Citrus Sinensis ID: 041297


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
KIVIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSDEESSTGSARSARSGGYSARVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQAKKQQLSRAVRSHWSV
cEEEEccccccccccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHccccccccccccccccEEEEEEEHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEcHHHHHHHHHHcccccccccccccccccccccccEEEEEccccHHcHHHHHHHHcccccEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccccccEEEEHHHHHHHHHHHHHccc
cEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccEEEEEEEEEEEHEEEcccccccccccccEEEccccHHHHHHHHHHHccccEEEEEcccccccccccccccccccccEEEEcHHHHHHHHHHHHHHccccccccHHHccccccccEEEEcccccHHHHHHHHHHccccccEEEEEccccEEEEEEcHcHHcHHHHHHHHHHHHHHHHHHHEEEcccccHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHHHcccEEEEcccccccccEEEHHHHHHHHHHHHccccc
kiviarsvrpmhwcdeialGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAAniddhedsagcscigkVCMVDIITflcpcfcsfakdsgivrhlkpsaSLLEAVDLLLGGVqnlvilpagiklqpkpslkstfhndseycwLTQEDLIRYFLNFIgllnptpnqpinshniiddagilaihyddpaafaiPLIAQSHIKQTSVAIVDeegrlvgdispfslnsCDETVAAAIATLLAGDLmaymdcgrPLKDLVRLVKQRLDEKNMVGLLELMEddleissgscsnssssdeesstgsarsarsggysarVVHRseaivcypwSSLMAVIMQALARRDRLRSMakaenpnfcpvRIQAKKQQLSRAVRSHWSV
kiviarsvrpmhWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGscsnssssdeesstgsarsarsggysarvvhrSEAIVCYPWSSLMAVIMQALARRDRLRSMAkaenpnfcpvriqakkqqlsravrshwsv
KIVIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEIssgscsnssssdeesstgsarsarsggysarVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQAKKQQLSRAVRSHWSV
**VIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSS*******************SAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLEL************************************ARVVHRSEAIVCYPWSSLMAVIMQALARRD*************C*********************
****ARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSA***************SAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVI*********************EYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVR**************************************************************IVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQAKKQQLSRAVRSHW**
KIVIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSS*****************EDSAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLE*******************************RVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQ****************
KIVIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSA***************SAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAG***************DSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLE*******************************************SEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQAKKQQLSR********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KIVIARSVRPMHWCDEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCPCFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSDEESSTGSARSARSGGYSARVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQAKKQQLSRAVRSHWSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q84WQ5391 CBS domain-containing pro yes no 0.778 0.754 0.367 4e-48
>sp|Q84WQ5|CBSX5_ARATH CBS domain-containing protein CBSX5 OS=Arabidopsis thaliana GN=CBSX5 PE=2 SV=2 Back     alignment and function desciption
 Score =  192 bits (488), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 197/346 (56%), Gaps = 51/346 (14%)

Query: 28  ALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCP-- 85
           A+ ALK   ++++++W+ +H             D +++  C C+GK+ M D+I  L    
Sbjct: 33  AIAALKSSEDTFLSVWNCNH-------------DDDNNTECECLGKISMADVICHLSKDH 79

Query: 86  --CFCSF--------AKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSL 135
               C+          K   IV H++PS SL+EA+DL++ G QNL++      +  KP  
Sbjct: 80  DHSLCALNSSVSVLLPKTRSIVLHVQPSCSLIEAIDLIIKGAQNLIV-----PIHTKPYT 134

Query: 136 KSTFHNDS------------EYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDA-G 182
           K   HND+             +CW+TQED+I++ L FI   +P P   ++   +I+    
Sbjct: 135 KKKQHNDNVSVTTTTHSNGQRFCWITQEDIIQFLLGFIAAFSPLPAMSLSDLGVINSTHT 194

Query: 183 ILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEG-----RLVGDISPFSLNSCDETVAAA 237
           ++A+ Y   A+  +  ++ +   QTSVA+VD EG      L+G+ISP +L  CDET AAA
Sbjct: 195 VVAVDYHSSASAVVSAVSNALAVQTSVAVVDGEGDDPFTSLIGEISPMTLTCCDETAAAA 254

Query: 238 IATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSD 297
           +ATL AGDLMAY+D   P + LV++V+ RL++K ++GL+ L +    +SS S S+  SS+
Sbjct: 255 VATLSAGDLMAYIDGANPPESLVQIVRNRLEDKGLIGLMSLFD---SLSSYSTSSGYSSE 311

Query: 298 EESSTGSARSARSGGYSARVVHRSEAIVCYPWSSLMAVIMQALARR 343
           EE+   +    RS   SAR+  +SEAIVC P SSLMAV++QA+A R
Sbjct: 312 EEAPVRTTSYGRSMSSSARMARKSEAIVCNPKSSLMAVMIQAVAHR 357





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
255556011396 conserved hypothetical protein [Ricinus 0.815 0.780 0.529 4e-82
224079247394 predicted protein [Populus trichocarpa] 0.817 0.786 0.513 7e-82
225470342384 PREDICTED: CBS domain-containing protein 0.791 0.781 0.510 2e-77
449457825398 PREDICTED: CBS domain-containing protein 0.804 0.766 0.510 4e-75
224125284391 predicted protein [Populus trichocarpa] 0.807 0.782 0.502 5e-73
356549353398 PREDICTED: CBS domain-containing protein 0.817 0.778 0.494 1e-69
357446497396 hypothetical protein MTR_2g013110 [Medic 0.820 0.785 0.467 6e-69
255644848398 unknown [Glycine max] 0.820 0.781 0.483 1e-67
356555172395 PREDICTED: LOW QUALITY PROTEIN: CBS doma 0.817 0.784 0.473 3e-67
388520909389 unknown [Medicago truncatula] 0.767 0.748 0.468 1e-66
>gi|255556011|ref|XP_002519040.1| conserved hypothetical protein [Ricinus communis] gi|223541703|gb|EEF43251.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  311 bits (796), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 180/340 (52%), Positives = 233/340 (68%), Gaps = 31/340 (9%)

Query: 27  HALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCP- 85
            AL  LKR ++ Y+++WS DH+ +K      N  +      C CIGK+CMVDII+FLC  
Sbjct: 31  EALSGLKRSDDPYLSVWSCDHNNKKNYINNNNNSNE-----CRCIGKICMVDIISFLCKE 85

Query: 86  --------------CFCSFAKDSGIVRHLKPSASLLEAVDLLLGGVQNLVILPAG----- 126
                              +K  G+VR L+P ASLLEA+DL+L G QNLVI P       
Sbjct: 86  ENLKNLPRALQEPLSSVLVSKVYGLVRPLEPHASLLEAIDLILEGAQNLVI-PVHSPFTR 144

Query: 127 IKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAI 186
            KL  + S  ST HN+ EYCWLTQED+IRY LN IGL +P PN  + S NIID   ILA+
Sbjct: 145 KKLIHRTSSYSTLHNNREYCWLTQEDIIRYLLNCIGLFSPIPNHTVESLNIIDTESILAV 204

Query: 187 HYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDL 246
            YD+PA+ A+PLI+QS +KQTSVAI+D EG+L+G+ISP++LNSCDE VAAAIATL AG+L
Sbjct: 205 CYDEPASSALPLISQSLVKQTSVAILDIEGKLIGEISPYTLNSCDELVAAAIATLSAGEL 264

Query: 247 MAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEI---SSGSCSNSSSSDEESSTG 303
           MAY+DCG P +DL+RLVK+RL+E+N+  +LELME++  I   SS   S SSSSDEE   G
Sbjct: 265 MAYVDCGDPPEDLIRLVKERLEERNLEIVLELMEEESGISSSSSSFSSFSSSSDEEFGLG 324

Query: 304 SARSARSGGYSARVVHRSEAIVCYPWSSLMAVIMQALARR 343
            + S R  G+S RV  R++AIVC+PWSSL+AV++QA++ R
Sbjct: 325 KSGSFR--GHSTRVARRTDAIVCFPWSSLVAVMIQAISHR 362




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224079247|ref|XP_002305808.1| predicted protein [Populus trichocarpa] gi|222848772|gb|EEE86319.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225470342|ref|XP_002269338.1| PREDICTED: CBS domain-containing protein CBSX5 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457825|ref|XP_004146648.1| PREDICTED: CBS domain-containing protein CBSX5-like [Cucumis sativus] gi|449527799|ref|XP_004170897.1| PREDICTED: CBS domain-containing protein CBSX5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224125284|ref|XP_002329767.1| predicted protein [Populus trichocarpa] gi|222870829|gb|EEF07960.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549353|ref|XP_003543058.1| PREDICTED: CBS domain-containing protein CBSX5-like [Glycine max] Back     alignment and taxonomy information
>gi|357446497|ref|XP_003593526.1| hypothetical protein MTR_2g013110 [Medicago truncatula] gi|124360612|gb|ABN08611.1| CBS [Medicago truncatula] gi|355482574|gb|AES63777.1| hypothetical protein MTR_2g013110 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255644848|gb|ACU22924.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356555172|ref|XP_003545910.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein CBSX5-like [Glycine max] Back     alignment and taxonomy information
>gi|388520909|gb|AFK48516.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
TAIR|locus:2164027408 AT5G53750 "AT5G53750" [Arabido 0.659 0.612 0.373 1.1e-48
TAIR|locus:2123999391 CBSX5 "AT4G27460" [Arabidopsis 0.796 0.772 0.330 7.3e-43
TAIR|locus:2206265425 CBSX6 "AT1G65320" [Arabidopsis 0.300 0.268 0.310 8.7e-05
TAIR|locus:2164027 AT5G53750 "AT5G53750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 1.1e-48, Sum P(2) = 1.1e-48
 Identities = 103/276 (37%), Positives = 152/276 (55%)

Query:    92 KDSGIVRHLKPSASLLEAVDLLLGGVQNLV--ILPAGI--KLQPKPSLK----------- 136
             K   +V H++ S SL+EA+DL++ G QNL+  I    I  + Q +  LK           
Sbjct:   101 KSRALVVHVQSSCSLIEAIDLIIKGAQNLIVPIHTKSITKRRQQQKLLKRNVVVSLTNAT 160

Query:   137 STFHNDS-EYCWLTQEDLIRYFLNFIGLLNPTPNQPINSHNIIDDAG-ILAIHYDDPAAF 194
             ST H +S E+CW+TQED+IR+ L+ I + +P P+  I+   +I+    ILA+ Y   AA 
Sbjct:   161 STTHKNSREFCWITQEDIIRFLLDSISVFSPLPSLSISDLGVINSTHTILAVDYYSSAAS 220

Query:   195 AIPLIAQSHIKQTSVAIV----DEEGR---LVGDISPFSLNSCDETVAAAIATLLAGDLM 247
             A+  I+++ +   SVA+V    D+E     L+G+ISP +L  CDET  AA+ATL AGDLM
Sbjct:   221 AVSAISRAILDNVSVAVVGKGCDQEDPCMVLIGEISPMTLACCDETAVAAVATLSAGDLM 280

Query:   248 AYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEIXXXXXXXXXXXXXXXXXXXXXX 307
             +Y+D   P + LV +V+ RL++K MVGL+ L+ D L +                      
Sbjct:   281 SYIDGSGPPESLVGVVRNRLEDKGMVGLISLI-DSLSLSSGSSSDEESPAGKTRMTSSYG 339

Query:   308 XXXXXXXXXVVHRSEAIVCYPWSSLMAVIMQALARR 343
                      +  +S AIVC   SSLMAV++QA+A R
Sbjct:   340 RSVSSAAR-MARKSVAIVCNRKSSLMAVMIQAIAHR 374


GO:0003674 "molecular_function" evidence=ND
GO:0009611 "response to wounding" evidence=IEP;RCA
GO:0009620 "response to fungus" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
TAIR|locus:2123999 CBSX5 "AT4G27460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206265 CBSX6 "AT1G65320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00040536
hypothetical protein (395 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
cd04627123 cd04627, CBS_pair_14, The CBS domain, named after 8e-05
>gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score = 41.5 bits (98), Expect = 8e-05
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 29/132 (21%)

Query: 100 LKPSASLLEAVDLLLGGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIRYFLN 159
           +  +ASL +A+++L  G  + V +           +            L+Q  L+ +   
Sbjct: 6   VPSTASLFQAIEILGSGGIHRVAVTEE----ESGEVIGI---------LSQRRLVEFLWE 52

Query: 160 ---FIGLLNPTPNQP-----INSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAI 211
                  L+P    P     I + ++I      +I+ D P   A+ L+    I  +SVA+
Sbjct: 53  NARSFPGLDPLYPIPLRDLTIGTSDVI------SINGDQPLIDALHLMHNEGI--SSVAV 104

Query: 212 VDEEGRLVGDIS 223
           VD +G L+G+IS
Sbjct: 105 VDNQGNLIGNIS 116


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 123

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.93
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 98.76
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 98.53
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 98.48
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 98.35
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 98.34
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 98.27
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 98.25
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 98.25
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 98.23
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 98.22
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 98.2
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 98.2
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 98.2
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 98.19
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 98.19
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 98.16
cd02205113 CBS_pair The CBS domain, named after human CBS, is 98.12
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 98.12
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 98.1
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 98.1
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 98.07
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 98.05
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 98.05
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 98.05
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 98.05
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 98.04
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 98.04
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 98.02
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 98.02
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 98.01
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 98.01
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 98.01
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 97.99
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 97.98
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.98
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 97.98
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 97.96
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.95
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 97.94
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 97.94
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 97.93
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 97.92
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 97.91
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 97.91
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 97.89
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.87
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 97.87
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 97.86
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 97.84
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 97.83
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 97.83
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 97.83
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 97.8
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 97.79
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 97.79
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 97.78
COG0517117 FOG: CBS domain [General function prediction only] 97.77
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 97.73
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 97.73
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 97.73
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 97.71
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.68
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 97.68
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 97.68
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 97.66
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 97.66
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 97.65
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 97.65
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 97.63
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 97.62
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 97.62
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 97.62
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 97.61
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 97.6
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.59
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 97.59
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 97.57
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 97.55
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 97.54
COG2524294 Predicted transcriptional regulator, contains C-te 97.54
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.53
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.53
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.53
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 97.5
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 97.5
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 97.5
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 97.49
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 97.49
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 97.49
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.49
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 97.46
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 97.43
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 97.42
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 97.41
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 97.41
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 97.41
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 97.39
COG3448382 CBS-domain-containing membrane protein [Signal tra 97.39
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 97.39
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 97.38
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 97.36
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.35
PRK14869546 putative manganese-dependent inorganic pyrophospha 97.34
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.33
cd02205113 CBS_pair The CBS domain, named after human CBS, is 97.33
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.32
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 97.29
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 97.28
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 97.25
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 97.25
PRK01862574 putative voltage-gated ClC-type chloride channel C 97.24
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 97.24
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 97.24
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.23
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 97.22
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 97.21
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 97.19
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 97.18
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 97.17
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 97.15
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 97.15
PRK01862574 putative voltage-gated ClC-type chloride channel C 97.15
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 97.11
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 97.11
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 97.1
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 97.1
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 97.08
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 97.08
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 97.08
PRK14869 546 putative manganese-dependent inorganic pyrophospha 97.08
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 97.07
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 97.07
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.05
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 97.04
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.03
PLN02274 505 inosine-5'-monophosphate dehydrogenase 97.0
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 97.0
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 96.95
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 96.95
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 96.94
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 96.91
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 96.91
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 96.89
PLN02274 505 inosine-5'-monophosphate dehydrogenase 96.89
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 96.85
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.8
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 96.8
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 96.79
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 96.75
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 96.74
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.67
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.67
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 96.66
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.66
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 96.59
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.5
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.49
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 96.44
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.43
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.42
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 96.28
COG2524294 Predicted transcriptional regulator, contains C-te 96.12
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 96.1
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 95.97
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 95.96
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 95.94
PRK10070400 glycine betaine transporter ATP-binding subunit; P 95.92
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 95.88
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 95.69
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 95.48
PRK11573413 hypothetical protein; Provisional 95.24
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 94.83
COG0517117 FOG: CBS domain [General function prediction only] 94.82
COG3448382 CBS-domain-containing membrane protein [Signal tra 94.2
COG1253429 TlyC Hemolysins and related proteins containing CB 94.07
COG2905 610 Predicted signal-transduction protein containing c 94.07
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 94.06
COG3620187 Predicted transcriptional regulator with C-termina 93.53
PRK10070400 glycine betaine transporter ATP-binding subunit; P 93.26
COG2905 610 Predicted signal-transduction protein containing c 90.05
smart0011649 CBS Domain in cystathionine beta-synthase and othe 89.86
COG3620187 Predicted transcriptional regulator with C-termina 86.62
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 83.86
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
Probab=99.93  E-value=3.7e-25  Score=221.57  Aligned_cols=248  Identities=21%  Similarity=0.285  Sum_probs=194.7

Q ss_pred             cccccCccccHHHHHHHHHhcCCceeeeecCCCchhhhhhhcccccccccCCCCeeeEeeeccceeeeccc---------
Q 041297           15 DEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCP---------   85 (379)
Q Consensus        15 ~~~~~~~~~tv~dAl~aL~~s~~~av~Vw~~~~~~~~~~~~~~~~~~~~~~~~~~~IG~V~mlDIv~~la~---------   85 (379)
                      +-+-|+..+.+.+|+++|..+...+.|+|+.+                    .++++||++|.|++.++.+         
T Consensus        77 ~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~--------------------~~~~~g~~~~~d~i~~~~~~~~~~~~~~  136 (381)
T KOG1764|consen   77 KLVVFDTKLSVKKAFNALVQNGVRAAPLWDSK--------------------KQQFVGMLTITDFITVLLRYYKSKSSLD  136 (381)
T ss_pred             eeEEeeCCCcHHHHHHHHHhhceeeeccccCc--------------------cceeEEEEEHHHHHHHHHHhhccCCcHH
Confidence            45678899999999999999999999999965                    3689999999999999985         


Q ss_pred             ---------------ccccccCC-CCceEEeCCCCchhHHHHHHh-cCccEEEEecCCcccCCCCCCcccccCCcceEEe
Q 041297           86 ---------------CFCSFAKD-SGIVRHLKPSASLLEAVDLLL-GGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWL  148 (379)
Q Consensus        86 ---------------VS~li~~~-~gll~~V~P~tsLLdAie~m~-~G~~rllVi~s~~k~~~~~s~~~~~~~~~~yC~L  148 (379)
                                     +-.+.... ...+.-+.|..+++++...+. .++||+.|++...              +.--+.|
T Consensus       137 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d~~~--------------~~v~~il  202 (381)
T KOG1764|consen  137 NIEVLEDSQLSKRREVECLLKETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVIDPET--------------GEVLYIL  202 (381)
T ss_pred             HHhhhhhhhccccchhhhhhccccCCCceeecCcHHHHHHHHHHHhCCccceeeecccc--------------cceeeeh
Confidence                           11122221 123488999999999998888 7999999977211              1334599


Q ss_pred             eHHHHHHHHHhhhcccC--CCCCCcccccccccCCcEEEEecCCchhcHHHHHHhccccCceeEEEcCCCcEEeeeCccc
Q 041297          149 TQEDLIRYFLNFIGLLN--PTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFS  226 (379)
Q Consensus       149 TQeDVvRFLl~~ig~l~--p~p~~SI~sLG~I~~~~v~aV~~~~~A~~Ai~lm~~a~~~~tAVAVVd~dGkLIGeISa~~  226 (379)
                      ||--|++|+-++.+.|-  ++..+|+.+||+..-+++..+..+.|+++|++.|+..  ..+|+||||..|+++|.+|-+|
T Consensus       203 t~~rIl~~l~~~~~~~~~~~~l~~s~~dl~ig~~~~i~~i~~~~~v~~al~~m~~~--~is~lpvV~~~g~~v~~~s~~D  280 (381)
T KOG1764|consen  203 TQRRILKFLWLNGRLLPLPSLLSKSLSDLGIGTWSNIASISEDTPVIEALKIMSER--RISALPVVDENGKKVGNYSRFD  280 (381)
T ss_pred             hHHHHHHHHHHhhcccccHHHhhCCHHHhCcchhhhheeecCCCcHHHHHHHHHhc--CcCcceEEcCCCceecceehhh
Confidence            99999999999999995  8889999999999977799999999999999999986  4599999999998899999999


Q ss_pred             cCCCcHHHHHHHHhcchhhhhhhhccCCChhhHHHHHHHHhhhhhhhhhhhhhhccccccCCCCCCCCCCccccccccCC
Q 041297          227 LNSCDETVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSDEESSTGSAR  306 (379)
Q Consensus       227 L~~CDet~a~A~atLSAgdf~a~vd~~~ppe~l~~~v~~~l~~k~l~~~~~l~~~~~~~ss~~~ssssssDee~~~g~~~  306 (379)
                      ...     +..-.+.+..+..             . +..                                         
T Consensus       281 v~~-----l~~~~~~~~~~~~-------------~-l~~-----------------------------------------  300 (381)
T KOG1764|consen  281 VIH-----LAREGTYNNLDLS-------------C-LSE-----------------------------------------  300 (381)
T ss_pred             hhh-----hhhcCccCccchh-------------H-HHH-----------------------------------------
Confidence            876     1111111110000             0 000                                         


Q ss_pred             cCCCCCCcccccCCccceeecCCCcHHHHHHHHHHcCCcEEEEeeCCCCcccceEee
Q 041297          307 SARSGGYSARVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQ  363 (379)
Q Consensus       307 ~~r~~~~S~~~~~~~~~vtC~p~SSLvAVMaQAlaHRV~~vWVvd~e~~l~~~v~~~  363 (379)
                           ..+.+.-+..+.++|+++|||.+||+|+++|||||+||||++|.++|||+.-
T Consensus       301 -----~~~~~~~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd~~~~l~GvvSLs  352 (381)
T KOG1764|consen  301 -----ALSHRPIRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVDEDGVLVGVISLS  352 (381)
T ss_pred             -----HhhhcccccCccEEEeecchHHHHHHHHHhcCceEEEEEcCCCcEEEEeeHH
Confidence                 0001112345579999999999999999999999999999999999999863



>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 1e-06
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 4e-06
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 4e-04
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
 Score = 48.8 bits (116), Expect = 1e-06
 Identities = 25/128 (19%), Positives = 43/128 (33%), Gaps = 14/128 (10%)

Query: 97  VRHLKPSASLLEAVDLLLG-GVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQEDLIR 155
              + PS  L EA   +L      + ++                H +     LTQ  +++
Sbjct: 124 TASIHPSRPLFEACLKMLESRSGRIPLI----------DQDEETHREIVVSVLTQYRILK 173

Query: 156 YFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEE 215
           +              PI   NII    + +     P    I ++ Q  +  +SV I+DE 
Sbjct: 174 FVALNCRE-THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRV--SSVPIIDEN 230

Query: 216 GRLVGDIS 223
           G L+    
Sbjct: 231 GYLINVYE 238


>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.89
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.83
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.81
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.77
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.76
3ddj_A296 CBS domain-containing protein; structural genomics 99.74
3ddj_A296 CBS domain-containing protein; structural genomics 99.27
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.22
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.11
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.1
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.06
4esy_A170 CBS domain containing membrane protein; structural 99.06
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 98.98
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 98.9
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 98.74
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 98.72
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.71
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 98.7
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.69
4esy_A170 CBS domain containing membrane protein; structural 98.66
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 98.64
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.61
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.61
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.61
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.59
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.59
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.58
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.57
1pvm_A184 Conserved hypothetical protein TA0289; structural 98.55
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.55
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.55
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.54
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.54
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 98.54
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.53
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.52
2o16_A160 Acetoin utilization protein ACUB, putative; struct 98.52
1o50_A157 CBS domain-containing predicted protein TM0935; CB 98.51
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 98.51
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.5
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 98.5
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.5
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 98.49
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.49
2o16_A160 Acetoin utilization protein ACUB, putative; struct 98.48
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.47
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.47
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 98.47
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.47
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.47
1pbj_A125 Hypothetical protein; structural genomics, domain, 98.47
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 98.47
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 98.46
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.45
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 98.45
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 98.45
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.44
1o50_A157 CBS domain-containing predicted protein TM0935; CB 98.43
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.43
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.43
1pbj_A125 Hypothetical protein; structural genomics, domain, 98.43
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.43
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.42
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.4
1pvm_A184 Conserved hypothetical protein TA0289; structural 98.4
4fry_A157 Putative signal-transduction protein with CBS DOM; 98.4
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.39
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.39
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.38
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.37
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 98.37
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.36
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.35
3ocm_A173 Putative membrane protein; structural genomics, PS 98.34
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.31
3kxr_A205 Magnesium transporter, putative; cystathionine bet 98.31
4fry_A157 Putative signal-transduction protein with CBS DOM; 98.31
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.3
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.29
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.29
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.27
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.26
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.25
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.24
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 98.24
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.24
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 98.23
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 98.22
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.2
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.2
2oux_A286 Magnesium transporter; 10001B, structural genomics 98.18
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 98.15
3ocm_A173 Putative membrane protein; structural genomics, PS 98.07
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.05
3kxr_A205 Magnesium transporter, putative; cystathionine bet 97.98
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 97.94
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.83
2oux_A286 Magnesium transporter; 10001B, structural genomics 97.81
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 97.69
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 97.63
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.63
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.56
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 97.51
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.47
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.46
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 97.43
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 97.31
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 97.27
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.23
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 97.19
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 97.19
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.12
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.09
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.09
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 96.88
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 96.86
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 96.76
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.6
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 96.37
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 96.26
3fio_A70 A cystathionine beta-synthase domain protein fused 96.03
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 95.96
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 95.91
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.87
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 95.77
3fio_A70 A cystathionine beta-synthase domain protein fused 95.75
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.84
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 87.7
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
Probab=99.89  E-value=4.7e-23  Score=191.00  Aligned_cols=251  Identities=16%  Similarity=0.138  Sum_probs=185.8

Q ss_pred             cccccCccccHHHHHHHHHhcCCceeeeecCCCchhhhhhhcccccccccCCCCeeeEeeeccceeeeccc---------
Q 041297           15 DEIALGQFIHRCHALLALKRLNESYINIWSSDHSARKRKAAAANIDDHEDSAGCSCIGKVCMVDIITFLCP---------   85 (379)
Q Consensus        15 ~~~~~~~~~tv~dAl~aL~~s~~~av~Vw~~~~~~~~~~~~~~~~~~~~~~~~~~~IG~V~mlDIv~~la~---------   85 (379)
                      +-++++...|+.+|++.|.+++...+|||+..                    .++++|++++-|++.++..         
T Consensus        41 ~~v~v~~~~sv~~a~~~m~~~~~~~~pV~d~~--------------------~~~lvGilt~~Dl~~~l~~~~~~~~~~~  100 (323)
T 3t4n_C           41 RLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSK--------------------TSRFAGLLTTTDFINVIQYYFSNPDKFE  100 (323)
T ss_dssp             EEEEEETTSBHHHHHHHHHHTTCSCEEEEETT--------------------TTEEEEEECHHHHHHHHHHHHHCGGGGG
T ss_pred             cEEEEcCCCcHHHHHHHHHHcCCceEEEEeCC--------------------CCeEEEEEEHHHHHHHHHHHHcCcchhH
Confidence            34678889999999999999999999999832                    3589999999999987631         


Q ss_pred             ---------ccccc---cCCCCceEEeCCCCchhHHHHHHh-cCccEEEEecCCcccCCCCCCcccccCCcceEEeeHHH
Q 041297           86 ---------CFCSF---AKDSGIVRHLKPSASLLEAVDLLL-GGVQNLVILPAGIKLQPKPSLKSTFHNDSEYCWLTQED  152 (379)
Q Consensus        86 ---------VS~li---~~~~gll~~V~P~tsLLdAie~m~-~G~~rllVi~s~~k~~~~~s~~~~~~~~~~yC~LTQeD  152 (379)
                               +.++.   ......+..+.|++++.||++.|. +|+++++|++...+.          ....-.-++|+.|
T Consensus       101 ~l~~~~~~~v~~i~~~~~~~~~~~v~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~----------~~~~l~Givt~~d  170 (323)
T 3t4n_C          101 LVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEET----------HREIVVSVLTQYR  170 (323)
T ss_dssp             GGGGCBHHHHHHHHHHTTC----CCCBCTTSBHHHHHHHHHHHTCSEEEEEEECTTT----------CCEEEEEEEEHHH
T ss_pred             HHHHHHHHHHHHHHHHhCCCCCCceEeCCCCcHHHHHHHHHhCCeeEEEEEecCCCC----------CccceEEEecHHH
Confidence                     22222   111134788999999999999998 699999997753221          0001233999999


Q ss_pred             HHHHHHhhhcccCCCCCCcccccccccCCcEEEEecCCchhcHHHHHHhccccCceeEEEcCCCcEEeeeCccccCCCcH
Q 041297          153 LIRYFLNFIGLLNPTPNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDE  232 (379)
Q Consensus       153 VvRFLl~~ig~l~p~p~~SI~sLG~I~~~~v~aV~~~~~A~~Ai~lm~~a~~~~tAVAVVd~dGkLIGeISa~~L~~CDe  232 (379)
                      +++|+.+.... ......+|.++++.-..++..|..++++.+|++.|.+.  +.+.+||||.+|+++|-||..||...-.
T Consensus       171 i~~~l~~~~~~-~~~~~~~v~~~~~~m~~~~~~v~~~~~~~~~~~~m~~~--~~~~~pVvd~~~~~~Giit~~dl~~~~~  247 (323)
T 3t4n_C          171 ILKFVALNCRE-THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQG--RVSSVPIIDENGYLINVYEAYDVLGLIK  247 (323)
T ss_dssp             HHHHHHHHCGG-GGGCCSBGGGTTCSBCTTCCCBCTTSBHHHHHHHHHHH--TCSEEEEECTTCBEEEEEETTHHHHHHH
T ss_pred             HHHHHHhcCCc-hhhhhCcHHHcCCCCCCCcEEECCCCcHHHHHHHHHHc--CCCEEEEECCCCeEEEEEeHHHHHHHHh
Confidence            99999987765 45667899999876533399999999999999999875  5589999999999999999988854110


Q ss_pred             HHHHHHHhcchhhhhhhhccCCChhhHHHHHHHHhhhhhhhhhhhhhhccccccCCCCCCCCCCccccccccCCcCCCCC
Q 041297          233 TVAAAIATLLAGDLMAYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSDEESSTGSARSARSGG  312 (379)
Q Consensus       233 t~a~A~atLSAgdf~a~vd~~~ppe~l~~~v~~~l~~k~l~~~~~l~~~~~~~ss~~~ssssssDee~~~g~~~~~r~~~  312 (379)
                      .........++.|+|                                      ...                        
T Consensus       248 ~~~~~~~~~~v~~~m--------------------------------------~~~------------------------  265 (323)
T 3t4n_C          248 GGIYNDLSLSVGEAL--------------------------------------MRR------------------------  265 (323)
T ss_dssp             TTHHHHTTSBHHHHG--------------------------------------GGS------------------------
T ss_pred             hchhhhccCCHHHHH--------------------------------------hhc------------------------
Confidence            000000111111111                                      000                        


Q ss_pred             CcccccCCccceeecCCCcHHHHHHHHHHcCCcEEEEeeCCCCcccceEeeh
Q 041297          313 YSARVVHRSEAIVCYPWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQA  364 (379)
Q Consensus       313 ~S~~~~~~~~~vtC~p~SSLvAVMaQAlaHRV~~vWVvd~e~~l~~~v~~~~  364 (379)
                          ......+++|.+..+|.+++.++..|+++++||+|++|.++|+|+..-
T Consensus       266 ----~~~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~Vvd~~~~l~Giit~~D  313 (323)
T 3t4n_C          266 ----SDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSD  313 (323)
T ss_dssp             ----CTTCCCCEEECTTCBHHHHHHHHHHSCCCEEEEECTTSBEEEEEEHHH
T ss_pred             ----cccCCCCEEECCCCCHHHHHHHHHHhCCCEEEEECCCCcEEEEEEHHH
Confidence                001135799999999999999999999999999999999999998653



>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.3
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.27
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.26
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.26
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.19
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.13
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.07
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.99
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 98.98
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 98.94
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 98.9
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.88
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 98.88
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 98.83
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.81
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.8
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.78
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.77
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.75
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.74
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.7
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.7
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.69
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.64
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.64
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.63
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.62
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.62
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 98.6
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.59
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 98.58
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.57
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.56
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 98.56
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.55
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 98.53
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.53
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 98.52
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.51
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 98.49
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 98.41
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 98.36
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.31
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.28
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 98.26
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.19
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 98.18
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 98.17
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 98.15
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.13
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 97.94
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 97.89
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Nuclear protein SNF4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.30  E-value=8.2e-13  Score=108.77  Aligned_cols=128  Identities=17%  Similarity=0.194  Sum_probs=93.0

Q ss_pred             CCCcccccccccCCcEEEEecCCchhcHHHHHHhccccCceeEEEcCCCcEEeeeCccccCCCcHHHHHHHHhcchhhhh
Q 041297          168 PNQPINSHNIIDDAGILAIHYDDPAAFAIPLIAQSHIKQTSVAIVDEEGRLVGDISPFSLNSCDETVAAAIATLLAGDLM  247 (379)
Q Consensus       168 p~~SI~sLG~I~~~~v~aV~~~~~A~~Ai~lm~~a~~~~tAVAVVd~dGkLIGeISa~~L~~CDet~a~A~atLSAgdf~  247 (379)
                      ..++|.+||++..+++.+|+.++++.+|+++|.+.  +.+++||||.+|+++|-|+..|+..                  
T Consensus         4 ~~~~i~~l~~~~~~~v~tv~~~~~v~~a~~~m~~~--~~~~ipVvd~~~~~vG~it~~Di~~------------------   63 (140)
T d2nyca1           4 LKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQG--RVSSVPIIDENGYLINVYEAYDVLG------------------   63 (140)
T ss_dssp             GGSBGGGSSCCBCSSCCCBCTTSBHHHHHHHHHHH--TCSEEEEECTTCBEEEEEEHHHHHH------------------
T ss_pred             ccCcHHHhCCccCCCCEEEcCcCcHHHHHHHHHHc--CCcEEEEEecCCeEcceehhhHHHH------------------
Confidence            46899999998877799999999999999999886  6699999999999999998877633                  


Q ss_pred             hhhccCCChhhHHHHHHHHhhhhhhhhhhhhhhccccccCCCCCCCCCCccccccccCCcCCCCCCcccccCCccceeec
Q 041297          248 AYMDCGRPLKDLVRLVKQRLDEKNMVGLLELMEDDLEISSGSCSNSSSSDEESSTGSARSARSGGYSARVVHRSEAIVCY  327 (379)
Q Consensus       248 a~vd~~~ppe~l~~~v~~~l~~k~l~~~~~l~~~~~~~ss~~~ssssssDee~~~g~~~~~r~~~~S~~~~~~~~~vtC~  327 (379)
                       ++..+... .        +..+    ..+.+..    .                              ..-...+++|.
T Consensus        64 -~~~~~~~~-~--------~~~~----~~~~~~~----~------------------------------~~~~~~~~~v~   95 (140)
T d2nyca1          64 -LIKGGIYN-D--------LSLS----VGEALMR----R------------------------------SDDFEGVYTCT   95 (140)
T ss_dssp             -HHHTC-------------CCSB----HHHHHHH----C------------------------------C------CEEC
T ss_pred             -HHhhcccc-c--------cccc----hhhhhhh----h------------------------------hhcccccEEEC
Confidence             11100000 0        0000    0000000    0                              00124468999


Q ss_pred             CCCcHHHHHHHHHHcCCcEEEEeeCCCCcccceEee
Q 041297          328 PWSSLMAVIMQALARRDRLRSMAKAENPNFCPVRIQ  363 (379)
Q Consensus       328 p~SSLvAVMaQAlaHRV~~vWVvd~e~~l~~~v~~~  363 (379)
                      +.++|.++|..+..++.|+++|||++|.++|+|+.+
T Consensus        96 ~~~~l~~~~~~~~~~~~~~l~VVd~~~~l~GiIt~~  131 (140)
T d2nyca1          96 KNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLS  131 (140)
T ss_dssp             TTSBHHHHHHHHHHHTCSEEEEECTTSBEEEEEEHH
T ss_pred             CCCcHHHHHHHHHhcCeeEEEEEeCCCeEEEEEEHH
Confidence            999999999999999999999999999999999864



>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure