM~~~Gi~Pd~  754 (1060)
T PLN03218        739 LEVLSEMKRLGLCPNT  754 (1060)
T ss_pred             HHHHHHHHHcCCCCCH
Confidence            6666666666666553



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4567 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 79.5 bits (194), Expect = 5e-17
 Identities = 22/220 (10%), Positives = 61/220 (27%), Gaps = 4/220 (1%)

Query: 32  LLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLC 91
           L    ++   +        L+             +   +   +++               
Sbjct: 79  LEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCL 138

Query: 92  KSGLVREA---IDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIP 148
            +  +  A   +              + +Y A++ G  ++   +    +   +    + P
Sbjct: 139 LTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTP 198

Query: 149 DTTAYTALIDGYLKHESFKEALN-LKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVL 207
           D  +Y A +    + +     +     +M++ G+ L       L+    R   L+    +
Sbjct: 199 DLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKV 258

Query: 208 FHEMIGRGILPDEILCISLLKKHYERGNMDEAIELQNEMM 247
                    LP  +    LL+  Y +       +L   + 
Sbjct: 259 KPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLK 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.91
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.91
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.85
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.85
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
3u4t_A272 TPR repeat-containing protein; structural genomics 99.82
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.82
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.8
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.79
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.79
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.78
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.76
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.75
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.75
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.72
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.72
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.71
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.7
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.69
3u4t_A272 TPR repeat-containing protein; structural genomics 99.68
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.67
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.67
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.65
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.64
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.64
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.64
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.63
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.62
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.62
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.6
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.6
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.6
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.57
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.56
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.55
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.52
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.52
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.5
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.49
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.49
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.48
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.45
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.45
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.44
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.42
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.42
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.41
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.39
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.39
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.38
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.37
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.36
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.36
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.34
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.33
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.33
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.33
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.32
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.32
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.32
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.32
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.31
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.31
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.31
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.27
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.26
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.24
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.2
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.19
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.18
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.15
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.14
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.12
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.08
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.08
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.03
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.02
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.02
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.02
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.01
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.0
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.99
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.98
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.96
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.95
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.93
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.92
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.92
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.9
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.9
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.86
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.84
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.83
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.82
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.82
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.81
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.81
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.81
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.81
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.8
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.8
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.79
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.78
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.78
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.78
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.77
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.73
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.72
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.71
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.68
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.67
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.67
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.64
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.63
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.62
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.62
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.6
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.56
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.55
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.54
3k9i_A117 BH0479 protein; putative protein binding protein, 98.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.53
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.5
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.5
3k9i_A117 BH0479 protein; putative protein binding protein, 98.49
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.44
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.43
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.42
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.36
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.36
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.3
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.28
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.2
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.2
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.15
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.11
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.91
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.78
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.73
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.73
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.69
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.68
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.64
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.64
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.5
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.36
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.35
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.26
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.24
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.19
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.14
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.92
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.89
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.85
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.73
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.65
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.34
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.9
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.85
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.81
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 95.45
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.41
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.41
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.1
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.71
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 94.68
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.44
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 94.06
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.66
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.41
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.99
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.92
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 92.63
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.52
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 92.43
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.96
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.55
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.95
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 90.71
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.67
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.55
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 90.51
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.97
2uwj_G115 Type III export protein PSCG; virulence, chaperone 89.3
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.19
2p58_C116 Putative type III secretion protein YSCG; type III 88.91
2uwj_G115 Type III export protein PSCG; virulence, chaperone 88.7
2p58_C116 Putative type III secretion protein YSCG; type III 88.42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 87.29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 86.39
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 86.37
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 86.35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 85.09
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 84.8
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 84.17
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 83.99
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 82.97
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=5.8e-38  Score=247.76  Aligned_cols=206  Identities=16%  Similarity=0.133  Sum_probs=163.0

Q ss_pred             hHHHHHHHHHHcCCCccH-HHHHHHHHHHHhcCChHHHHHHHHHHHhcCCcccHHHHHHHHHHHHhcCc---------HH
Q 041259           28 DSKLLLSEMKENGLTANT-VICTTLMDAYFKAGEPSEALSLLDEMLDSRIEVTVVTFCVLIDGLCKSGL---------VR   97 (257)
Q Consensus        28 ~a~~~~~~~~~~~~~~~~-~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~---------~~   97 (257)
                      .+..+.+.+.+.+..+.+ ..++.+|.+|++.|++++|+++|++|.+.|++||..+|+.+|.+|.+.+.         ++
T Consensus         8 ~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~   87 (501)
T 4g26_A            8 PSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLS   87 (501)
T ss_dssp             ----------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHH
T ss_pred             hHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHH
Confidence            345555666666554433 35777888888888888888888888888888888888888888876543         67


Q ss_pred             HHHHHHHhcccCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHhhhCCCCCCHHHHHHHHHHHHcccCHHHHHHHHHHHH
Q 041259           98 EAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMIPDTTAYTALIDGYLKHESFKEALNLKNRMT  177 (257)
Q Consensus        98 ~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~  177 (257)
                      .|.++|++|...|+.||..+|+++|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.
T Consensus        88 ~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~  167 (501)
T 4g26_A           88 RGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMV  167 (501)
T ss_dssp             HHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHH
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HcCCCccHHHHHHHHHHHHhcCcHHHHHHHHHHHHhCCCCCcHHHHHHHHHHHHhc
Q 041259          178 EVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLLKKHYER  233 (257)
Q Consensus       178 ~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  233 (257)
                      +.|+.||..+|+.||.+|++.|++++|.+++++|.+.|..|+..||+.++..|...
T Consensus       168 ~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          168 ESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             HTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             hcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            88888888888888888888888888888888888888888888888888887653



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.79
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.62
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.47
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.47
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.41
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.34
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.17
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.13
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.09
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.08
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.03
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.97
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.93
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.89
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.87
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.76
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.75
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.73
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.6
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.42
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.42
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.4
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.35
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.33
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.32
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.25
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.15
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.07
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.85
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.64
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.59
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.31
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.59
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.21
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.01
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.83
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 94.67
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.59
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.65
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 83.45
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.68
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=1.3e-16  Score=120.59  Aligned_cols=236  Identities=14%  Similarity=0.072  Sum_probs=155.0

Q ss_pred             ChhhHHHHHHHHHhcCChhhHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCc-----------
Q 041259            9 DLPLYGTIIWGLCIESKFEDSKLLLSEMKENGLTANTVICTTLMDAYFKAGEPSEALSLLDEMLDSRIE-----------   77 (257)
Q Consensus         9 ~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~-----------   77 (257)
                      +...+..+...+.+.|++++|...++.+.+.. |.+..+|..+..++.+.|++++|+..+....+....           
T Consensus        32 ~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~  110 (388)
T d1w3ba_          32 NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAA  110 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcccccccccccccccccccccccccccccc
Confidence            45677777888888888888888888887764 445677778888888888888887776655432110           


Q ss_pred             --------------------------------------------------------------------------------
Q 041259           78 --------------------------------------------------------------------------------   77 (257)
Q Consensus        78 --------------------------------------------------------------------------------   77 (257)
                                                                                                      
T Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~  190 (388)
T d1w3ba_         111 LVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIH  190 (388)
T ss_dssp             HHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHH
Confidence                                                                                            


Q ss_pred             ----------ccHHHHHHHHHHHHhcCcHHHHHHHHHhcccCCCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHhhhCCCC
Q 041259           78 ----------VTVVTFCVLIDGLCKSGLVREAIDYFGRMPDFGLHPNVAVYTALIDGLCKKNCIERARNLFDEMPKRDMI  147 (257)
Q Consensus        78 ----------~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~  147 (257)
                                -+..++..+...+...|++++|...+++..... +.+...+..+...+.+.|++++|...|++..+..+.
T Consensus       191 ~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~  269 (388)
T d1w3ba_         191 HFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH  269 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSS
T ss_pred             HHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC
Confidence                      011222333333444444444444444443332 234445555666666677777777777776665443


Q ss_pred             CCHHHHHHHHHHHHcccCHHHHHHHHHHHHHcCCCccHHHHHHHHHHHHhcCcHHHHHHHHHHHHhCCCCCcHHHHHHHH
Q 041259          148 PDTTAYTALIDGYLKHESFKEALNLKNRMTEVGVDLDLNAYTSLVWGLSRCGHLQEARVLFHEMIGRGILPDEILCISLL  227 (257)
Q Consensus       148 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~  227 (257)
                       +..++..+...+...|++++|...++...... +.+...+..+...+...|++++|...+++..+.. +-+...+..+.
T Consensus       270 -~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la  346 (388)
T d1w3ba_         270 -FPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLA  346 (388)
T ss_dssp             -CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHH
T ss_pred             -CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHH
Confidence             56667777777777777777777777766653 3466677777777888888888888888877642 22456677788


Q ss_pred             HHHHhcCCHHHHHHHHHHHHhC
Q 041259          228 KKHYERGNMDEAIELQNEMMGR  249 (257)
Q Consensus       228 ~~~~~~g~~~~a~~~~~~m~~~  249 (257)
                      .++.+.|++++|.+.|++.++.
T Consensus       347 ~~~~~~g~~~~A~~~~~~al~l  368 (388)
T d1w3ba_         347 SVLQQQGKLQEALMHYKEAIRI  368 (388)
T ss_dssp             HHHHTTTCCHHHHHHHHHHHTT
T ss_pred             HHHHHcCCHHHHHHHHHHHHHh
Confidence            8888888888888888887653



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure