Citrus Sinensis ID: 041271

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MSLSINMDLPAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLGFLAKAAAAPFAKLNQKSKLLRVLSAKKLISKLGVLAKAAPVCILCGHASSNSGSSNNSNSQR
cccccccccccccccccccccccccEEEEEEEccEEEEEEEccccccccEEEEEEccEEEEEEEEEccccEEEEEEEccEEEccccccccccccccccccccccccEEEEccccccccccccccEEEEEEEccEEEEEEEccccEEEEEEEcccccccccEEEEEcccEEEEEEEEEEEEEccccccccEEEEEEEccEEEEEEEcccccccccEEEEcccccEEEEEEccccccccccccEEEEEccccHHcccccccccccccccEEHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccc
ccEEEccccccEEEccccEEccccccEEEEEcccEEEEEEEEEEEEEEEEEEEEcccEEEEEEccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccEEEEEEcccccccccEEEEEEccccEEEEEccccEEEEccccccEEEEEEEccccEEEEEEccccccHHEEEEEEccccEEEEEEcccccccccccEEEEEEEcccccccccccccccccHcccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccc
mslsinmdlpafitesskfidssnistrweydgdkivckaslpavrmedvkidindkeltltrelniaDGGTILRRFLKVsrnfdlpdgvkrsnfkstsmedgvLTVTFTRdaaatantssRSVYKKVIAFLNAVIYWETSLDKHVLkasllpgmkkedvkieIEDDGAELKMIVLLETeeeegdtipewlleeftdgkiirrfklpadvrlddfktemeedgvltvtftkpikpkktQQQLISKLLGFLAKAaaapfaklnQKSKLLRVLSAKKLISKLGVLakaapvcilcghassnsgssnnsnsqr
MSLSINMDLPAFitesskfidssnistrweydgdkIVCKaslpavrmedvkidindkeltltrelniadggtILRRFLKvsrnfdlpdgvkrsnfkstsmedgvLTVTFTRDAaatantssrsvyKKVIAFLNAVIYWETSLDKHVLKasllpgmkkedvKIEIEDDGAELKMIVLLETeeeegdtipewlleeftdgkiirrfklpadvrlddfktemeedgvltvtftkpikpkkTQQQLISKLLGFLAKAAAApfaklnqksKLLRVLSAKKLISKLGVLAKAAPVCILCghassnsgssnnsnsqr
MSLSINMDLPAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLeteeeeGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLtvtftkpikpkktqqqLISkllgflakaaaapfaklNQKSKLLRVLSAKKLISKLGVLAKAAPVCILCGHAssnsgssnnsnsQR
*********PAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGV***********DGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVL************EWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLGFLAKAAAAPFAKLNQKSKLLRVLSAKKLISKLGVLAKAAPVCILCGH***************
********LPAFITE*SKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTL************LRRFLKVSRNFDLP**VKRSNFKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAE**********************EEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVT**********************************************KLISKLGVLAKAAPVCILC*****************
MSLSINMDLPAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLGFLAKAAAAPFAKLNQKSKLLRVLSAKKLISKLGVLAKAAPVCILCGHAS*************
*SLSINMDLPAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKSTSMEDGVLTVTFTR***********SVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLGFL**************SKLLRVLSAKKLISKLGVLAKAAPVCILCGH***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSINMDLPAFITESSKFIDSSNISTRWEYDGDKIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLGFLAKAAAAPFAKLNQKSKLLRVLSAKKLISKLGVLAKAAPVCILCGHASSNSGSSNNSNSQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
Q9LNW0157 17.8 kDa class I heat sho yes no 0.338 0.668 0.464 1e-13
P27880158 18.2 kDa class I heat sho N/A no 0.377 0.740 0.357 4e-13
P27879143 18.1 kDa class I heat sho N/A no 0.345 0.748 0.410 8e-13
Q9XIE3155 17.6 kDa class I heat sho no no 0.338 0.677 0.455 3e-12
P13853157 17.6 kDa class I heat sho no no 0.319 0.630 0.413 5e-12
Q84Q77161 17.9 kDa class I heat sho yes no 0.338 0.652 0.4 1e-11
P04795154 17.6 kDa class I heat sho no no 0.351 0.707 0.377 2e-11
Q84J50159 17.7 kDa class I heat sho no no 0.325 0.635 0.425 4e-11
P02519153 17.3 kDa class I heat sho no no 0.309 0.627 0.417 4e-11
P05478161 18.5 kDa class I heat sho no no 0.312 0.602 0.392 7e-11
>sp|Q9LNW0|HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (60%), Gaps = 7/112 (6%)

Query: 130 AFLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETE-EEEGDTIP 188
           A  NA + W+ + + HV KA L PGMKKE+VK+EIEDD   LK+      E EE+ DT  
Sbjct: 44  AITNARVDWKETAEAHVFKADL-PGMKKEEVKVEIEDDSV-LKISGERHVEKEEKQDT-- 99

Query: 189 EWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKPIKPKKTQQ 240
            W   E + G+  R+FKLP +V++D  K  M E+GVLTVT  K  + KK  Q
Sbjct: 100 -WHRVERSSGQFSRKFKLPENVKMDQVKASM-ENGVLTVTVPKVEEAKKKAQ 149

Arabidopsis thaliana (taxid: 3702)
>sp|P27880|HSP12_MEDSA 18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1 Back     alignment and function description
>sp|P27879|HSP11_MEDSA 18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIE3|HS17A_ARATH 17.6 kDa class I heat shock protein 1 OS=Arabidopsis thaliana GN=HSP17.6A PE=1 SV=1 Back     alignment and function description
>sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 Back     alignment and function description
>sp|Q84Q77|HS17A_ORYSJ 17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1 Back     alignment and function description
>sp|P04795|HSP15_SOYBN 17.6 kDa class I heat shock protein OS=Glycine max GN=HSP17.6-L PE=3 SV=1 Back     alignment and function description
>sp|Q84J50|HS177_ORYSJ 17.7 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.7 PE=2 SV=1 Back     alignment and function description
>sp|P02519|HSP11_SOYBN 17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1 Back     alignment and function description
>sp|P05478|HSP16_SOYBN 18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
255558872198 heat-shock protein, putative [Ricinus co 0.567 0.888 0.341 3e-15
255558876151 heat-shock protein, putative [Ricinus co 0.345 0.708 0.446 1e-12
321266547151 heat shock protein 17 [Hordeum vulgare s 0.319 0.655 0.442 1e-12
158828220153 HSP21 [Cleome spinosa] 0.338 0.686 0.441 2e-12
326518244151 predicted protein [Hordeum vulgare subsp 0.312 0.642 0.450 3e-12
83776798142 17.5 kDa class I HSP [Arachis hypogaea] 0.312 0.683 0.441 5e-12
15222395157 class I heat shock protein [Arabidopsis 0.338 0.668 0.464 6e-12
255558916158 heat-shock protein, putative [Ricinus co 0.348 0.683 0.424 7e-12
38639431154 17.5 kDa class I heat shock protein [Car 0.341 0.688 0.414 7e-12
83701135150 17.3 kDa class I heat shock protein [Ara 0.312 0.646 0.441 8e-12
>gi|255558872|ref|XP_002520459.1| heat-shock protein, putative [Ricinus communis] gi|223540301|gb|EEF41872.1| heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 88.6 bits (218), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 103/196 (52%), Gaps = 20/196 (10%)

Query: 36  IVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNF 95
            V  A++   R EDV+++I  + + L     I  G    R+     ++  LP  V   + 
Sbjct: 8   FVITANVQVFRTEDVRVEIRGRNVVL----KIGGG----RQNCGCIKSCQLPSNVN-VDM 58

Query: 96  KSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVLKASLLPGM 155
            +TS+ +GVL V           TSS  + ++  AF+NA + W+ + + HV KA L PG+
Sbjct: 59  TTTSINNGVLFV------KTPFPTSSSILSRENSAFVNARVDWKETPEAHVFKADL-PGL 111

Query: 156 KKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDF 215
           KKE+VK+EIEDD     + +  E   E+ D    W   E + GK +RRF+LP + ++D  
Sbjct: 112 KKEEVKVEIEDDRV---LQISGERNVEKEDKNDTWHRVERSSGKFLRRFRLPENAKMDQV 168

Query: 216 KTEMEEDGVLTVTFTK 231
           K  M E+GVLTV+  K
Sbjct: 169 KASM-ENGVLTVSVPK 183

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558876|ref|XP_002520461.1| heat-shock protein, putative [Ricinus communis] gi|223540303|gb|EEF41874.1| heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|321266547|gb|ADW78609.1| heat shock protein 17 [Hordeum vulgare subsp. spontaneum] Back     alignment and taxonomy information
>gi|158828220|gb|ABW81098.1| HSP21 [Cleome spinosa] Back     alignment and taxonomy information
>gi|326518244|dbj|BAK07374.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|83776798|gb|ABC46712.1| 17.5 kDa class I HSP [Arachis hypogaea] Back     alignment and taxonomy information
>gi|15222395|ref|NP_172220.1| class I heat shock protein [Arabidopsis thaliana] gi|75311415|sp|Q9LNW0.1|HS178_ARATH RecName: Full=17.8 kDa class I heat shock protein; AltName: Full=17.8 kDa heat shock protein; Short=AtHsp17.8 gi|8778561|gb|AAF79569.1|AC022464_27 F22G5.25 [Arabidopsis thaliana] gi|21555637|gb|AAM63903.1| heat shock protein, putative [Arabidopsis thaliana] gi|26452709|dbj|BAC43437.1| putative heat shock protein [Arabidopsis thaliana] gi|28973039|gb|AAO63844.1| putative heat shock protein [Arabidopsis thaliana] gi|332189999|gb|AEE28120.1| class I heat shock protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255558916|ref|XP_002520481.1| heat-shock protein, putative [Ricinus communis] gi|223540323|gb|EEF41894.1| heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|38639431|gb|AAR25848.1| 17.5 kDa class I heat shock protein [Carica papaya] Back     alignment and taxonomy information
>gi|83701135|gb|ABC41131.1| 17.3 kDa class I heat shock protein [Arachis hypogaea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.416 0.801 0.340 2.5e-12
TAIR|locus:2042977153 AT2G29500 "AT2G29500" [Arabido 0.325 0.660 0.386 7.7e-12
TAIR|locus:2024997157 AT1G07400 [Arabidopsis thalian 0.293 0.579 0.416 1e-11
TAIR|locus:2075256156 HSP17.4 "heat shock protein 17 0.303 0.602 0.396 1.8e-11
UNIPROTKB|Q943E7149 HSP16.9C "16.9 kDa class I hea 0.293 0.610 0.364 2.3e-11
UNIPROTKB|Q943E6150 HSP16.9B "16.9 kDa class I hea 0.293 0.606 0.375 3.1e-11
TAIR|locus:2025921155 AT1G59860 [Arabidopsis thalian 0.293 0.587 0.406 5.3e-11
UNIPROTKB|Q84Q72161 HSP18.1 "18.1 kDa class I heat 0.422 0.813 0.316 5.3e-11
TAIR|locus:2024862157 AT1G53540 [Arabidopsis thalian 0.3 0.592 0.377 5.3e-11
UNIPROTKB|P27777150 HSP16.9A "16.9 kDa class I hea 0.293 0.606 0.364 6.9e-11
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 2.5e-12, P = 2.5e-12
 Identities = 47/138 (34%), Positives = 73/138 (52%)

Query:    89 GVKRSN-FKSTSMEDGVLTVTFTRDAAATANTSSRSVYKKVIAFLNAVIYWETSLDKHVL 147
             G +RSN F   S +       F   ++A AN S+    + V AF NA + W+ + + HV 
Sbjct:     9 GGRRSNVFDPFSQDLWDPFEGFFTPSSALANASTA---RDVAAFTNARVDWKETPEAHVF 65

Query:   148 KASLLPGMKKEDVKIEIEDDGAELKMIVLLXXXXXXGDTIPEWLLEEFTDGKIIRRFKLP 207
             KA L PG+KKE+VK+E+ED      + +         +   +W   E   GK +RRF+LP
Sbjct:    66 KADL-PGLKKEEVKVEVEDKNV---LQISGERSKENEEKNDKWHRVERASGKFMRRFRLP 121

Query:   208 ADVRLDDFKTEMEEDGVL 225
              + ++++ K  ME +GVL
Sbjct:   122 ENAKMEEVKATME-NGVL 138
GO:0005737 "cytoplasm" evidence=ISM
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0010286 "heat acclimation" evidence=IEP
GO:0009644 "response to high light intensity" evidence=IEP;RCA
GO:0042542 "response to hydrogen peroxide" evidence=IEP;RCA
GO:0006457 "protein folding" evidence=RCA
TAIR|locus:2042977 AT2G29500 "AT2G29500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024997 AT1G07400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075256 HSP17.4 "heat shock protein 17.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E7 HSP16.9C "16.9 kDa class I heat shock protein 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E6 HSP16.9B "16.9 kDa class I heat shock protein 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025921 AT1G59860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84Q72 HSP18.1 "18.1 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2024862 AT1G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P27777 HSP16.9A "16.9 kDa class I heat shock protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G07400
17.8 kDa class I heat shock protein (HSP17.8-CI); 17.8 kDa class I heat shock protein (HSP17.8-CI); INVOLVED IN- response to oxidative stress, response to heat; CONTAINS InterPro DOMAIN/s- Heat shock protein Hsp20 (InterPro-IPR002068), HSP20-like chaperone (InterPro-IPR008978); BEST Arabidopsis thaliana protein match is- 17.6 kDa class I heat shock protein (HSP17.6A-CI) (TAIR-AT1G59860.1); Has 4521 Blast hits to 4521 proteins in 968 species- Archae - 130; Bacteria - 2463; Metazoa - 119; Fungi - 227; Plants - 1004; Viruses - 0; Other Eukaryotes - 578 (source- NCBI BLink). (157 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AKR2
AKR2 (ANKYRIN REPEAT-CONTAINING PROTEIN 2); protein binding; Involved in targeting of chloropla [...] (342 aa)
    • • 0.983
OEP7
OEP7 (OUTER ENVELOPE MEMBRANE PROTEIN 7); encodes a 7 kDa chloroplast outer envelope membrane p [...] (64 aa)
      • 0.886
AT5G51440
23.5 kDa mitochondrial small heat shock protein (HSP23.5-M); 23.5 kDa mitochondrial small heat [...] (210 aa)
   •• ••0.867
AT2G07738
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (88 aa)
    •   0.796
ATHSP101
ATHSP101 (ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 101); ATP binding / ATPase/ nucleoside-tripho [...] (911 aa)
•  •  • 0.736
HSP70
HSP70 (heat shock protein 70); ATP binding; heat shock protein 70 (HSP70); FUNCTIONS IN- ATP bi [...] (650 aa)
   •  • 0.716
AT1G59860
17.6 kDa class I heat shock protein (HSP17.6A-CI); 17.6 kDa class I heat shock protein (HSP17.6 [...] (155 aa)
• ••  ••0.675
HSP17.7
AT-HSP17.6A (ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.6A); unfolded protein binding; Encodes [...] (156 aa)
• ••  ••0.658
ATHSP90.1
ATHSP90.1 (HEAT SHOCK PROTEIN 90.1); ATP binding / unfolded protein binding; Encodes a cytosoli [...] (705 aa)
   •  • 0.647
HSP17.6II
HSP17.6II (17.6 KDA CLASS II HEAT SHOCK PROTEIN); 17.6 KDA CLASS II HEAT SHOCK PROTEIN (HSP17.6 [...] (155 aa)
• ••  ••0.645

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 1e-16
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 6e-13
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 1e-12
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 7e-11
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 2e-09
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 9e-09
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 1e-08
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 6e-07
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 6e-07
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 4e-06
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 1e-04
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 1e-04
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 0.003
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information 
 Score = 73.1 bits (180), Expect = 1e-16
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 15/101 (14%)

Query: 136 IYWETSLDKHVLKASLLPGMKKEDVKIEIEDDG-----AELKMIVLLETEEEEGDTIPEW 190
           + W+ + + HV KA + PG+KKEDVK+E+ED        E K       EE++GD   +W
Sbjct: 2   VDWKETPEAHVFKADV-PGVKKEDVKVEVEDGRVLRISGERKK-----EEEKKGD---DW 52

Query: 191 LLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTK 231
              E + G+ +RRF+LP +   D+ K  + E+GVLTVT  K
Sbjct: 53  HRVERSSGRFVRRFRLPENADADEVKAFL-ENGVLTVTVPK 92

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative stress. Also belonging to this group is wheat HSP16.9 which differs in quaternary structure from the shell-type particles of ScHsp26, it assembles as a dodecameric double disc, with each disc organized as a trimer of dimers. Length = 92
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
PRK11597142 heat shock chaperone IbpB; Provisional 99.9
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.9
PRK10743137 heat shock protein IbpA; Provisional 99.9
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.89
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.87
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.86
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.85
PRK10743137 heat shock protein IbpA; Provisional 99.83
PRK11597142 heat shock chaperone IbpB; Provisional 99.83
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.82
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.81
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.8
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.8
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.8
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.79
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.79
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.78
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.77
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.77
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.76
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.76
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.75
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.75
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.73
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.73
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.73
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.73
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.72
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.72
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.72
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.72
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.71
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.71
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.69
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.67
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.66
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.63
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.61
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.57
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.51
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.33
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.29
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.25
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.16
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 98.95
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 98.88
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.65
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.52
cd0646384 p23_like Proteins containing this p23_like domain 98.52
cd0646384 p23_like Proteins containing this p23_like domain 98.44
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.18
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.13
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 97.87
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 97.63
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.22
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.17
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.16
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.1
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 96.96
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 96.95
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 96.7
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 96.5
cd0648887 p23_melusin_like p23_like domain similar to the C- 96.45
cd0648887 p23_melusin_like p23_like domain similar to the C- 96.34
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 96.34
cd0646892 p23_CacyBP p23_like domain found in proteins simil 96.34
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.03
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 96.03
cd0646892 p23_CacyBP p23_like domain found in proteins simil 95.85
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 94.52
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 94.02
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 93.96
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 93.29
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.04
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.91
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 92.83
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 90.98
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 90.41
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 89.77
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 88.96
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 82.15
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information 
Probab=99.90  E-value=3.3e-23  Score=175.67  Aligned_cols=106  Identities=17%  Similarity=0.292  Sum_probs=92.4

Q ss_pred             ecceEEEee-cCcEEEEEEecCCCCCCCCeEEEEECCeeeEEEEEEEEeeecccCCCccEEEEeeecceEEEEEECCCCc
Q 041271          132 LNAVIYWET-SLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADV  210 (310)
Q Consensus       132 ~~p~vdv~e-t~~~~~i~~~~lPG~~~edI~V~v~~~~~~L~I~~~g~~~~~~~~~~~~~~~~E~~~g~F~R~~~LP~~v  210 (310)
                      ..|++||.+ ++++|.|.++ |||++++||+|++++|.  |+|  +|+++.  +.++.+|+++|+.+|.|.|+|.||.+|
T Consensus        31 ~~P~vdI~e~~~~~y~v~ad-lPGv~kedi~V~v~~~~--LtI--~ge~~~--~~~~~~~~~~Er~~g~F~R~f~LP~~v  103 (142)
T PRK11597         31 SFPPYNIEKSDDNHYRITLA-LAGFRQEDLDIQLEGTR--LTV--KGTPEQ--PEKEVKWLHQGLVNQPFSLSFTLAENM  103 (142)
T ss_pred             CCCcEEEEEcCCCEEEEEEE-eCCCCHHHeEEEEECCE--EEE--EEEEcc--ccCCCcEEEEEEeCcEEEEEEECCCCc
Confidence            348899998 5779999999 99999999999999999  999  999764  345678999999999999999999999


Q ss_pred             ccCCeEEEeeeCCEEEEEEeCCCCCCCCCceEEEEecC
Q 041271          211 RLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKLLG  248 (310)
Q Consensus       211 d~~~I~A~l~~dGvL~ItvPK~~~~~~~~~r~I~I~~~  248 (310)
                      |.+  +|+|+ ||||+|++||. .++..++++|+|+..
T Consensus       104 d~~--~A~~~-nGVL~I~lPK~-~~~~~~~rkI~I~~~  137 (142)
T PRK11597        104 EVS--GATFV-NGLLHIDLIRN-EPEAIAPQRIAISER  137 (142)
T ss_pred             ccC--cCEEc-CCEEEEEEecc-CccccCCcEEEECCc
Confidence            998  69999 99999999997 333445699999543

>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 5e-17
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 4e-07
1gme_A151 Heat shock protein 16.9B; small heat shock protein 5e-16
1gme_A151 Heat shock protein 16.9B; small heat shock protein 4e-08
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 1e-15
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 4e-10
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 2e-14
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 2e-09
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 1e-12
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 4e-10
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 9e-10
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 9e-09
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 4e-09
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 9e-09
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 2e-08
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 3e-08
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 6e-08
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 1e-07
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 1e-07
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
 Score = 79.1 bits (194), Expect = 5e-17
 Identities = 30/212 (14%), Positives = 66/212 (31%), Gaps = 27/212 (12%)

Query: 32  DGDKIVCKASLPAVRMEDVKIDINDKELTLT-RELNIADGGTILRRFLKVSRNFDLPDGV 90
                    ++   + E++ I  +  +L +  ++        +        R+  LP  V
Sbjct: 110 GRLHFKVYFNVKNFKAEEITIKADKNKLVVRAQKSVACGDAAMSESV---GRSIPLPPSV 166

Query: 91  KRSNFKSTSMEDGVLTVTFTRDAAATANTSSRS--------------VYKKVIAFLNAVI 136
            R++ ++T   D VL +    +                                    ++
Sbjct: 167 DRNHIQATITTDDVLVIEAPVNEPNYKAIKLSPEKGLAIQPSEVQERQLAVKNKEGLEIV 226

Query: 137 YWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFT 196
             E    K  L+  + P    +DVK+  + +      +  +  +EE+ +        EF 
Sbjct: 227 TAEDGSKKIHLELKVDPHFAPKDVKVWAKGNKV---YVHGVTGKEEKTENASHSEHREFY 283

Query: 197 DGKIIRRFKLPADVRLDDFKTEMEEDGVLTVT 228
                + F  P  V     + E+  DG++ V 
Sbjct: 284 -----KAFVTPEVVDASKTQAEI-VDGLMVVE 309
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 100.0
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.92
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.9
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.9
4fei_A102 Heat shock protein-related protein; stress respons 99.89
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.86
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.85
4fei_A102 Heat shock protein-related protein; stress respons 99.85
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.85
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.84
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.83
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.81
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.79
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.79
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.79
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.78
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.77
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.76
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.75
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.74
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.7
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.65
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.52
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.51
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.5
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.43
3igf_A374 ALL4481 protein; two-domained protein consisting o 98.16
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.77
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.71
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.59
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.56
3igf_A374 ALL4481 protein; two-domained protein consisting o 96.96
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 96.74
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 96.71
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 96.6
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 96.58
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 96.48
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.46
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 96.38
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 96.27
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 96.21
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.06
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 95.99
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 95.9
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 95.8
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 95.72
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 95.64
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 95.15
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 94.72
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 94.31
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 94.31
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 93.75
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
Probab=100.00  E-value=7.8e-38  Score=295.36  Aligned_cols=197  Identities=16%  Similarity=0.159  Sum_probs=154.7

Q ss_pred             CCceeeEEEeCC----EEEEEEEcCCCCCCceEEEEeCCEEEEEEEEEecccceeEEeecceEEeeeCCcccCcCCccee
Q 041271           23 SNISTRWEYDGD----KIVCKASLPAVRMEDVKIDINDKELTLTRELNIADGGTILRRFLKVSRNFDLPDGVKRSNFKST   98 (310)
Q Consensus        23 ~~~~~dv~E~ed----~y~v~vdLPGv~~edI~V~v~~~~L~I~g~~~~~~~~~~er~~g~f~R~~~LP~~vd~~~~~~A   98 (310)
                      ..|++|++|+++    .|+|.++||||+++||+|.++++.|+|+|+++.+...  .|.+|+|.|+|.||.+|+ .+.++|
T Consensus        97 ~~p~vDi~E~~~dgk~~~~v~~dlPG~~~edI~V~v~~~~L~I~ge~~~~~e~--~r~~g~F~R~~~LP~~Vd-~e~i~A  173 (314)
T 2bol_A           97 LDFLKDAYEVGKDGRLHFKVYFNVKNFKAEEITIKADKNKLVVRAQKSVACGD--AAMSESVGRSIPLPPSVD-RNHIQA  173 (314)
T ss_dssp             TGGGGGCEEECTTSSEEEEEEEECTTCCTTTEEEEEETTEEEEEECCBSSTTC--CCBCCCEEEEEECCTTBC-GGGCEE
T ss_pred             CCCccceEEcCCCCceEEEEEEECCCCchHHeEEEEECCEEEEEEEEeccCCC--CEEEEEEEEEEECCCCcc-ccccEE
Confidence            458999999999    9999999999999999999999999999998754432  288999999999999999 889999


Q ss_pred             eee-CCeEEEEeecccccccccc---ccccchh-e-------eeeecceEEEee---cCcEEEEEEecC-CCCCCCCeEE
Q 041271           99 SME-DGVLTVTFTRDAAATANTS---SRSVYKK-V-------IAFLNAVIYWET---SLDKHVLKASLL-PGMKKEDVKI  162 (310)
Q Consensus        99 ~~~-dGvL~I~lPK~~~a~a~~~---s~~~~~~-~-------~~~~~p~vdv~e---t~~~~~i~~~~l-PG~~~edI~V  162 (310)
                      .|+ ||+|+|++||...+....+   ..+...+ .       ........+|.+   +++.|.+.++ | |||++|||+|
T Consensus       174 ~~~~nGVL~I~lPK~~~~~~~I~it~~~ql~Iqp~s~~q~~l~vkg~~~~~i~e~~~~~~~~~v~~~-ldPG~~~edi~V  252 (314)
T 2bol_A          174 TITTDDVLVIEAPVNEPNYKAIKLSPEKGLAIQPSEVQERQLAVKNKEGLEIVTAEDGSKKIHLELK-VDPHFAPKDVKV  252 (314)
T ss_dssp             EECSSSEEEEEEEBSSCCTTTEEEETTTEEEECCBCCSSCCSCCCSCCEEEEEECTTSCEEEEEEEE-CCTTCCGGGEEE
T ss_pred             EEeCCCEEEEEEeccCcccceeecccCCccCcCCCccccceeecccCCCCcEEEecCCCcEEEEEEE-cCCCCChHHeEE
Confidence            999 9999999999876532211   0111000 0       011123455555   4468888888 9 9999999999


Q ss_pred             EEECCeeeEEEEEEEEeeecccCCCccEEEEeeecceEEEEEECCCCcccCCeEEEeeeCCEEEEEEeCC
Q 041271          163 EIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADVRLDDFKTEMEEDGVLTVTFTKP  232 (310)
Q Consensus       163 ~v~~~~~~L~I~~~g~~~~~~~~~~~~~~~~E~~~g~F~R~~~LP~~vd~~~I~A~l~~dGvL~ItvPK~  232 (310)
                      +++++.  |+|  +|+++.+.+    .|+++|+.||.|.|+|.||++||.++|+|+|+ ||||+|++||.
T Consensus       253 ~v~~~~--LtI--~ge~~~~~~----~~~~~Er~~g~F~R~~~LP~~vd~~~i~A~~~-dGvL~i~~Pk~  313 (314)
T 2bol_A          253 WAKGNK--VYV--HGVTGKEEK----TENASHSEHREFYKAFVTPEVVDASKTQAEIV-DGLMVVEAPLF  313 (314)
T ss_dssp             EESSSE--EEE--EEEEC----------------CEEEEEEEECSSEECGGGCEEEEE-TTEEEEEEEEE
T ss_pred             EEECCE--EEE--EEEEeccCC----ceEEEEEeeeEEEEEEECCCCcChHHeEEEEe-CCEEEEEEecC
Confidence            999999  999  999876543    47889999999999999999999999999999 99999999986
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 9e-10
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 3e-06
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 2e-09
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 3e-04
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 53.1 bits (127), Expect = 9e-10
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 7/97 (7%)

Query: 143 DKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIR 202
               + A L PG+ KED+ +    D  E++         E    I         + +I R
Sbjct: 20  QHIKVIAWL-PGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSE---IPEEEEIYR 75

Query: 203 RFKLPADVRLDDFKTEMEEDGVLTVTFTK--PIKPKK 237
             KLPA V+ ++   +  E+GVL+V   K      K 
Sbjct: 76  TIKLPATVKEENASAKF-ENGVLSVILPKAESSIKKG 111
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.9
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.87
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.76
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.76
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.59
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.42
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 95.88
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 95.45
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 95.33
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 95.26
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 94.93
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 93.88
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 91.66
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 91.36
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.90  E-value=9.5e-24  Score=177.33  Aligned_cols=110  Identities=40%  Similarity=0.644  Sum_probs=98.7

Q ss_pred             eecceEEEeecCcEEEEEEecCCCCCCCCeEEEEECCeeeEEEEEEEEeeecccCCCccEEEEeeecceEEEEEECCCCc
Q 041271          131 FLNAVIYWETSLDKHVLKASLLPGMKKEDVKIEIEDDGAELKMIVLLETEEEEGDTIPEWLLEEFTDGKIIRRFKLPADV  210 (310)
Q Consensus       131 ~~~p~vdv~et~~~~~i~~~~lPG~~~edI~V~v~~~~~~L~I~~~g~~~~~~~~~~~~~~~~E~~~g~F~R~~~LP~~v  210 (310)
                      .+.|++||.+++++|+|+++ |||++++||+|+++++. +|+|  +|+++.+...++.+|+.+|+.+|.|.|+|.||.+|
T Consensus        40 ~~~p~~dv~e~~~~~~i~~~-lPG~~~edi~v~v~~~~-~l~i--~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~v  115 (150)
T d1gmea_          40 FANARMDWKETPEAHVFKAD-LPGVKKEEVKVEVEDGN-VLVV--SGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDA  115 (150)
T ss_dssp             HGGGCEEEEECSSEEEEEEE-CTTCCGGGEEEEEETTT-EEEE--EECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCC
T ss_pred             cCCCceeEEECCCEEEEEEE-eCCCccCCEEEEEEEcc-ceeE--EEEEecccccccceeeeeeeccceEEEEEECCCCe
Confidence            45689999999999999999 99999999999999754 3789  99988887788889999999999999999999999


Q ss_pred             ccCCeEEEeeeCCEEEEEEeCCCCCCCCCceEEEEe
Q 041271          211 RLDDFKTEMEEDGVLTVTFTKPIKPKKTQQQLISKL  246 (310)
Q Consensus       211 d~~~I~A~l~~dGvL~ItvPK~~~~~~~~~r~I~I~  246 (310)
                      |.++|+|+|+ ||+|+|++||. ++++++.++|+|+
T Consensus       116 d~~~i~A~~~-nGvL~I~lpK~-~~~~~~~~~I~I~  149 (150)
T d1gmea_         116 KVEEVKAGLE-NGVLTVTVPKA-EVKKPEVKAIQIS  149 (150)
T ss_dssp             CGGGCEEEEE-TTEEEEEEECC-CCCTTCCCCCCCC
T ss_pred             eeceeEEEEE-CCEEEEEEEcC-CcCCCCceEEecc
Confidence            9999999999 99999999999 5666756666663
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure