Citrus Sinensis ID: 041480
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1122 | 2.2.26 [Sep-21-2011] | |||||||
| C6L7U1 | 1485 | Putative E3 ubiquitin-pro | N/A | no | 0.328 | 0.248 | 0.310 | 1e-39 | |
| D1FP57 | 1485 | Putative E3 ubiquitin-pro | N/A | no | 0.316 | 0.239 | 0.316 | 2e-37 | |
| D1FP53 | 1488 | Putative E3 ubiquitin-pro | N/A | no | 0.313 | 0.236 | 0.312 | 3e-36 | |
| Q5VRH9 | 611 | U-box domain-containing p | no | no | 0.139 | 0.255 | 0.277 | 4e-11 | |
| Q681N2 | 660 | U-box domain-containing p | no | no | 0.083 | 0.142 | 0.355 | 3e-10 | |
| Q9SRT0 | 460 | U-box domain-containing p | no | no | 0.065 | 0.160 | 0.402 | 5e-10 | |
| Q9ZV31 | 654 | U-box domain-containing p | no | no | 0.088 | 0.151 | 0.320 | 6e-10 | |
| Q8GUG9 | 612 | U-box domain-containing p | no | no | 0.096 | 0.176 | 0.341 | 6e-10 | |
| Q9LZW3 | 674 | U-box domain-containing p | no | no | 0.060 | 0.100 | 0.449 | 1e-09 | |
| Q9SFX2 | 811 | U-box domain-containing p | no | no | 0.073 | 0.102 | 0.384 | 1e-09 |
| >sp|C6L7U1|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 166 bits (420), Expect = 1e-39, Method: Compositional matrix adjust.
Identities = 118/380 (31%), Positives = 194/380 (51%), Gaps = 11/380 (2%)
Query: 740 ETAIFILEQLLTVFSDQERITNAKHLISIGGLQFLICRFESGKLEEKARVAALMCCCIEA 799
+ AI ILEQ L + R NA +IS G+ L+ E ++E + V +++ CC++A
Sbjct: 809 DAAIAILEQTLMGGDEYSRSLNASSVISANGIPTLVKYLE--RMEGRRSVVSVLLCCMQA 866
Query: 800 DAGCRNQMARNINVYSLLELLHSKQVKPRTNTVLLLIDLICLSRRRDVSTLLRNVQNEEL 859
+ C+N +A I + +LEL HS R V L +L+ L+RR + +L +++E
Sbjct: 867 EKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEFLSELVQLNRRTSCNQILHTIKDEGA 926
Query: 860 VNAMHVLLLYLQRSPPEQRPLFSILLLHLDLLVEPRKYSIYREAAVDAITVALEESLTDE 919
+ MH L+YLQ +P E + + LLL LDLL EPRK SIYRE AV+ + AL +
Sbjct: 927 FSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPRKMSIYREEAVETLIEALWQK-DFS 985
Query: 920 KIQEKCCRALLILGGRFSFSREVANESWILKPAGF----NDRCEGNSLDNDENDLPVDDS 975
Q K ALL L G S S + E+W+LK AGF N + L +NDL
Sbjct: 986 NTQMKALDALLFLIGHISSSGKSYTEAWLLKIAGFDQPYNALMKVEQLGQHDNDL----I 1041
Query: 976 TPLDDEEQASEEWLRKLSASLLGNRKRSFLETVSKILGSRNSDLVSVCLTTVAWLSHALS 1035
++DE+ A W +++++ L + S + + + L S + + CL WL+H L
Sbjct: 1042 ETMEDEKNALNSWQKRIASVLCNHENGSIFKALEECLKSNSLKMAKSCLVLATWLTHMLY 1101
Query: 1036 AQPDAEFQLSAFSAVISQLKEILQNGEQPQQKVLASMSLLNFSKIPECGAVLKTIAAEIR 1095
PD + A +++ ++ +LQ+ + ++K+LA+++L F P L+ A I
Sbjct: 1102 TLPDTGVRDVARKSLLEEVINVLQSSKNLEEKILATLALKTFISDPSTHEALRVYAKSIY 1161
Query: 1096 IPLQSLTEVTWTTQELCAII 1115
L+ L + + ++ +I
Sbjct: 1162 RTLRRLKKYSVVAVDIMKVI 1181
|
Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules. Lotus japonicus (taxid: 34305) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|D1FP57|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|D1FP53|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9SRT0|PUB9_ARATH U-box domain-containing protein 9 OS=Arabidopsis thaliana GN=PUB9 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LZW3|PUB16_ARATH U-box domain-containing protein 16 OS=Arabidopsis thaliana GN=PUB16 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SFX2|PUB43_ARATH U-box domain-containing protein 43 OS=Arabidopsis thaliana GN=PUB43 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1122 | ||||||
| 225435612 | 1148 | PREDICTED: putative E3 ubiquitin-protein | 0.986 | 0.964 | 0.551 | 0.0 | |
| 147819103 | 1148 | hypothetical protein VITISV_011730 [Viti | 0.986 | 0.964 | 0.550 | 0.0 | |
| 297746401 | 1084 | unnamed protein product [Vitis vinifera] | 0.957 | 0.990 | 0.557 | 0.0 | |
| 224073202 | 1159 | predicted protein [Populus trichocarpa] | 0.979 | 0.948 | 0.535 | 0.0 | |
| 356569115 | 1089 | PREDICTED: uncharacterized protein LOC10 | 0.937 | 0.966 | 0.463 | 0.0 | |
| 357501435 | 1073 | U-box domain-containing protein [Medicag | 0.934 | 0.976 | 0.442 | 0.0 | |
| 449462607 | 1159 | PREDICTED: uncharacterized protein LOC10 | 0.932 | 0.902 | 0.395 | 0.0 | |
| 209967430 | 1050 | U-box domain-containing protein [Heliant | 0.812 | 0.868 | 0.451 | 0.0 | |
| 224053004 | 760 | predicted protein [Populus trichocarpa] | 0.620 | 0.915 | 0.524 | 0.0 | |
| 255574426 | 1050 | hypothetical protein RCOM_0146510 [Ricin | 0.623 | 0.666 | 0.477 | 1e-172 |
| >gi|225435612|ref|XP_002283306.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1141 bits (2952), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 639/1158 (55%), Positives = 796/1158 (68%), Gaps = 51/1158 (4%)
Query: 2 ASLEELLLADGFKGRRSSVTSSRPSFREEAMSMPVYPFGDKNKAASSSSSRIKTERARSD 61
+SLE+LL +GF+GRR T+ RPSF A+SMP+YPF KA + S +I+T R RS
Sbjct: 3 SSLEDLLAEEGFQGRRLK-TTPRPSFASRAVSMPLYPFRINCKADAGSVVKIQTARTRSS 61
Query: 62 LSRYTLKSDSPRISNLSGRRPRDSLVRREKVDSGSMKEHRERLAGRRSVDVQE------- 114
+SRY + ++P + + GR+ +DSL+RREK+D KE +R R + DV E
Sbjct: 62 VSRYNSEGEAPPTNRVKGRKQKDSLIRREKLDREPKKELNKRFEERETNDVFEDFPGNEI 121
Query: 115 ----------------------RRRSNAKSS---ETSQENEIVEVSGEESQRVSINLDTR 149
R+RS+ S E + E E S +L +
Sbjct: 122 VEVGVEENGRYKDIYSDKEYSPRKRSHKSSHRIVEKERNKERSEKRNSSSTSSIKHLPAQ 181
Query: 150 HSNVDNR-KSMKENEPGNDRYNRSSMSRKSIKENY-RKHESVLAPASEPALDEVAVQAIV 207
S +N SMKE +R +S + K EN + H+S + SEPALDEVAVQA+V
Sbjct: 182 KSLSNNHNNSMKEPHTFLNRSRKSMENNKIFDENRGQNHDSTVQAVSEPALDEVAVQAMV 241
Query: 208 SILSGYVKSFLKNEDFRATLRRKCFSSLNFIEPEDEGNSNESKVIASLEQAIETVQRAAE 267
SI+SG+VK FLK++DFR L CFSSLN I+ E EG S SKVI +LEQAIETV+ AE
Sbjct: 242 SIISGFVKRFLKDKDFRTLLHHNCFSSLNIIDLE-EGESTASKVITTLEQAIETVELVAE 300
Query: 268 ESASSKELKKASLQLSMITGMSANDLKDGSTSGVPNSKLSACAHLYLSVIYKIQKKDRVS 327
ESAS K+LKKASLQLS+I G+S++D+KDG TSGVPN KLSACAHLYL +IYK+QKKD+ S
Sbjct: 301 ESASGKDLKKASLQLSVIAGLSSDDMKDGFTSGVPNYKLSACAHLYLGLIYKLQKKDKAS 360
Query: 328 AKHLLQVFCDSPFMARTTLLPELWDYLISPHLAHLKAWYKQEADSLADESNKPRKMKLLE 387
AKH+LQVFCDSPF ART LLPELWDYL P L+HLK WY QEADSLAD ++ RK++LLE
Sbjct: 361 AKHILQVFCDSPFQARTMLLPELWDYLFLPQLSHLKVWYNQEADSLADAPSRQRKLELLE 420
Query: 388 KVYNEILDSGTYQFAVYYKDWLTEGIEDPSVPTIQIPSLSVQRHQRKGSFGNSSEVASPA 447
KVYNEILD GT+QFA+YYKDWLTEG+E PSVP+I +PS+SV+ + S + E+A+P
Sbjct: 421 KVYNEILDLGTHQFAIYYKDWLTEGVEAPSVPSIHVPSVSVRGVDQGSSQSHYQELANPL 480
Query: 448 AAFSPQPTVSKKLYDAVFERASKPRVDAAEDDGEMENFDNYARSSGGSTVE-KRTLTYSS 506
FS QP VSKKLY+ VF + +P+V E+ GE E N RSS S VE K+ LT+ S
Sbjct: 481 GPFSTQPMVSKKLYNTVFGNSIQPQVGEVEEYGEAEY--NCMRSSDDSAVEDKQALTHFS 538
Query: 507 EIVKCTYQDTEDDSPKIAQDDLFHPEDELLLAAEEGWRLPGVKYPAERNINSNINICCTS 566
E VK T Q ++ + D+ HPED LL AEE RL GV P ER+ + + C S
Sbjct: 539 EAVKHTDQHAKEHLMENPYDEAAHPEDGHLLEAEESTRLHGVSAPGERDPSDEV---CDS 595
Query: 567 KKIQ----TIKLYTPPDTKANELTLKRLAKSAFEQQQTEGCTALTISSPPSTSEAPVNLR 622
Q + ++ P +ANE TL+ LA+S F+ + + I P T N+
Sbjct: 596 HIRQVPPGSSHMFHAPIHRANESTLRTLARSVFDLHISSQSNSEAIFDPNQT-----NME 650
Query: 623 PSFEELHENDEYFDKGSFLTSIPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGN 682
S ++LH N +YF++GSF +SIPQDFICPLTG+LFE+PVT+E+GQTFE AI+EW QGN
Sbjct: 651 SSAKDLHGNCQYFNEGSFFSSIPQDFICPLTGRLFEDPVTIETGQTFERHAIREWFNQGN 710
Query: 683 RTCPVTGKYLACPSLPLTNFILKRVIDGWKSENCMHLLAFAFQIVEKSRMNESKNGDETA 742
R CPVTGK L +PLTNFILKRVIDGWKSENC HLLAFA ++ S + + DETA
Sbjct: 711 RNCPVTGKALEGLGVPLTNFILKRVIDGWKSENCRHLLAFASKVEGSSGEHGVEPKDETA 770
Query: 743 IFILEQLLTVFSDQERITNAKHLISIGGLQFLICRFESGKLEEKARVAALMCCCIEADAG 802
I+ LEQ L+ S +E++TNAKHLIS+GGLQFL RFE G LEEK VAALMC CIEAD
Sbjct: 771 IYALEQFLSGSSKEEKLTNAKHLISLGGLQFLTRRFELGNLEEKTCVAALMCSCIEADYR 830
Query: 803 CRNQMARNINVYSLLELLHSKQVKPRTNTVLLLIDLICLSRRRDVSTLLRNVQNEELVNA 862
C+N++A+ I LLELLHSKQ K RTN VLLL +LIC+ R +DV+ L + QNE +++A
Sbjct: 831 CKNEIAKYIKKPCLLELLHSKQAKSRTNAVLLLTELICMHRWKDVTLFLSSFQNEGIMSA 890
Query: 863 MHVLLLYLQRSPPEQRPLFSILLLHLDLLVEPRKYSIYREAAVDAITVALEESLTDEKIQ 922
MHVLL+YLQ S PEQRPL ++LLLHLDLLVEPRKYSIYRE AVDAI VALE SLTDE ++
Sbjct: 891 MHVLLVYLQSSSPEQRPLVAVLLLHLDLLVEPRKYSIYREEAVDAIVVALEGSLTDENVR 950
Query: 923 EKCCRALLILGGRFSFSREVANESWILKPAGFNDRCEGNSLDNDENDLPVDDSTPLDDEE 982
EKCCRALLIL G FSFS +V E WILKPAG D + +S +N+EN L VD + LD EE
Sbjct: 951 EKCCRALLILTGHFSFSGDVPTEKWILKPAGPMDSHDLSSCNNEENGLLVDGTISLDAEE 1010
Query: 983 QASEEWLRKLSASLLGNRKRSFLETVSKILGSRNSDLVSVCLTTVAWLSHALSAQPDAEF 1042
QA EEW R LSA LLGN ++SFLE +SK LGS +S+LV VCLTTVAWLS ALS+ DAEF
Sbjct: 1011 QAKEEWFRNLSAVLLGNGQKSFLEAISKCLGSDSSELVRVCLTTVAWLSSALSSLSDAEF 1070
Query: 1043 QLSAFSAVISQLKEILQNGEQPQQKVLASMSLLNFSKIPECGAVLKTIAAEIRIPLQSLT 1102
QLSAFSA+IS+L++ L+N EQ + K+LAS SLL+FSKIPEC +L TIA EI +PL+SL
Sbjct: 1071 QLSAFSALISRLRDNLENSEQIEHKILASASLLSFSKIPECRVLLMTIAEEIVVPLRSLV 1130
Query: 1103 EVTWTTQELCAIIAGRSL 1120
+VTWT + L I+G L
Sbjct: 1131 QVTWTAKHLYTTISGEDL 1148
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147819103|emb|CAN71223.1| hypothetical protein VITISV_011730 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297746401|emb|CBI16457.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224073202|ref|XP_002304021.1| predicted protein [Populus trichocarpa] gi|222841453|gb|EEE79000.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356569115|ref|XP_003552751.1| PREDICTED: uncharacterized protein LOC100820501 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357501435|ref|XP_003621006.1| U-box domain-containing protein [Medicago truncatula] gi|124365538|gb|ABN09772.1| U box [Medicago truncatula] gi|355496021|gb|AES77224.1| U-box domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449462607|ref|XP_004149032.1| PREDICTED: uncharacterized protein LOC101219197 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|209967430|gb|ACJ02343.1| U-box domain-containing protein [Helianthus annuus] | Back alignment and taxonomy information |
|---|
| >gi|224053004|ref|XP_002297659.1| predicted protein [Populus trichocarpa] gi|222844917|gb|EEE82464.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255574426|ref|XP_002528126.1| hypothetical protein RCOM_0146510 [Ricinus communis] gi|223532465|gb|EEF34256.1| hypothetical protein RCOM_0146510 [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1122 | ||||||
| UNIPROTKB|Q5VRH9 | 611 | PUB12 "U-box domain-containing | 0.180 | 0.332 | 0.253 | 2.7e-10 | |
| TAIR|locus:2014584 | 811 | PUB43 "plant U-box 43" [Arabid | 0.176 | 0.244 | 0.257 | 3.8e-10 | |
| TAIR|locus:2079706 | 460 | PUB9 "plant U-box 9" [Arabidop | 0.174 | 0.426 | 0.281 | 9.4e-09 | |
| TAIR|locus:2030462 | 801 | SAUL1 "senescence-associated E | 0.175 | 0.245 | 0.269 | 1.4e-08 | |
| TAIR|locus:2141226 | 374 | PUB8 "plant U-box 8" [Arabidop | 0.057 | 0.173 | 0.4 | 2.5e-08 | |
| TAIR|locus:2017719 | 612 | AT1G23030 [Arabidopsis thalian | 0.108 | 0.199 | 0.333 | 5.1e-08 | |
| TAIR|locus:2013990 | 628 | AT1G71020 [Arabidopsis thalian | 0.070 | 0.125 | 0.385 | 5.1e-08 | |
| TAIR|locus:2162276 | 660 | PUB15 "Plant U-Box 15" [Arabid | 0.101 | 0.172 | 0.319 | 6.5e-08 | |
| TAIR|locus:2013850 | 431 | CMPG1 ""CYS, MET, PRO, and GLY | 0.059 | 0.155 | 0.414 | 1.1e-07 | |
| RGD|1359296 | 476 | Wdsub1 "WD repeat, sterile alp | 0.073 | 0.172 | 0.430 | 1.2e-07 |
| UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 183 (69.5 bits), Expect = 2.7e-10, P = 2.7e-10
Identities = 55/217 (25%), Positives = 99/217 (45%)
Query: 572 IKLYTPPDTKANELTLKRLAKSAFEQQQTEGCTALTISSPPSTSEAPVNLRPSFEELHEN 631
++L+T D K + L + S + +GC S + V E H N
Sbjct: 160 LQLHTMADMKNESIALHNMVIST--AGEPDGCVDQMSSLLKKLKDCVVT------EDHAN 211
Query: 632 DEYFDKGSFLTS----IPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPV 687
D + + + IP +F CP++ +L ++PV + SGQT+E I++W++ G++TCP
Sbjct: 212 DALTTRSASIKHRSPIIPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPK 271
Query: 688 TGKYLACPSLPLTNFILKRVIDGWKSENCMHLLAFAFQIVEKSRMNESKNGDETAIFILE 747
T + L+ SL NF+LK +I W N + L +K S + ++
Sbjct: 272 TQQPLSHTSLT-PNFVLKSLISQWCEANGIELPKNKQNSRDKKAAKSSDYDHAGLVSLMN 330
Query: 748 QLLTVFSDQERITNAK-HLISIGGLQFLICRFESGKL 783
+L + D++R + L++ + IC E+G +
Sbjct: 331 RLRSGNQDEQRAAAGEIRLLAKRNVNNRICIAEAGAI 367
|
|
| TAIR|locus:2014584 PUB43 "plant U-box 43" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079706 PUB9 "plant U-box 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030462 SAUL1 "senescence-associated E3 ubiquitin ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141226 PUB8 "plant U-box 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162276 PUB15 "Plant U-Box 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013850 CMPG1 ""CYS, MET, PRO, and GLY protein 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1359296 Wdsub1 "WD repeat, sterile alpha motif and U-box domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1122 | |||
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 5e-15 | |
| pfam04564 | 73 | pfam04564, U-box, U-box domain | 9e-12 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 7e-05 | |
| pfam11789 | 57 | pfam11789, zf-Nse, Zinc-finger of the MIZ type in | 2e-04 |
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
Score = 70.0 bits (172), Expect = 5e-15
Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
Query: 647 DFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLTNFILKR 706
+F+CP++ ++ ++PV L SGQT+E AI++W+ + T PVTG+ L L + N LK
Sbjct: 1 EFLCPISLEVMKDPVILPSGQTYERSAIEKWL-LSHGTDPVTGQPLTHEDL-IPNLALKS 58
Query: 707 VIDGW 711
I W
Sbjct: 59 AIQEW 63
|
Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63 |
| >gnl|CDD|203049 pfam04564, U-box, U-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1122 | |||
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.74 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.71 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.67 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.53 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 99.38 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 99.28 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 99.24 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 99.22 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.91 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 98.88 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.86 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 98.78 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.75 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 98.71 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.68 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.43 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.43 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.35 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.26 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.25 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.23 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.22 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.2 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 98.1 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 98.09 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.09 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.05 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.03 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.0 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.97 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 97.97 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 97.93 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.9 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.88 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.83 | |
| KOG2042 | 943 | consensus Ubiquitin fusion degradation protein-2 [ | 97.81 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.8 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.78 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 97.67 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.66 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.58 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.57 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.54 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.51 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 97.5 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.43 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.42 | |
| COG5113 | 929 | UFD2 Ubiquitin fusion degradation protein 2 [Postt | 97.31 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 97.29 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.26 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 97.22 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.12 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.01 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.0 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.94 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.83 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.64 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 96.62 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 96.61 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.53 | |
| PF05536 | 543 | Neurochondrin: Neurochondrin | 96.45 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.24 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 96.23 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 96.23 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.21 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 96.2 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.15 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 96.02 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 95.9 | |
| KOG2171 | 1075 | consensus Karyopherin (importin) beta 3 [Nuclear s | 95.87 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 95.87 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.78 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.7 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 95.53 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.42 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 95.34 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 95.19 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.92 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.76 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 94.62 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 94.49 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 94.44 | |
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 94.36 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 94.11 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 94.1 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 94.09 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 94.08 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.0 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.82 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 93.64 | |
| PF05004 | 309 | IFRD: Interferon-related developmental regulator ( | 93.62 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 93.46 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 93.45 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 93.42 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 93.41 | |
| KOG2171 | 1075 | consensus Karyopherin (importin) beta 3 [Nuclear s | 93.28 | |
| KOG1060 | 968 | consensus Vesicle coat complex AP-3, beta subunit | 93.19 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 93.07 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 92.33 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 92.23 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 92.03 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.87 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 91.87 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 91.71 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.66 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 91.63 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 91.47 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.65 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 90.37 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 89.53 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 89.4 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 89.28 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 89.01 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.27 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 87.78 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 87.06 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 86.64 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 86.63 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 86.28 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 85.58 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.39 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 85.18 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 85.02 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 84.62 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 84.62 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 84.59 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 84.06 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 83.28 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 83.17 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.09 | |
| PF14664 | 371 | RICTOR_N: Rapamycin-insensitive companion of mTOR, | 81.35 | |
| KOG1062 | 866 | consensus Vesicle coat complex AP-1, gamma subunit | 80.86 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 80.59 | |
| PF05536 | 543 | Neurochondrin: Neurochondrin | 80.37 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 80.28 |
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
Probab=99.74 E-value=1.3e-18 Score=156.63 Aligned_cols=72 Identities=43% Similarity=0.792 Sum_probs=63.0
Q ss_pred CCCcccccccchhccCCcccCCCcccchHHHHHHHHhCCCCCCCCCCcCCCCCCCcchHHHHHHHHHHHHhcc
Q 041480 644 IPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLTNFILKRVIDGWKSENC 716 (1122)
Q Consensus 644 ipeef~CPIc~elm~DPVtl~cGhTycRscIe~wl~~g~~tCP~trq~L~~~~ll~pN~~Lk~lIe~w~~~n~ 716 (1122)
+|++|+||||++||.|||++++||||||.+|++|+.+++.+||+|++++.... +.||..||..|+.|+.+|.
T Consensus 1 iP~~f~CpIt~~lM~dPVi~~~G~tyer~~I~~~l~~~~~~~P~t~~~l~~~~-l~pn~~Lk~~I~~~~~~~~ 72 (73)
T PF04564_consen 1 IPDEFLCPITGELMRDPVILPSGHTYERSAIERWLEQNGGTDPFTRQPLSESD-LIPNRALKSAIEEWCAENK 72 (73)
T ss_dssp SSGGGB-TTTSSB-SSEEEETTSEEEEHHHHHHHHCTTSSB-TTT-SB-SGGG-SEE-HHHHHHHHHHHHHCT
T ss_pred CCcccCCcCcCcHhhCceeCCcCCEEcHHHHHHHHHcCCCCCCCCCCcCCccc-ceECHHHHHHHHHHHHHcc
Confidence 69999999999999999999999999999999999998999999999999988 5999999999999998874
|
Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A .... |
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term | Back alignment and domain information |
|---|
| >KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1122 | ||||
| 1t1h_A | 78 | Nmr Solution Structure Of The U Box Domain From Atp | 2e-07 |
| >pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 | Back alignment and structure |
|---|
Score = 98.4 bits (246), Expect = 5e-25
Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
Query: 644 IPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLT-NF 702
P+ F CP++ +L ++PV + +GQT+E +I++W++ G++TCP + + L LT N+
Sbjct: 5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETL--LHAGLTPNY 62
Query: 703 ILKRVIDGWKSEN 715
+LK +I W N
Sbjct: 63 VLKSLIALWCESN 75
|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1122 | |||
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.76 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.75 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.74 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.74 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.73 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.73 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.73 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.71 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.69 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.68 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.67 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.65 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.65 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.64 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.64 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.64 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.64 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.61 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.6 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.59 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.58 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.58 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.56 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.56 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.53 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.53 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.52 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.52 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.52 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.51 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.51 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.51 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.51 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.49 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.48 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.47 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.47 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.46 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.46 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.45 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.45 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 99.43 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.4 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 99.35 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.34 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.34 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.33 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.32 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.28 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.19 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.15 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.15 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.15 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 99.15 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.14 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.14 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.12 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.12 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.11 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.11 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.1 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.07 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.07 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.07 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.02 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.02 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.01 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.98 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.95 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.95 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.94 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.93 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.83 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.82 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.8 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.75 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.74 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.68 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.67 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.57 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 98.52 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.51 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.48 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.48 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.46 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.45 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.44 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.4 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.38 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.38 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.37 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.35 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.33 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.29 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.17 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.16 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.08 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.94 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.91 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.83 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.81 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.8 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.76 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.73 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.72 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.68 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 97.65 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 97.64 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.51 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.39 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.39 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.29 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.26 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.17 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.66 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.39 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.15 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 96.01 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.99 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 95.85 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.75 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 95.73 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 95.68 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 95.48 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 95.18 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 95.02 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 95.01 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 94.4 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 94.11 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 94.06 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 93.89 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 93.68 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 93.45 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 93.11 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 92.39 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.36 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 91.82 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 91.78 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 91.14 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 91.1 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 90.97 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 89.0 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 88.7 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 86.93 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 84.62 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 83.1 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 81.41 |
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
Probab=99.76 E-value=4.9e-17 Score=195.19 Aligned_cols=325 Identities=14% Similarity=0.071 Sum_probs=222.9
Q ss_pred HHHHHHHHhhhhchhhhhhhhhHHHhhccHHHHHHhhcCCCHHHHHHHHHHHHHhhhc-chhhHHHHHhccchHHHHHHh
Q 041480 742 AIFILEQLLTVFSDQERITNAKHLISIGGLQFLICRFESGKLEEKARVAALMCCCIEA-DAGCRNQMARNINVYSLLELL 820 (1122)
Q Consensus 742 Al~~LekLls~~~~ee~~~Nr~~IasaGaIp~LV~LL~sgs~Eek~~AaalL~~La~~-D~snR~~Iae~GaI~pLV~LL 820 (1122)
|...|..|... +..|+..|+..|+||.||.+|.+++.+.+..|+.+|.+++.. +.++|..|++.|+|++||++|
T Consensus 68 Aa~~L~~La~~-----~~~~k~~V~~~G~Ip~LV~LL~s~~~~vq~~Aa~AL~nLa~~~~~~nk~~I~~~GaIp~LV~LL 142 (584)
T 3l6x_A 68 AAAYLQHLCYR-----NDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLL 142 (584)
T ss_dssp HHHHHHHHHTT-----CHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHHTSSSCHHHHHHHHHTTHHHHHHHHH
T ss_pred HHHHHHHHHcC-----ChHHHHHHHHcCCcHHHHHHHCCCCHHHHHHHHHHHHHHHccCCHHHHHHHHHcCCHHHHHHHH
Confidence 44456555432 235889999999999999999999999999999999999974 578999999999999999999
Q ss_pred hc-CChhHHHHHHHHHHHHHcccCccchHHHHHhhhhhhhhhhHHHHHHHhh---cC---------------CcchHHHH
Q 041480 821 HS-KQVKPRTNTVLLLIDLICLSRRRDVSTLLRNVQNEELVNAMHVLLLYLQ---RS---------------PPEQRPLF 881 (1122)
Q Consensus 821 ~S-Gs~~aRenAv~aL~eLs~~~~~k~~~~~L~~I~~eG~~gaI~~Ll~lLq---sg---------------s~~~k~lA 881 (1122)
.+ ++...+++|+.+|.+|+..+.++.. |. -++|++|+.++- +| .+..+..|
T Consensus 143 ~s~~~~~~~e~aa~aL~nLS~~~~~k~~------I~----~~alp~Lv~LL~~p~sg~~~~~~~~~k~~~~~d~~V~~nA 212 (584)
T 3l6x_A 143 RKARDMDLTEVITGTLWNLSSHDSIKME------IV----DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNT 212 (584)
T ss_dssp HHCCSHHHHHHHHHHHHHHTTSGGGHHH------HH----HHTHHHHHHHTHHHHHCCC----------CCCCHHHHHHH
T ss_pred cCCCCHHHHHHHHHHHHHHhCCchhhHH------HH----hccHHHHHHHHhcccccccccccccccccccccHHHHHHH
Confidence 97 5778899999999999987666522 22 257899998762 11 24667889
Q ss_pred HHHHHhhccCCChhhhhhhh-hccHHHHHHHHhcc----CCChHHHHHHHHHHHHhhcCCC----CCc------------
Q 041480 882 SILLLHLDLLVEPRKYSIYR-EAAVDAITVALEES----LTDEKIQEKCCRALLILGGRFS----FSR------------ 940 (1122)
Q Consensus 882 A~aLlnLsll~EpnK~sIvR-eGAV~aLV~LL~~g----~~~~~~qe~Aa~AL~~Lag~fS----~sG------------ 940 (1122)
+++|.||+...+.+|..|++ .|+|++||.+|.+. ..+.+.+++|+.+|.||+.+.. ..+
T Consensus 213 a~~L~NLs~~~~~~R~~i~~~~Gli~~LV~~L~~~~~~~~~~~~~~enav~aL~NLs~~~~~e~~~~~~~~~~~~~~~~~ 292 (584)
T 3l6x_A 213 AGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANN 292 (584)
T ss_dssp HHHHHHHTSSCHHHHHHHHHSTTHHHHHHHHHHHHHHTTCCSCHHHHHHHHHHHHHHTTHHHHSTTCCC-----------
T ss_pred HHHHHHHhcCCHHHHHHHHHcCCcHHHHHHHHHHhhcccCccHHHHHHHHHHHHHhhccccccccchhhhhhhccccccc
Confidence 99999999865556888887 67788999999863 3334799999999999996410 000
Q ss_pred ----hhhhhhhhhccccccccccccCCCCCCCCCCCCCCCCCchhHHhHHHHHHHhH----------HHHh-cCCchhhH
Q 041480 941 ----EVANESWILKPAGFNDRCEGNSLDNDENDLPVDDSTPLDDEEQASEEWLRKLS----------ASLL-GNRKRSFL 1005 (1122)
Q Consensus 941 ----e~~~~~~LlK~AG~~~~~~~~~~~~~~~d~~~d~~~~~~~ee~~~~~w~rk~a----------~~Lv-~~G~~~~L 1005 (1122)
.+....||. +.++.+.|..+... +....-.|.++ .-+.+++ ..+| .+|. +
T Consensus 293 ~~~~~~~Gve~L~-~~~~v~~Ll~LL~~----------s~~~~v~E~Aa-~AL~nL~ag~~~~~~~~~~~v~~~~g---l 357 (584)
T 3l6x_A 293 TGTSPARGYELLF-QPEVVRIYISLLKE----------SKTPAILEASA-GAIQNLCAGRWTYGRYIRSALRQEKA---L 357 (584)
T ss_dssp ---CCCCGGGGGG-SHHHHHHHHHHHHH----------CCCHHHHHHHH-HHHHHHHSSCSHHHHHHHHHHTSHHH---H
T ss_pred ccccCchhHHHHh-cccHHHHHHHHHcc----------CCCHHHHHHHH-HHHHHHHcCCccccHHHHHHHHHcCc---H
Confidence 000011111 11111222111110 00000012211 1122221 2233 3444 6
Q ss_pred HHHHHhhccCCchhHHHHHHHHHHHHhhhccCCCchhhHhhHHHhHHHHHHhhcCCCC-------hhhHHHHHHHhhhhh
Q 041480 1006 ETVSKILGSRNSDLVSVCLTTVAWLSHALSAQPDAEFQLSAFSAVISQLKEILQNGEQ-------PQQKVLASMSLLNFS 1078 (1122)
Q Consensus 1006 ~aL~~~l~s~~~~l~~acL~t~aWl~~~L~~~~~t~~~~~A~~~ll~~Lv~~L~~~~~-------~eer~LA~~aL~~~~ 1078 (1122)
..|.+.|.++..++..++ +|+.+-|+..+++ +..-..+.||+||++|..+.+ .+-.+-|+-+|.|++
T Consensus 358 p~Lv~LL~s~~~~v~~~A----~~aL~nLs~~~~~--~~~I~~g~ip~LV~LL~~~~~~~~~~~s~~v~~~a~~tL~NL~ 431 (584)
T 3l6x_A 358 SAIADLLTNEHERVVKAA----SGALRNLAVDARN--KELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVI 431 (584)
T ss_dssp HHHHHGGGCSCHHHHHHH----HHHHHHHHTTCSC--HHHHHHHHHHHHHHTSSSSSCSGGGTCCHHHHHHHHHHHHHHH
T ss_pred HHHHHHHcCCCHHHHHHH----HHHHHHHhCChhH--HHHHHhCCHHHHHHHhcCCcccccccchHHHHHHHHHHHHHHh
Confidence 777888999998776665 8999999988774 233357899999999997642 233455777899997
Q ss_pred C-CcchhhhHHHHhhHhHHHhhhhccc
Q 041480 1079 K-IPECGAVLKTIAAEIRIPLQSLTEV 1104 (1122)
Q Consensus 1079 ~-~~~~~~~L~~~a~gi~~~Lr~L~~~ 1104 (1122)
. ++++++.+ ...|....|-.|.+-
T Consensus 432 a~~~~~~~~I--~~~g~I~~Lv~LL~s 456 (584)
T 3l6x_A 432 AENLEAAKKL--RETQGIEKLVLINKS 456 (584)
T ss_dssp TTCHHHHHHH--HHTTHHHHHHHHHTC
T ss_pred cCCHHHHHHH--HHCCChHHHHHHHhC
Confidence 5 48888877 677888888777654
|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1122 | ||||
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-14 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 2e-10 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-08 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 2e-07 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 5e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.003 |
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: E3 ubiquitin ligase PUB14 species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 67.0 bits (163), Expect = 2e-14
Identities = 25/72 (34%), Positives = 46/72 (63%), Gaps = 1/72 (1%)
Query: 644 IPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLTNFI 703
P+ F CP++ +L ++PV + +GQT+E +I++W++ G++TCP + + L L N++
Sbjct: 5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-TPNYV 63
Query: 704 LKRVIDGWKSEN 715
LK +I W N
Sbjct: 64 LKSLIALWCESN 75
|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1122 | |||
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.76 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.76 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.69 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.41 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.39 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.36 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.34 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.31 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.3 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.25 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.2 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.18 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.96 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.69 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.68 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.54 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.34 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.2 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.0 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.77 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.64 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 96.57 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 94.68 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 94.48 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 94.19 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 94.17 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 93.93 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 93.51 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 92.92 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 92.07 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 90.53 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 86.82 |
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: E3 ubiquitin ligase PUB14 species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.76 E-value=9.2e-20 Score=162.09 Aligned_cols=75 Identities=32% Similarity=0.744 Sum_probs=70.7
Q ss_pred CCCCCcccccccchhccCCcccCCCcccchHHHHHHHHhCCCCCCCCCCcCCCCCCCcchHHHHHHHHHHHHhccc
Q 041480 642 TSIPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLTNFILKRVIDGWKSENCM 717 (1122)
Q Consensus 642 ~~ipeef~CPIc~elm~DPVtl~cGhTycRscIe~wl~~g~~tCP~trq~L~~~~ll~pN~~Lk~lIe~w~~~n~~ 717 (1122)
.++|++|.||||+++|+|||+++|||+|||+||++|+..+..+||.|++++.... +.||+.|+++|+.|+.+|+.
T Consensus 3 peiP~~l~CpIc~~~m~dPV~~~cgh~fc~~ci~~~~~~~~~~cP~~~~~l~~~~-l~pN~~L~~~I~~~~~~~~~ 77 (78)
T d1t1ha_ 3 PEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAG-LTPNYVLKSLIALWCESNGI 77 (78)
T ss_dssp CCCSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTTCCBCTTTCCBCSSCC-CEECTTTHHHHHHHHHHSCC
T ss_pred CCCCccCCCcCcCchhhCceEccCCCcchHHHHHHHHHHCCCCCCcccccCCccc-ccchHHHHHHHHHHHHHhCc
Confidence 4689999999999999999999999999999999999988889999999999888 49999999999999998874
|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|