Citrus Sinensis ID: 041378

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
KYGGDIDEGYAEGAEQHAGGDKPEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKKKGQSAENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPVS
cccccccccccccccccccccccHHHHHHHcccccccccccccccccccEEEEcccEEEEEEEccccccccEEEEccEEEEEEccccEEEEEEcccEEEEEEEccccccccccEEEEcccEEEEEEccccccccccccEEEEEcc
ccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccEEEEEEcccccccEEEEEEEcccccccccEEEEEEEccccEEEEEEccccccHHHEEEEEcccEEEEEEccccccccccccEEEEEEc
kyggdidegyaegaeqhaggdkpEEMEKMLQQPGRRYVKNARAIlrtpadiyedpshysfildmpgleasnikkkkgqsaeneGAVKAIRIERRRARnmrkftlpqdsnlEEVKAIYKDGVLTVTVAKkvpevsrrpktvtipvs
kyggdidegyaegaeqhaggdkpeEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIkkkkgqsaenegavkairierrrarnmrkftlpqdsnleevkaiykdgvltvtvakkvpevsrrpktvtipvs
KYGGDIDEGYAEGAEQHAGGDKPEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKKKGQSAENEGAVKairierrrarNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPVS
************************************YVKNARAILRTPADIYEDPSHYSFILDM*********************************************LEEVKAIYKDGVLTVTVAKK****************
********************DKPEEMEKMLQQ**********AILRTPADIYEDPSHYSFILDMPGLEA*********************IERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTV************TVTIPVS
KYGGDIDEGYAE*********************GRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASN*************AVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVS***********
*YGGDIDEGYAEGAEQHAGGDK************RRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKKKGQSAENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KYGGDIDEGYAEGAEQHAGGDKPEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKKKGQSAENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
P46516160 17.9 kDa class II heat sh N/A no 0.772 0.7 0.448 3e-20
Q01545167 18.8 kDa class II heat sh N/A no 0.793 0.688 0.437 3e-19
P29830155 17.6 kDa class II heat sh yes no 0.813 0.761 0.393 1e-18
P19242152 17.1 kDa class II heat sh N/A no 0.737 0.703 0.388 2e-18
O81822156 17.7 kDa class II heat sh no no 0.834 0.775 0.392 6e-18
Q01544155 17.2 kDa class II heat sh N/A no 0.855 0.8 0.364 8e-18
Q5VRY1166 18.0 kDa class II heat sh yes no 0.868 0.759 0.372 1e-17
O82013155 17.3 kDa class II heat sh N/A no 0.689 0.645 0.396 8e-17
P05477159 17.9 kDa class II heat sh no no 0.772 0.704 0.392 1e-16
P24631161 17.5 kDa class II heat sh N/A no 0.620 0.559 0.407 2e-16
>sp|P46516|HSP21_HELAN 17.9 kDa class II heat shock protein OS=Helianthus annuus GN=HSP17.9 PE=2 SV=1 Back     alignment and function desciption
 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 82/125 (65%), Gaps = 13/125 (10%)

Query: 33  PGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIK------------KKKGQSA 80
           P R YV++ARA+  TPAD+ E P+ Y FI+DMPGL++ +IK             K+ +  
Sbjct: 37  PSRAYVRDARAMAATPADVKECPNSYVFIVDMPGLKSGDIKVQVERDNVLVISGKRNREE 96

Query: 81  ENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTV 140
           E EG VK +R+ERR  + M+KF LP+D+N +++ AI +DGVLTVTV K  P   ++PKT+
Sbjct: 97  EKEG-VKYVRMERRMGKFMKKFALPEDANTDKISAICQDGVLTVTVEKLPPPEPKKPKTI 155

Query: 141 TIPVS 145
            + V+
Sbjct: 156 QVQVA 160

Helianthus annuus (taxid: 4232)
>sp|Q01545|HSP22_IPONI 18.8 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-2 PE=2 SV=1 Back     alignment and function description
>sp|P29830|HS176_ARATH 17.6 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.6 PE=2 SV=1 Back     alignment and function description
>sp|P19242|HSP21_PEA 17.1 kDa class II heat shock protein OS=Pisum sativum GN=HSP17.7 PE=2 SV=1 Back     alignment and function description
>sp|O81822|HS177_ARATH 17.7 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.7 PE=2 SV=1 Back     alignment and function description
>sp|Q01544|HSP21_IPONI 17.2 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-1 PE=2 SV=1 Back     alignment and function description
>sp|Q5VRY1|HSP18_ORYSJ 18.0 kDa class II heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.0 PE=2 SV=1 Back     alignment and function description
>sp|O82013|HSP21_SOLPE 17.3 kDa class II heat shock protein OS=Solanum peruvianum PE=2 SV=1 Back     alignment and function description
>sp|P05477|HSP21_SOYBN 17.9 kDa class II heat shock protein OS=Glycine max GN=HSP17.9-D PE=3 SV=1 Back     alignment and function description
>sp|P24631|HSP21_MAIZE 17.5 kDa class II heat shock protein OS=Zea mays PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
116784766148 unknown [Picea sitchensis] 0.806 0.790 0.446 1e-21
21068474151 small heat-shock protein [Picea abies] g 0.717 0.688 0.474 2e-21
1350517152 heat shock protein 17.0 [Picea glauca] 0.758 0.723 0.443 3e-21
148907212151 unknown [Picea sitchensis] gi|148909414| 0.717 0.688 0.465 1e-20
343887298158 heat shock protein [Citrus unshiu] 0.827 0.759 0.405 2e-20
116781024152 unknown [Picea sitchensis] 0.717 0.684 0.444 2e-20
99033697158 chaperone [Agave tequilana] 0.724 0.664 0.441 2e-20
1619829151 small heat shock protein [Picea abies] g 0.717 0.688 0.456 3e-20
21068484151 small heat-shock protein [Picea glauca] 0.717 0.688 0.456 4e-20
116789251152 unknown [Picea sitchensis] 0.717 0.684 0.452 5e-20
>gi|116784766|gb|ABK23464.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 82/132 (62%), Gaps = 15/132 (11%)

Query: 23  PEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKK------- 75
           P+++E++L  P R Y+++  A   TP D+ E P+ Y FI+DMPGL++++IK +       
Sbjct: 17  PDDLERILHAPTRSYMRDTEATASTPVDVKEYPNSYVFIVDMPGLKSNDIKVQVEDENVL 76

Query: 76  --KGQSAENE---GAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKV 130
              G+   NE   G VK IR+ERR A+ MRKFTLP D NLE + A  +DGVLTVTV K  
Sbjct: 77  NISGERKRNEKEEGEVKYIRMERRVAKFMRKFTLPADCNLEAISAACQDGVLTVTVPKLP 136

Query: 131 PEVSRRPKTVTI 142
           P     PKT+ +
Sbjct: 137 PP---EPKTIAV 145

Source: Picea sitchensis

Species: Picea sitchensis

Genus: Picea

Family: Pinaceae

Order: Coniferales

Class: Coniferopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|21068474|emb|CAC81958.1| small heat-shock protein [Picea abies] gi|21068478|emb|CAC81960.1| small heat-shock protein [Picea abies] Back     alignment and taxonomy information
>gi|1350517|gb|AAB01561.1| heat shock protein 17.0 [Picea glauca] Back     alignment and taxonomy information
>gi|148907212|gb|ABR16747.1| unknown [Picea sitchensis] gi|148909414|gb|ABR17805.1| unknown [Picea sitchensis] gi|148910118|gb|ABR18141.1| unknown [Picea sitchensis] gi|224286139|gb|ACN40780.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|343887298|dbj|BAK61844.1| heat shock protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|116781024|gb|ABK21931.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|99033697|gb|ABF61870.1| chaperone [Agave tequilana] Back     alignment and taxonomy information
>gi|1619829|emb|CAA67726.1| small heat shock protein [Picea abies] gi|21068469|emb|CAC81955.1| small heat-shock protein [Picea abies] gi|21068472|emb|CAC81957.1| small heat-shock protein [Picea abies] gi|21068476|emb|CAC81959.1| small heat-shock protein [Picea abies] gi|21068480|emb|CAC81961.1| small heat-shock protein [Picea abies] gi|116778847|gb|ABK21024.1| unknown [Picea sitchensis] gi|116785596|gb|ABK23786.1| unknown [Picea sitchensis] gi|116792492|gb|ABK26390.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|21068484|emb|CAC81963.1| small heat-shock protein [Picea glauca] Back     alignment and taxonomy information
>gi|116789251|gb|ABK25174.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:2143109155 HSP17.6II "17.6 kDa class II h 0.841 0.787 0.362 3.6e-18
TAIR|locus:2143024156 HSP17.6A "heat shock protein 1 0.855 0.794 0.366 7.5e-18
UNIPROTKB|Q5VRY1166 HSP18.0 "18.0 kDa class II hea 0.779 0.680 0.367 4.1e-17
TAIR|locus:2014410155 AT1G54050 "AT1G54050" [Arabido 0.668 0.625 0.368 2.8e-11
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.717 0.645 0.330 1.4e-07
TAIR|locus:2075256156 HSP17.4 "heat shock protein 17 0.710 0.660 0.347 2.9e-07
TAIR|locus:2024862157 AT1G53540 [Arabidopsis thalian 0.689 0.636 0.342 3.8e-07
UNIPROTKB|Q943E7149 HSP16.9C "16.9 kDa class I hea 0.717 0.697 0.305 3.4e-06
UNIPROTKB|Q84J50159 HSP17.7 "17.7 kDa class I heat 0.710 0.647 0.282 7e-06
UNIPROTKB|P27777150 HSP16.9A "16.9 kDa class I hea 0.641 0.62 0.327 1.1e-05
TAIR|locus:2143109 HSP17.6II "17.6 kDa class II heat shock protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 220 (82.5 bits), Expect = 3.6e-18, P = 3.6e-18
 Identities = 50/138 (36%), Positives = 81/138 (58%)

Query:    23 PEEM--EKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIK------- 73
             PE+   EK    P R Y+++A+A+  TPAD+ E P+ Y+F++DMPG++   IK       
Sbjct:    19 PEDHNNEKTRNNPSRVYMRDAKAMAATPADVIEHPNAYAFVVDMPGIKGDEIKVQVENDN 78

Query:    74 ------KKKGQSAENEGAVKXXXXXXXXXXNMRKFTLPQDSNLEEVKAIYKDGVLTVTVA 127
                   +++ ++ ENEG VK           MRKF LP++++L+++ A+  DGVL VTV 
Sbjct:    79 VLVVSGERQRENKENEG-VKYVRMERRMGKFMRKFQLPENADLDKISAVCHDGVLKVTVQ 137

Query:   128 KKVPEVSRRPKTVTIPVS 145
             K  P   ++PKT+ + V+
Sbjct:   138 KLPPPEPKKPKTIQVQVA 155
GO:0005737 "cytoplasm" evidence=ISM
GO:0009408 "response to heat" evidence=IEP;ISS;RCA
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2143024 HSP17.6A "heat shock protein 17.6A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRY1 HSP18.0 "18.0 kDa class II heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2014410 AT1G54050 "AT1G54050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075256 HSP17.4 "heat shock protein 17.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024862 AT1G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E7 HSP16.9C "16.9 kDa class I heat shock protein 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84J50 HSP17.7 "17.7 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27777 HSP16.9A "16.9 kDa class I heat shock protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 3e-16
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 2e-14
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 8e-12
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 5e-09
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 1e-08
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 4e-07
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information 
 Score = 69.2 bits (170), Expect = 3e-16
 Identities = 37/104 (35%), Positives = 51/104 (49%), Gaps = 11/104 (10%)

Query: 50  DIYEDPSHYSFILDMPGLEASNIKKK--------KGQSAENEGAVKAIRIERRRARNMRK 101
           DI ED   +   LD+PG +   +K K        KG+  + E     +R ER      RK
Sbjct: 1   DIKEDKDAFVVKLDVPGFKPEELKVKVEDNRVLVKGKHEKEEEDDHGLRSERSYRSFSRK 60

Query: 102 FTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPVS 145
           F LP++++ ++VKA  KDGVLTVTV K  P      K   I + 
Sbjct: 61  FVLPENADPDKVKASLKDGVLTVTVPKLEPPE---KKPRRIQIQ 101

Length = 101
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PRK10743137 heat shock protein IbpA; Provisional 99.94
PRK11597142 heat shock chaperone IbpB; Provisional 99.94
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.93
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.87
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.87
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.85
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.83
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.81
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.79
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.79
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.78
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.76
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.75
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.73
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.71
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.7
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.69
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.68
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.54
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.53
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.52
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.35
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.16
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.98
cd0646384 p23_like Proteins containing this p23_like domain 98.81
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.65
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.3
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.95
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.89
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.66
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.54
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.5
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.49
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.26
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.78
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.34
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 96.27
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.09
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 95.16
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 94.31
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 93.94
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 85.21
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 84.7
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 84.46
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 83.35
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 82.82
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 82.58
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 80.77
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information 
Probab=99.94  E-value=1.2e-26  Score=162.91  Aligned_cols=124  Identities=15%  Similarity=0.203  Sum_probs=96.1

Q ss_pred             CCChhhHHHHHhcccHHHHHHhhcCCccccccccccccCCcceEEE-cCCeEEEEEECCCCCCcceeEEe--------cc
Q 041378            8 EGYAEGAEQHAGGDKPEEMEKMLQQPGRRYVKNARAILRTPADIYE-DPSHYSFILDMPGLEASNIKKKK--------GQ   78 (145)
Q Consensus         8 ~~~p~~~l~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~p~~~v~e-~~~~~~i~~~lpG~~~e~i~V~~--------~~   78 (145)
                      ++.||..+...++++|++|.+.+..+         ....|++||++ ++++|+|.++|||++++||+|..        .+
T Consensus         5 ~~~~~~~~~~~~d~lf~~~~~~~~~~---------~~~~p~~di~ee~~~~~~v~aelPGv~kedi~V~v~~~~LtI~ge   75 (137)
T PRK10743          5 DLSPLYRSAIGFDRLFNLLENNQSQS---------NGGYPPYNVELVDENHYRIAIAVAGFAESELEITAQDNLLVVKGA   75 (137)
T ss_pred             ccChhhhcccCHHHHhhhhhhhhhcc---------cCCCCcEEEEEcCCCEEEEEEECCCCCHHHeEEEEECCEEEEEEE
Confidence            45666677777777888777654421         11238999995 88999999999999999999921        11


Q ss_pred             cccccCcceEEEEeeecceEEEEEECCCCCccCCceEEEeCCEEEEEEeCcCCCCCCCCeeEEec
Q 041378           79 SAENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIP  143 (145)
Q Consensus        79 ~~~~~~~~~~~~~e~~~~~f~r~i~LP~~vd~~~i~A~~~~GvL~I~~pK~~~~~~~~~~~I~I~  143 (145)
                      .....++..++++|+.+++|+|+|.||++||.++  |+|+||||+|++||.. ++..++++|+|+
T Consensus        76 ~~~~~~~~~~~~~Er~~g~F~R~~~LP~~Vd~~~--A~~~dGVL~I~lPK~~-~~~~~~r~I~I~  137 (137)
T PRK10743         76 HADEQKERTYLYQGIAERNFERKFQLAENIHVRG--ANLVNGLLYIDLERVI-PEAKKPRRIEIN  137 (137)
T ss_pred             ECccccCCcEEEEEEECCEEEEEEECCCCcccCc--CEEeCCEEEEEEeCCC-ccccCCeEEeeC
Confidence            1113345678999999999999999999999994  9999999999999964 345578999885

>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
1gme_A151 Heat shock protein 16.9B; small heat shock protein 8e-22
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 2e-18
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 9e-18
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 4e-17
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 8e-12
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 4e-10
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 1e-09
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 1e-07
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 2e-06
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 8e-05
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score = 83.9 bits (208), Expect = 8e-22
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 33  PGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIK-------------KKKGQS 79
                     A      D  E P  + F  D+PG++   +K             ++  + 
Sbjct: 30  AISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEK 89

Query: 80  AENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKT 139
            +     K  R+ER   + +R+F L +D+ +EEVKA  ++GVLTVTV K   +   +P+ 
Sbjct: 90  EDKND--KWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVK---KPEV 144

Query: 140 VTIPVS 145
             I +S
Sbjct: 145 KAIQIS 150
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.93
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.92
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.91
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.91
4fei_A102 Heat shock protein-related protein; stress respons 99.9
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.87
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.84
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 99.83
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.82
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.8
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.77
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.66
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.97
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.91
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.42
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 98.22
3igf_A374 ALL4481 protein; two-domained protein consisting o 98.04
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.73
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.57
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.56
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.44
2o30_A131 Nuclear movement protein; MCSG, structural genomic 97.19
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.17
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.15
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 97.03
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.82
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.76
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 87.2
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 86.52
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 85.76
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 84.81
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 82.65
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 82.16
4fei_A102 Heat shock protein-related protein; stress respons 81.91
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
Probab=99.93  E-value=1.9e-25  Score=159.96  Aligned_cols=95  Identities=24%  Similarity=0.303  Sum_probs=79.9

Q ss_pred             CCcceEEEcCCeEEEEEECCCCCCcceeEEe----------cccccccCcceEEEEee-ecceEEEEEECCCCCccCCce
Q 041378           46 RTPADIYEDPSHYSFILDMPGLEASNIKKKK----------GQSAENEGAVKAIRIER-RRARNMRKFTLPQDSNLEEVK  114 (145)
Q Consensus        46 ~p~~~v~e~~~~~~i~~~lpG~~~e~i~V~~----------~~~~~~~~~~~~~~~e~-~~~~f~r~i~LP~~vd~~~i~  114 (145)
                      .+++||++++++|+|.++|||+++++|+|..          +......+...++++|+ .+++|.|+|.||.+||.++|+
T Consensus        56 ~~pvdi~e~~~~~~v~~dlPG~~~edi~V~~~~~~L~I~g~~~~~~~~~~~~~~~~Er~~~g~f~R~~~LP~~vd~~~i~  135 (161)
T 4eld_A           56 FMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENAS  135 (161)
T ss_dssp             CCCEEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEEEECCCCCCCSSCEEEEECSCCCCEEEEEEECSSCBCGGGCE
T ss_pred             ccceeEEEeCCEEEEEEECCCCChHhEEEEEECCEEEEEEEEcccccCCCceEEEEEeeccccEEEEEECCCCcccccEE
Confidence            3449999999999999999999999999921          11111235567889999 999999999999999999999


Q ss_pred             EEEeCCEEEEEEeCcCCCCCCCCeeEEec
Q 041378          115 AIYKDGVLTVTVAKKVPEVSRRPKTVTIP  143 (145)
Q Consensus       115 A~~~~GvL~I~~pK~~~~~~~~~~~I~I~  143 (145)
                      |+|+||+|+|++||.+   .+++++|+|+
T Consensus       136 A~~~nGvL~I~lpK~~---~~~~r~I~Ie  161 (161)
T 4eld_A          136 AKFENGVLSVILPKAE---SSIKKGINIE  161 (161)
T ss_dssp             EEEETTEEEEEEEBCG---GGSCCCCCCC
T ss_pred             EEEECCEEEEEEEcCC---CCCCcEeecC
Confidence            9999999999999954   4467889885
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 2e-14
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 2e-13
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 64.0 bits (155), Expect = 2e-14
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 14/136 (10%)

Query: 21  DKPEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIK------- 73
             P +  + +            A      D  E P  + F  D+PG++   +K       
Sbjct: 17  ADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGN 76

Query: 74  ----KKKGQSAENEGAVKAIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKK 129
                 +    + +   K  R+ER   + +R+F L +D+ +EEVKA  ++GVLTVTV K 
Sbjct: 77  VLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKA 136

Query: 130 VPEVSRRPKTVTIPVS 145
             +   +P+   I +S
Sbjct: 137 EVK---KPEVKAIQIS 149
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.93
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.89
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.41
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 97.57
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 96.8
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.68
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 96.41
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 84.44
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.93  E-value=1.4e-25  Score=157.17  Aligned_cols=122  Identities=27%  Similarity=0.383  Sum_probs=90.7

Q ss_pred             hcccHHHHHHhhcCCccccccccccccCCcceEEEcCCeEEEEEECCCCCCcceeEEec-----------ccccccCcce
Q 041378           19 GGDKPEEMEKMLQQPGRRYVKNARAILRTPADIYEDPSHYSFILDMPGLEASNIKKKKG-----------QSAENEGAVK   87 (145)
Q Consensus        19 ~~~~~~e~~~~~~~~~~~~~~~~~~~~~p~~~v~e~~~~~~i~~~lpG~~~e~i~V~~~-----------~~~~~~~~~~   87 (145)
                      +.+.|+.|...+..... ........+.|+++|++++++|+|.++|||++++||+|...           .......+..
T Consensus        16 ~~d~f~~~~~~~~~~~~-~~~~~~~~~~p~~dv~e~~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~~~~~~~~~   94 (150)
T d1gmea_          16 WADPFDTFRSIVPAISG-GGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDK   94 (150)
T ss_dssp             GSSHHHHHHHHGGGTTS-SCCSHHHHGGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCE
T ss_pred             hhchhhhhhhhhhcccc-ccccccccCCCceeEEECCCEEEEEEEeCCCccCCEEEEEEEccceeEEEEEecccccccce
Confidence            44446665554443221 11222345678999999999999999999999999999321           1111344568


Q ss_pred             EEEEeeecceEEEEEECCCCCccCCceEEEeCCEEEEEEeCcCCCCCCCCeeEEecc
Q 041378           88 AIRIERRRARNMRKFTLPQDSNLEEVKAIYKDGVLTVTVAKKVPEVSRRPKTVTIPV  144 (145)
Q Consensus        88 ~~~~e~~~~~f~r~i~LP~~vd~~~i~A~~~~GvL~I~~pK~~~~~~~~~~~I~I~v  144 (145)
                      ++.+++.++.|+|+|.||.+||.++|+|+|+||+|+|++||..+   ++++.+.|+|
T Consensus        95 ~~~~e~~~~~f~r~~~LP~~vd~~~i~A~~~nGvL~I~lpK~~~---~~~~~~~I~I  148 (150)
T d1gmea_          95 WHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEV---KKPEVKAIQI  148 (150)
T ss_dssp             EEECCCCCCCEEEEEECSSCCCGGGCEEEEETTEEEEEEECCCC---CTTCCCCCCC
T ss_pred             eeeeeeccceEEEEEECCCCeeeceeEEEEECCEEEEEEEcCCc---CCCCceEEec
Confidence            88899999999999999999999999999999999999999653   3445555555
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure