Citrus Sinensis ID: 041549

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
QAYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLLQEPENTRDYLLTL
cccccccccccccccccccccccEEEEcccccccccccEEEEEEEccHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccEEEEEEEEcccccccccccccEEEEccEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccccHHcccc
ccccccEEcHHHHHHHccHHEccccccccccEEEEEccccEEEEccHHHHHHHHcccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEEEEccccHHHHHHHccEEEEEcEEccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEc
qayrsacicpefrhylngveladsvslnphkwfltnmdcgclwvkhssflvdsqstksdimrnrspasststnvapvidykDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAkderfetveprkcalvcfrlkpkresdgselnqLSLTQATLGGVYVIRCSigttltqdrHIDDLRKLIQEKADRLLLLQEPENTRDYLLTL
qayrsacicpEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSqstksdimrnrspasststnvapvidYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAkderfetveprkcaLVCFRLKpkresdgselnqLSLTQATLGGVYVIRCSIgttltqdrhiDDLRKLIQEKADrllllqepentrdylltl
QAYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLLQEPENTRDYLLTL
****SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLV**********************VAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLK***********QLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLL*************
QAYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLL***********LTL
QAYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVD********************NVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLLQEPENTRDYLLTL
*AYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRS*********APVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLLQEPENTRDYLL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QAYRSACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLLQEPENTRDYLLTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
P54768518 Tyrosine/DOPA decarboxyla N/A no 0.885 0.372 0.468 1e-54
P54771523 Tyrosine/DOPA decarboxyla N/A no 0.885 0.369 0.464 6e-54
Q06087516 Tyrosine decarboxylase 3 N/A no 0.885 0.374 0.495 8e-53
Q06088508 Tyrosine decarboxylase 4 N/A no 0.885 0.379 0.495 1e-52
P54769531 Tyrosine/DOPA decarboxyla N/A no 0.885 0.363 0.455 5e-52
Q06086514 Tyrosine decarboxylase 2 N/A no 0.885 0.375 0.490 5e-52
P54770533 Tyrosine/DOPA decarboxyla N/A no 0.885 0.362 0.443 8e-51
Q7XHL3497 Tyrosine decarboxylase 1 yes no 0.885 0.388 0.443 1e-50
P17770500 Aromatic-L-amino-acid dec N/A no 0.885 0.386 0.440 3e-49
Q8RY79490 Tyrosine decarboxylase 1 yes no 0.885 0.393 0.443 2e-48
>sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 Back     alignment and function desciption
 Score =  212 bits (540), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 104/222 (46%), Positives = 142/222 (63%), Gaps = 29/222 (13%)

Query: 5   SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNR 64
           SACICPEFRH+++GVE ADS SLN HKWF T +DC CLWVK S  LV + ST  + ++N+
Sbjct: 295 SACICPEFRHFIDGVEDADSFSLNAHKWFFTTLDCCCLWVKDSDSLVKALSTSPEYLKNK 354

Query: 65  SPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEA 124
           +      T+   VIDYKDWQIALSRRF+++KLW V+R +G + L   +RS V MAK F+ 
Sbjct: 355 A------TDSKQVIDYKDWQIALSRRFRSMKLWLVLRSYGIANLRTFLRSHVKMAKHFQG 408

Query: 125 MVAKDERFETVEPRKCALVCFRLKPKR------------ESDGSELN-----------QL 161
           ++  D RFE V PR  A+VCFRLKP              E+  +E+N           ++
Sbjct: 409 LIGMDNRFEIVVPRTFAMVCFRLKPAAIFRKKIVEDDHIEAQTNEVNAKLLESVNASGKI 468

Query: 162 SLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLL 203
            +T A +GGVY+IR ++G TLT++RH+    K++QE  D +L
Sbjct: 469 YMTHAVVGGVYMIRFAVGATLTEERHVTGAWKVVQEHTDAIL 510
Marginally higher substrate specificity for L-DOPA over L-tyrosine.
Papaver somniferum (taxid: 3469)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 5
>sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 Back     alignment and function description
>sp|Q06087|TYDC3_PETCR Tyrosine decarboxylase 3 OS=Petroselinum crispum GN=TYRDC-3 PE=2 SV=1 Back     alignment and function description
>sp|Q06088|TYDC4_PETCR Tyrosine decarboxylase 4 OS=Petroselinum crispum GN=TYRDC-4 PE=2 SV=1 Back     alignment and function description
>sp|P54769|TYDC2_PAPSO Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum GN=TYDC2 PE=2 SV=1 Back     alignment and function description
>sp|Q06086|TYDC2_PETCR Tyrosine decarboxylase 2 OS=Petroselinum crispum GN=TYRDC-2 PE=2 SV=1 Back     alignment and function description
>sp|P54770|TYDC3_PAPSO Tyrosine/DOPA decarboxylase 3 OS=Papaver somniferum GN=TYDC3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 Back     alignment and function description
>sp|P17770|DDC_CATRO Aromatic-L-amino-acid decarboxylase OS=Catharanthus roseus GN=TDC PE=2 SV=1 Back     alignment and function description
>sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
255569010 445 aromatic amino acid decarboxylase, putat 0.885 0.433 0.654 1e-73
225462400 496 PREDICTED: tyrosine/DOPA decarboxylase 2 0.899 0.395 0.604 6e-71
359476508 496 PREDICTED: tyrosine/DOPA decarboxylase 2 0.899 0.395 0.595 8e-70
147833019 496 hypothetical protein VITISV_007034 [Viti 0.899 0.395 0.590 7e-69
225431041219 PREDICTED: tyrosine/DOPA decarboxylase 1 0.885 0.881 0.595 1e-68
224123662 493 predicted protein [Populus trichocarpa] 0.885 0.391 0.604 8e-68
224139068 494 predicted protein [Populus trichocarpa] 0.885 0.390 0.595 1e-67
147854402 489 hypothetical protein VITISV_020160 [Viti 0.811 0.361 0.563 7e-61
359476541305 PREDICTED: LOW QUALITY PROTEIN: tyrosine 0.816 0.583 0.538 1e-56
147804683 434 hypothetical protein VITISV_007655 [Viti 0.788 0.396 0.554 1e-54
>gi|255569010|ref|XP_002525475.1| aromatic amino acid decarboxylase, putative [Ricinus communis] gi|223535288|gb|EEF36965.1| aromatic amino acid decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 162/211 (76%), Gaps = 18/211 (8%)

Query: 5   SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNR 64
           SACICPEFR+YLNGVELADS+S+NPHKWFLTNMDC CLWVK   FLVDS STK + +RN 
Sbjct: 239 SACICPEFRNYLNGVELADSISMNPHKWFLTNMDCCCLWVKQPDFLVDSLSTKPEYLRNT 298

Query: 65  SPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEA 124
           +  SS       VIDYKDWQIALSRRF+A+KLW VIR+HG + LM+HIRSDVNMAKRFE+
Sbjct: 299 ASESSA------VIDYKDWQIALSRRFRAIKLWVVIRRHGLATLMHHIRSDVNMAKRFES 352

Query: 125 MVAKDERFETVEPRKCALVCFRLKPKRESDGS-ELNQ-----------LSLTQATLGGVY 172
           +VA D+RFE V PRK ALVCFRLKPK  ++ S ELN+             LT    GG+Y
Sbjct: 353 LVANDKRFEIVVPRKFALVCFRLKPKDGANSSDELNRRLLAMVNQSGCAFLTHGVAGGIY 412

Query: 173 VIRCSIGTTLTQDRHIDDLRKLIQEKADRLL 203
            IRC+IG+TLT++RH+DDL KLIQEKA  +L
Sbjct: 413 FIRCAIGSTLTEERHVDDLWKLIQEKAHSML 443

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225462400|ref|XP_002266962.1| PREDICTED: tyrosine/DOPA decarboxylase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476508|ref|XP_003631850.1| PREDICTED: tyrosine/DOPA decarboxylase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833019|emb|CAN61896.1| hypothetical protein VITISV_007034 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225431041|ref|XP_002273847.1| PREDICTED: tyrosine/DOPA decarboxylase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123662|ref|XP_002319135.1| predicted protein [Populus trichocarpa] gi|222857511|gb|EEE95058.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139068|ref|XP_002322972.1| predicted protein [Populus trichocarpa] gi|222867602|gb|EEF04733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147854402|emb|CAN81298.1| hypothetical protein VITISV_020160 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476541|ref|XP_003631856.1| PREDICTED: LOW QUALITY PROTEIN: tyrosine/DOPA decarboxylase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804683|emb|CAN69187.1| hypothetical protein VITISV_007655 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2038937490 AAS "AT2G20340" [Arabidopsis t 0.899 0.4 0.449 1.5e-44
TAIR|locus:2139855547 TYRDC "L-tyrosine decarboxylas 0.899 0.358 0.406 1.5e-37
UNIPROTKB|E1BV90485 DDC "Uncharacterized protein" 0.899 0.404 0.401 1.3e-34
ZFIN|ZDB-GENE-040426-2656480 ddc "dopa decarboxylase" [Dani 0.899 0.408 0.392 9.5e-34
FB|FBgn0000422510 Ddc "Dopa decarboxylase" [Dros 0.885 0.378 0.384 1.4e-32
UNIPROTKB|P27718487 DDC "Aromatic-L-amino-acid dec 0.926 0.414 0.386 6e-32
UNIPROTKB|B5KFA1401 AADC "Aromatic-L-amino-acid de 0.917 0.498 0.384 6e-32
UNIPROTKB|I3L7F0486 DDC "Aromatic-L-amino-acid dec 0.917 0.411 0.384 6e-32
UNIPROTKB|P80041486 DDC "Aromatic-L-amino-acid dec 0.917 0.411 0.384 6e-32
UNIPROTKB|C9IYA0387 DDC "Aromatic-L-amino-acid dec 0.899 0.506 0.377 3.3e-31
TAIR|locus:2038937 AAS "AT2G20340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 469 (170.2 bits), Expect = 1.5e-44, P = 1.5e-44
 Identities = 97/216 (44%), Positives = 137/216 (63%)

Query:     2 AYR-SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDI 60
             AY  SACICPE+R Y++GVE ADS ++N HKWFLTN DC  LWVK    L  + ST  + 
Sbjct:   279 AYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWVKDQDSLTLALSTNPEF 338

Query:    61 MRNRSPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAK 120
             ++N++    +  N+  V+DYKDWQI L RRF++LKLW V+R +G   L  +IR+ + +AK
Sbjct:   339 LKNKA----SQANL--VVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAK 392

Query:   121 RFEAMVAKDERFETVEPRKCALVCFRLKPKRESD------GSEL-------NQLSLTQAT 167
              FE +V++D  FE V PR  ALVCFRL P ++ +        EL        +L ++   
Sbjct:   393 EFEQLVSQDPNFEIVTPRIFALVCFRLVPVKDEEKKCNNRNRELLDAVNSSGKLFMSHTA 452

Query:   168 LGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLL 203
             L G  V+RC+IG  LT+++H+ +  K+IQE+A  LL
Sbjct:   453 LSGKIVLRCAIGAPLTEEKHVKEAWKIIQEEASYLL 488
GO:0004837 "tyrosine decarboxylase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006520 "cellular amino acid metabolic process" evidence=ISS
GO:0009611 "response to wounding" evidence=IEP
GO:1990055 "phenylacetaldehyde synthase activity" evidence=IDA
GO:0006559 "L-phenylalanine catabolic process" evidence=IDA
TAIR|locus:2139855 TYRDC "L-tyrosine decarboxylase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BV90 DDC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2656 ddc "dopa decarboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0000422 Ddc "Dopa decarboxylase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P27718 DDC "Aromatic-L-amino-acid decarboxylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B5KFA1 AADC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7F0 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P80041 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9IYA0 DDC "Aromatic-L-amino-acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007643001
SubName- Full=Chromosome undetermined scaffold_197, whole genome shotgun sequence; (550 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037462001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (427 aa)
     •  0.899
GSVIVG00032723001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (410 aa)
     •  0.899
GSVIVG00032463001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (450 aa)
     •  0.899
GSVIVG00027735001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (422 aa)
     •  0.899
GSVIVG00018772001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (423 aa)
     •  0.899
GSVIVG00018632001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (419 aa)
     •  0.899
GSVIVG00018631001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (419 aa)
     •  0.899
GSVIVG00018628001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (419 aa)
     •  0.899
GSVIVG00016723001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (411 aa)
     •  0.899
GSVIVG00016002001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (703 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
PLN02880490 PLN02880, PLN02880, tyrosine decarboxylase 2e-71
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 4e-54
PLN02590539 PLN02590, PLN02590, probable tyrosine decarboxylas 3e-46
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 4e-32
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 7e-14
TIGR03799522 TIGR03799, NOD_PanD_pyr, putative pyridoxal-depend 2e-04
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information 
 Score =  225 bits (574), Expect = 2e-71
 Identities = 98/213 (46%), Positives = 141/213 (66%), Gaps = 19/213 (8%)

Query: 5   SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNR 64
           SACICPE+RHY++GVE ADS ++N HKWFLTN DC  LWVK  + L+ S ST  + ++N+
Sbjct: 281 SACICPEYRHYIDGVEEADSFNMNAHKWFLTNFDCSLLWVKDRNALIQSLSTNPEFLKNK 340

Query: 65  SPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEA 124
             AS  ++    V+DYKDWQI L RRF++LKLW V+R +G   L  +IR+ + +AK FE 
Sbjct: 341 --ASQANS----VVDYKDWQIPLGRRFRSLKLWMVLRLYGVENLQSYIRNHIKLAKEFEQ 394

Query: 125 MVAKDERFETVEPRKCALVCFRLKP--KRESDGSELN-----------QLSLTQATLGGV 171
           +VA+D RFE V PR  +LVCFRL P    E +G++LN           ++ ++   L G 
Sbjct: 395 LVAQDSRFEVVTPRIFSLVCFRLVPPKNNEDNGNKLNHDLLDAVNSSGKIFISHTVLSGK 454

Query: 172 YVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLL 204
           YV+R ++G  LT++RH+    K++Q++A +LL 
Sbjct: 455 YVLRFAVGAPLTEERHVTAAWKVLQDEASKLLG 487

Length = 490
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163511 TIGR03799, NOD_PanD_pyr, putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
PLN02590539 probable tyrosine decarboxylase 100.0
PLN02880490 tyrosine decarboxylase 100.0
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 100.0
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
KOG0629510 consensus Glutamate decarboxylase and related prot 99.97
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.97
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.96
PLN02263470 serine decarboxylase 99.95
PLN03032374 serine decarboxylase; Provisional 99.94
PRK02769380 histidine decarboxylase; Provisional 99.92
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.77
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 99.75
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.67
PRK13520371 L-tyrosine decarboxylase; Provisional 99.65
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.61
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.45
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.43
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.36
TIGR01814406 kynureninase kynureninase. This model describes ky 99.36
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.35
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.35
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.34
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.32
PLN02724 805 Molybdenum cofactor sulfurase 99.32
PRK05367954 glycine dehydrogenase; Provisional 99.32
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.31
PRK03080378 phosphoserine aminotransferase; Provisional 99.28
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.24
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.22
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.21
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.2
PLN02651364 cysteine desulfurase 99.19
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.18
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.11
PRK05367 954 glycine dehydrogenase; Provisional 99.07
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.05
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.03
PLN02414 993 glycine dehydrogenase (decarboxylating) 98.99
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 98.97
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 98.95
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 98.95
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.95
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 98.94
PLN02414993 glycine dehydrogenase (decarboxylating) 98.9
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 98.9
PRK00451447 glycine dehydrogenase subunit 1; Validated 98.88
PLN02409401 serine--glyoxylate aminotransaminase 98.87
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 98.86
PRK14012404 cysteine desulfurase; Provisional 98.82
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 98.81
PRK12566954 glycine dehydrogenase; Provisional 98.8
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 98.79
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 98.75
PRK02948381 cysteine desulfurase; Provisional 98.67
PLN02721353 threonine aldolase 98.61
PRK13580493 serine hydroxymethyltransferase; Provisional 98.6
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 98.5
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 98.43
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 98.3
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 98.28
PLN03226475 serine hydroxymethyltransferase; Provisional 98.26
PLN02452365 phosphoserine transaminase 98.23
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 98.2
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 98.19
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 98.17
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.13
PRK07582366 cystathionine gamma-lyase; Validated 98.11
cd00609350 AAT_like Aspartate aminotransferase family. This f 98.1
PRK13034416 serine hydroxymethyltransferase; Reviewed 98.09
PRK07179407 hypothetical protein; Provisional 98.08
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 97.99
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 97.89
PRK12462364 phosphoserine aminotransferase; Provisional 97.85
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 97.83
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 97.83
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 97.79
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 97.73
PRK08861388 cystathionine gamma-synthase; Provisional 97.72
PLN02271586 serine hydroxymethyltransferase 97.69
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 97.65
PRK08045386 cystathionine gamma-synthase; Provisional 97.65
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 97.64
cd06454349 KBL_like KBL_like; this family belongs to the pyri 97.64
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 97.63
PRK07269364 cystathionine gamma-synthase; Reviewed 97.61
PRK08114395 cystathionine beta-lyase; Provisional 97.59
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 97.59
PRK06767386 methionine gamma-lyase; Provisional 97.57
PRK08064390 cystathionine beta-lyase; Provisional 97.56
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 97.54
PLN02509464 cystathionine beta-lyase 97.47
PRK06434384 cystathionine gamma-lyase; Validated 97.43
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 97.31
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 97.31
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 97.31
PRK05968389 hypothetical protein; Provisional 97.29
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 97.27
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 97.25
PRK09028394 cystathionine beta-lyase; Provisional 97.24
PRK07811388 cystathionine gamma-synthase; Provisional 97.22
PLN02822481 serine palmitoyltransferase 97.21
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 97.21
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 97.17
PRK07671377 cystathionine beta-lyase; Provisional 97.16
PRK08574385 cystathionine gamma-synthase; Provisional 97.16
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 97.12
PRK08776405 cystathionine gamma-synthase; Provisional 97.11
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 97.1
PRK07050394 cystathionine beta-lyase; Provisional 97.0
PRK08249398 cystathionine gamma-synthase; Provisional 96.98
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 96.98
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 96.98
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 96.91
PLN03227392 serine palmitoyltransferase-like protein; Provisio 96.89
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 96.88
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 96.88
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 96.87
PRK06460376 hypothetical protein; Provisional 96.86
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 96.85
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 96.79
PRK09064407 5-aminolevulinate synthase; Validated 96.79
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 96.79
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 96.77
PRK13392410 5-aminolevulinate synthase; Provisional 96.69
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 96.69
KOG0630 838 consensus Predicted pyridoxal-dependent decarboxyl 96.66
PLN02483489 serine palmitoyltransferase 96.64
PRK03244398 argD acetylornithine aminotransferase; Provisional 96.64
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 96.49
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 96.47
PRK08247366 cystathionine gamma-synthase; Reviewed 96.45
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 96.42
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 96.38
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 96.36
PRK06234400 methionine gamma-lyase; Provisional 96.31
PRK10534333 L-threonine aldolase; Provisional 96.25
PRK07503403 methionine gamma-lyase; Provisional 96.25
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 96.25
PRK13237460 tyrosine phenol-lyase; Provisional 96.12
PRK13393406 5-aminolevulinate synthase; Provisional 96.08
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 96.02
PRK06108382 aspartate aminotransferase; Provisional 95.98
PRK04311464 selenocysteine synthase; Provisional 95.85
TIGR00707379 argD acetylornithine and succinylornithine aminotr 95.83
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 95.8
PRK07908349 hypothetical protein; Provisional 95.79
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 95.76
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 95.67
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 95.66
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 95.65
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 95.63
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 95.61
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 95.38
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 95.32
PTZ00125400 ornithine aminotransferase-like protein; Provision 95.28
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 95.19
KOG1368384 consensus Threonine aldolase [Amino acid transport 95.19
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 94.99
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 94.91
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 94.89
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 94.65
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 94.62
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 94.61
PRK01688351 histidinol-phosphate aminotransferase; Provisional 94.59
PRK08363398 alanine aminotransferase; Validated 94.39
PRK04635354 histidinol-phosphate aminotransferase; Provisional 94.36
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 94.35
PRK08361391 aspartate aminotransferase; Provisional 94.33
PRK02731367 histidinol-phosphate aminotransferase; Validated 94.24
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 94.02
PRK12566 954 glycine dehydrogenase; Provisional 93.95
PRK05764393 aspartate aminotransferase; Provisional 93.89
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 93.64
PRK15029 755 arginine decarboxylase; Provisional 93.62
PRK07049427 methionine gamma-lyase; Validated 93.56
PLN02955476 8-amino-7-oxononanoate synthase 93.38
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 93.14
PRK08056356 threonine-phosphate decarboxylase; Provisional 92.97
PRK05967395 cystathionine beta-lyase; Provisional 92.96
PRK13578 720 ornithine decarboxylase; Provisional 92.95
PRK04870356 histidinol-phosphate aminotransferase; Provisional 92.9
PRK02936377 argD acetylornithine aminotransferase; Provisional 92.8
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 92.54
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 92.19
PRK06225380 aspartate aminotransferase; Provisional 92.15
PRK05387353 histidinol-phosphate aminotransferase; Provisional 91.86
PRK05769441 4-aminobutyrate aminotransferase; Provisional 91.77
PRK15399 713 lysine decarboxylase LdcC; Provisional 91.54
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 91.53
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 91.25
PRK02627396 acetylornithine aminotransferase; Provisional 91.06
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 91.02
PRK12381406 bifunctional succinylornithine transaminase/acetyl 91.01
PRK14807351 histidinol-phosphate aminotransferase; Provisional 90.95
PRK04260375 acetylornithine aminotransferase; Provisional 90.89
PRK03715395 argD acetylornithine transaminase protein; Provisi 90.85
PRK05939397 hypothetical protein; Provisional 90.82
PRK03158359 histidinol-phosphate aminotransferase; Provisional 90.8
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 90.54
PRK01278389 argD acetylornithine transaminase protein; Provisi 90.25
PRK06290410 aspartate aminotransferase; Provisional 90.23
PRK06425332 histidinol-phosphate aminotransferase; Validated 90.09
PLN02242418 methionine gamma-lyase 89.93
PRK00950361 histidinol-phosphate aminotransferase; Validated 89.8
PLN03026380 histidinol-phosphate aminotransferase; Provisional 89.71
PRK06358354 threonine-phosphate decarboxylase; Provisional 89.67
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 89.64
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 89.58
PRK04781364 histidinol-phosphate aminotransferase; Provisional 89.56
PRK15400 714 lysine decarboxylase CadA; Provisional 89.55
PRK09105370 putative aminotransferase; Provisional 89.34
PRK06207405 aspartate aminotransferase; Provisional 89.04
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 89.02
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 88.96
PRK06541460 hypothetical protein; Provisional 88.88
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 88.47
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 88.43
PRK02610374 histidinol-phosphate aminotransferase; Provisional 88.31
PRK05957389 aspartate aminotransferase; Provisional 87.99
PRK07682378 hypothetical protein; Validated 87.87
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 87.69
PLN02624474 ornithine-delta-aminotransferase 87.6
PRK03317368 histidinol-phosphate aminotransferase; Provisional 87.57
PRK08297443 L-lysine aminotransferase; Provisional 87.3
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 86.84
PRK08153369 histidinol-phosphate aminotransferase; Provisional 86.84
PRK13360442 omega amino acid--pyruvate transaminase; Provision 86.79
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 86.67
PRK04612408 argD acetylornithine transaminase protein; Provisi 86.67
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 86.61
PTZ00433412 tyrosine aminotransferase; Provisional 86.51
PRK07681399 aspartate aminotransferase; Provisional 86.5
PRK07568397 aspartate aminotransferase; Provisional 86.49
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 86.4
PRK09221445 beta alanine--pyruvate transaminase; Provisional 86.04
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 85.99
PTZ00377481 alanine aminotransferase; Provisional 85.91
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 85.79
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 85.54
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 85.51
PRK06107402 aspartate aminotransferase; Provisional 85.34
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 85.12
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 85.11
PRK06959339 putative threonine-phosphate decarboxylase; Provis 85.05
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 84.82
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 84.65
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 84.46
PRK09265404 aminotransferase AlaT; Validated 84.42
PRK13355517 bifunctional HTH-domain containing protein/aminotr 84.1
PRK06917447 hypothetical protein; Provisional 84.04
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 83.96
PLN02187462 rooty/superroot1 83.6
PRK08175395 aminotransferase; Validated 83.32
PRK15481431 transcriptional regulatory protein PtsJ; Provision 83.24
PRK08117433 4-aminobutyrate aminotransferase; Provisional 81.79
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 81.65
PRK07505402 hypothetical protein; Provisional 81.57
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 81.5
PRK05166371 histidinol-phosphate aminotransferase; Provisional 81.33
PRK05639457 4-aminobutyrate aminotransferase; Provisional 81.2
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 81.01
PRK03321352 putative aminotransferase; Provisional 80.62
PRK06058443 4-aminobutyrate aminotransferase; Provisional 80.53
PRK07777387 aminotransferase; Validated 80.12
PLN00144382 acetylornithine transaminase 80.03
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information 
Probab=100.00  E-value=9.1e-46  Score=339.67  Aligned_cols=196  Identities=41%  Similarity=0.810  Sum_probs=174.7

Q ss_pred             cccccc-cCccccccccCCCCCCeeeecccccCCCccceeEEEEeCCcchhhhhcCCcccccccCCCCCCCCCCCCccCC
Q 041549            2 AYRSAC-ICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDY   80 (218)
Q Consensus         2 A~Gg~~-~~~~~r~~~~gi~~aDSi~~d~HK~l~~P~~~g~l~~r~~~~l~~~~~~~~~yl~~~~~~~~~~~~~~~~~~~   80 (218)
                      ||||++ +||++|+++.||++||||++||||||++|++||++++|++..+.+++..+++|+.....+..      ..+|+
T Consensus       325 A~GG~al~~~~~r~~~~Gie~ADSit~D~HK~l~~p~~cg~llvr~~~~l~~a~~~~~~YL~~~~~~~~------~~~d~  398 (539)
T PLN02590        325 AYAGNACICPEYRKFIDGIENADSFNMNAHKWLFANQTCSPLWVKDRYSLIDALKTNPEYLEFKVSKKD------TVVNY  398 (539)
T ss_pred             chhhhhhcChhhHHHhcCCccCCEEEECchhhcCcCcCEEEEEecCHHHHHHHhhcCHHHhCCcccccc------cCCCc
Confidence            899855 57999999999999999999999999999999999999998887889899999965432211      35789


Q ss_pred             cCccccCCCCCchhHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCCceeEEEEecCCC--cchHHH-
Q 041549           81 KDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKR--ESDGSE-  157 (218)
Q Consensus        81 ~~~tl~~sR~~~al~~w~~l~~~G~~g~~~~i~~~~~la~~l~~~L~~~~~~el~~~~~~~iV~Fr~~~~~--~~~~~~-  157 (218)
                      .+|++++|||++|||+|++|+.+|.+||+++|++++++|++|++.|+++|+||++.+|.+++||||+.|..  ++..++ 
T Consensus       399 ~d~~i~lsRr~raLklW~~lr~~G~~G~~~~i~~~~~lA~~~~~~l~~~~~fel~~~~~l~iVcFr~~~~~~~~~~~~~l  478 (539)
T PLN02590        399 KDWQISLSRRFRSLKLWMVLRLYGSENLRNFIRDHVNLAKHFEDYVAQDPSFEVVTTRYFSLVCFRLAPVDGDEDQCNER  478 (539)
T ss_pred             cccCCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCceEEEEEEecCCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999998742  222333 


Q ss_pred             -------hhc---eeecceEECCEEEEEEecCCCCCcHHHHHHHHHHHHHHHHHHH
Q 041549          158 -------LNQ---LSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLL  203 (218)
Q Consensus       158 -------Ln~---~~vs~~~~~g~~~lR~~~~n~~tt~~di~~l~~~l~~~~~~~~  203 (218)
                             |++   .|++++.++|+.+||+|++||.|+++||+.+++.|.+.+.++-
T Consensus       479 n~~l~~~l~~~G~~~vs~t~~~g~~~lR~~i~n~~T~~~dv~~~~~~i~~~a~~~~  534 (539)
T PLN02590        479 NRELLAAVNSTGKIFISHTALSGKFVLRFAVGAPLTEEKHVTEAWQIIQKHASKFT  534 (539)
T ss_pred             HHHHHHHHHhCCCEEEEeeEECCEEEEEEEecCCCCCHHHHHHHHHHHHHHHHHhc
Confidence                   333   7899999999999999999999999999999999999987764

>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>KOG0630 consensus Predicted pyridoxal-dependent decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3k40_A475 Crystal Structure Of Drosophila 3,4-Dihydroxyphenyl 9e-35
1js3_A486 Crystal Structure Of Dopa Decarboxylase In Complex 1e-34
3rbf_A480 Crystal Structure Of Human Aromatic L-Amino Acid De 4e-34
3rch_A480 Crystal Structure Of Human Aromatic L-Amino Acid De 2e-33
4e1o_A481 Human Histidine Decarboxylase Complex With Histidin 2e-29
2jis_A515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 1e-08
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 6e-07
2okj_A504 The X-Ray Crystal Structure Of The 67kda Isoform Of 2e-06
2qma_A497 Crystal Structure Of Glutamate Decarboxylase Domain 2e-05
2okk_A497 The X-Ray Crystal Structure Of The 65kda Isoform Of 4e-05
>pdb|3K40|A Chain A, Crystal Structure Of Drosophila 3,4-Dihydroxyphenylalanine Decarboxylase Length = 475 Back     alignment and structure 
Iteration: 1

 Score =  143 bits (360), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 109/204 (53%), Gaps = 14/204 (6%)
Query: 5   SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNR 64
           SA ICPE+RH + G+E ADS + NPH W L N DC  +W+K  S++V++ +     +++ 
Sbjct: 276 SAFICPEYRHLMKGIESADSFNFNPHXWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHD 335
Query: 65  SPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEA 124
              S+         DY+ WQI L RRF+ALKLW V+R +G   L  HIR   N AK+F  
Sbjct: 336 MQGSAP--------DYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGD 387
Query: 125 MVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLS------LTQATLGGVYVIRCSI 178
           +   D RFE        LVCFRLK   E + + L +++      L  A +  VY +R +I
Sbjct: 388 LCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIKDVYFLRMAI 447
Query: 179 GTTLTQDRHIDDLRKLIQEKADRL 202
            +  TQ   ++   K +   AD +
Sbjct: 448 CSRFTQSEDMEYSWKEVSAAADEM 471
>pdb|1JS3|A Chain A, Crystal Structure Of Dopa Decarboxylase In Complex With The Inhibitor Carbidopa Length = 486 Back     alignment and structure
>pdb|3RBF|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Apo Form Length = 480 Back     alignment and structure
>pdb|3RCH|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Open Conformation With Llp And Plp Bound To Chain-A And Chain- B Respectively Length = 480 Back     alignment and structure
>pdb|4E1O|A Chain A, Human Histidine Decarboxylase Complex With Histidine Methyl Ester (Hme) Length = 481 Back     alignment and structure
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 6e-73
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 6e-72
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1e-71
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 7e-68
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 6e-66
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 5e-64
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 1e-09
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 1e-08
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 1e-08
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-08
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 4e-06
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
 Score =  228 bits (582), Expect = 6e-73
 Identities = 78/211 (36%), Positives = 111/211 (52%), Gaps = 12/211 (5%)

Query: 5   SACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNR 64
           SA ICPEFRH LNGVE ADS + NPHKW L N DC  +WVK  + L  +       +++ 
Sbjct: 277 SAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHS 336

Query: 65  SPASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEA 124
              S        + DY+ WQ+ L RRF++LK+W V R +G  GL  +IR  V ++  FEA
Sbjct: 337 HQGS------GLITDYRHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEA 390

Query: 125 MVAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLS------LTQATLGGVYVIRCSI 178
            V +D RFE        LVCFRLK     + + L +++      L    L G +V+R +I
Sbjct: 391 FVLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAI 450

Query: 179 GTTLTQDRHIDDLRKLIQEKADRLLLLQEPE 209
            +   +  H+    + I+  A  LL  +E +
Sbjct: 451 CSRKVESGHVRLAWEHIRGLAAELLAAEEGK 481
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.97
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.96
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.96
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.96
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.96
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.9
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.88
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.65
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.65
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.54
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.44
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.41
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.3
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.27
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.26
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.22
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.16
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.13
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.01
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 98.99
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 98.9
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 98.88
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 98.88
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 98.87
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 98.87
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.86
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 98.84
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 98.84
1iug_A352 Putative aspartate aminotransferase; wild type, py 98.81
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 98.81
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 98.81
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 98.8
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 98.79
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 98.76
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 98.76
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 98.76
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 98.75
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 98.74
2yrr_A353 Aminotransferase, class V; structural genomics, NP 98.71
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 98.67
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 98.66
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.62
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 98.56
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 98.55
3f0h_A376 Aminotransferase; RER070207000802, structural geno 98.54
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 98.53
2fnu_A375 Aminotransferase; protein-product complex, structu 98.49
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 98.46
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 98.44
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 98.44
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 98.43
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.41
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.4
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 98.4
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 98.39
1svv_A359 Threonine aldolase; structural genomics, structura 98.38
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.35
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 98.34
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.31
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 98.29
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 98.28
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 98.2
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 98.19
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 98.14
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.13
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 98.12
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 98.1
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 98.06
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 98.06
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 98.02
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 97.96
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 97.94
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 97.94
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 97.93
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 97.92
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 97.89
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 97.89
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 97.88
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 97.87
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 97.87
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 97.84
1o69_A394 Aminotransferase; structural genomics, unknown fun 97.83
1xi9_A406 Putative transaminase; alanine aminotransferase, s 97.82
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 97.82
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 97.8
3pj0_A359 LMO0305 protein; structural genomics, joint center 97.8
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 97.79
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 97.78
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 97.78
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 97.76
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 97.74
1vp4_A425 Aminotransferase, putative; structural genomics, j 97.71
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 97.7
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 97.7
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 97.7
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 97.7
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 97.69
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 97.68
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 97.67
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 97.66
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 97.66
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 97.64
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 97.61
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 97.61
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 97.6
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 97.58
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 97.57
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 97.57
3ftb_A361 Histidinol-phosphate aminotransferase; structural 97.56
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 97.56
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 97.56
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 97.55
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 97.53
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 97.48
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 97.47
3l8a_A421 METC, putative aminotransferase, probable beta-cys 97.46
3nra_A407 Aspartate aminotransferase; structural genomics, j 97.44
2z61_A370 Probable aspartate aminotransferase 2; amino acid 97.41
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 97.41
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 97.41
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 97.38
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 97.34
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 97.32
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 97.31
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 97.28
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 97.27
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 97.26
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 97.26
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 97.25
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 97.24
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 97.24
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 97.24
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 97.2
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 97.19
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 97.18
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 97.18
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 97.15
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 97.13
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 97.13
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 97.11
3aow_A448 Putative uncharacterized protein PH0207; protein-P 97.1
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 97.1
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 97.08
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 97.06
4adb_A406 Succinylornithine transaminase; transferase, PLP e 97.03
3ruy_A392 Ornithine aminotransferase; structural genomics, c 96.99
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 96.86
3ele_A398 Amino transferase; RER070207001803, structural gen 96.84
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 96.8
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 96.79
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 96.77
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 96.73
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 96.67
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 96.65
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 96.62
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 96.6
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 96.56
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 96.53
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 96.52
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 96.5
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 96.49
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 96.49
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 96.48
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 96.43
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 96.41
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 96.41
1z7d_A433 Ornithine aminotransferase; structural genomics co 96.39
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 96.37
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 96.26
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 96.15
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 96.13
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 96.12
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 96.09
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 96.04
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 95.97
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 95.85
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 95.68
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 95.67
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 95.67
3hmu_A472 Aminotransferase, class III; structural genomics, 95.66
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 95.32
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 95.18
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 95.14
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 95.12
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 95.06
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 94.06
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 94.98
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 94.95
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 94.59
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 94.58
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 94.5
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 94.23
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 94.21
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 94.16
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 94.08
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 93.98
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 93.74
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 93.63
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 93.59
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 93.02
3rq1_A418 Aminotransferase class I and II; structural genomi 92.94
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 92.65
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 91.51
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 90.84
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 90.83
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 90.17
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 90.15
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 90.05
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 89.83
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 89.61
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 89.33
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 87.86
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 87.78
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 87.58
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 87.18
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 85.66
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 85.2
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 85.11
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 83.8
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 83.52
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 82.34
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
Probab=100.00  E-value=9.6e-33  Score=250.18  Aligned_cols=196  Identities=38%  Similarity=0.706  Sum_probs=152.8

Q ss_pred             ccccc-ccCccccccccCCCCCCeeeecccccCCCccceeEEEEeCCcchhhhhcCCcccccccCCCCCCCCCCCCccCC
Q 041549            2 AYRSA-CICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDY   80 (218)
Q Consensus         2 A~Gg~-~~~~~~r~~~~gi~~aDSi~~d~HK~l~~P~~~g~l~~r~~~~l~~~~~~~~~yl~~~~~~~~~~~~~~~~~~~   80 (218)
                      |||+. +++|++++.+.|++++||+++|+|||+++|++||++++|++..+.+.+...++|+.....+        ..+++
T Consensus       272 A~~~~~~~~~~~~~~~~gi~~~Ds~~~~~hK~l~~p~g~g~l~~~~~~~l~~~~~~~~~yl~~~~~~--------~~~~~  343 (475)
T 3k40_A          272 AYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQG--------SAPDY  343 (475)
T ss_dssp             TTGGGGGGSGGGGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESSGGGC------------------------------
T ss_pred             HhHHHHHhCHhhHHHhcCcccCCEEEECchhccCCCCceEEEEEeCHHHHHHHhcCCccccCCCcCC--------CCCCc
Confidence            78874 5579999999999999999999999999999999999999987766777778898764321        34677


Q ss_pred             cCccccCCCCCchhHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCCceeEEEEecCCCc---chHHH
Q 041549           81 KDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRE---SDGSE  157 (218)
Q Consensus        81 ~~~tl~~sR~~~al~~w~~l~~~G~~g~~~~i~~~~~la~~l~~~L~~~~~~el~~~~~~~iV~Fr~~~~~~---~~~~~  157 (218)
                      .+|++++||+++++++|++|+.+|.+|+++++++..++++++++.|+++|+|+++.++.+++|||++++.+.   +..++
T Consensus       344 ~~~~~~~sr~~~~l~l~~al~~~g~~g~~~~~~~~~~~a~~l~~~L~~~~g~~l~~~~~~~iv~f~~~~~~~~~~~l~~~  423 (475)
T 3k40_A          344 RHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKR  423 (475)
T ss_dssp             -----CCCGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTEEESSCCBTTEEEEEESSCHHHHHHHHHH
T ss_pred             ccccccCCCcccHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEecCCceEEEEEEeCCchHHHHHHHHH
Confidence            789999999999999999999999999999999999999999999999999999999999999999976421   22345


Q ss_pred             hhc---eeecceEECCEEEEEEecCCCCCcHHHHHHHHHHHHHHHHHHHhh
Q 041549          158 LNQ---LSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLLL  205 (218)
Q Consensus       158 Ln~---~~vs~~~~~g~~~lR~~~~n~~tt~~di~~l~~~l~~~~~~~~~~  205 (218)
                      |++   .+++++.++|..++|++++|++++++||+.+++.|++++++++++
T Consensus       424 L~~~g~~~~~~~~~~g~~~lR~~~~~~~tt~~di~~~~~~i~~~~~~~~~~  474 (475)
T 3k40_A          424 INGRGHIHLVPAKIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAADEMEQE  474 (475)
T ss_dssp             HHHHTSCBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHhCCcEEEEeeEECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHhcc
Confidence            555   567788889999999999999999999999999999999988764
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 4e-39
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 8e-12
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 5e-05
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 0.001
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  138 bits (347), Expect = 4e-39
 Identities = 76/204 (37%), Positives = 107/204 (52%), Gaps = 12/204 (5%)

Query: 6   ACICPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRS 65
           A ICPEFRH LNGVE ADS + NPHKW L N DC  +WVK  + L  +       +++  
Sbjct: 278 AFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSH 337

Query: 66  PASSTSTNVAPVIDYKDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAM 125
             S        + DY+ WQ+ L RRF++LK+W V R +G  GL  +IR  V ++  FEA 
Sbjct: 338 QGS------GLITDYRHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAF 391

Query: 126 VAKDERFETVEPRKCALVCFRLKPKRESDGSELNQLS------LTQATLGGVYVIRCSIG 179
           V +D RFE        LVCFRLK     + + L +++      L    L G +V+R +I 
Sbjct: 392 VLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAIC 451

Query: 180 TTLTQDRHIDDLRKLIQEKADRLL 203
           +   +  H+    + I+  A  LL
Sbjct: 452 SRKVESGHVRLAWEHIRGLAAELL 475
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.97
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.58
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.46
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.45
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.4
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.4
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.38
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.02
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 98.91
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 98.86
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.84
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.81
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 98.78
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 98.76
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 98.59
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.54
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 98.53
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 98.37
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.28
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 98.17
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.06
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 98.01
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 97.7
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 97.65
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 97.2
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 96.6
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 96.53
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 96.51
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 96.48
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 96.43
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 96.37
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 96.34
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 96.24
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 95.9
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 95.53
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 95.13
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 94.94
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 94.83
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 94.78
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 94.69
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 94.5
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 94.32
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 93.6
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 93.49
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 92.56
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 92.28
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 92.27
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 91.92
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 91.69
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 91.02
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 90.87
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 90.63
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 90.07
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 89.37
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 86.95
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 86.61
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 85.95
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 84.2
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 83.59
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 82.59
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 82.36
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 81.63
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=3.5e-43  Score=317.12  Aligned_cols=197  Identities=39%  Similarity=0.701  Sum_probs=168.6

Q ss_pred             ccccccc-CccccccccCCCCCCeeeecccccCCCccceeEEEEeCCcchhhhhcCCcccccccCCCCCCCCCCCCccCC
Q 041549            2 AYRSACI-CPEFRHYLNGVELADSVSLNPHKWFLTNMDCGCLWVKHSSFLVDSQSTKSDIMRNRSPASSTSTNVAPVIDY   80 (218)
Q Consensus         2 A~Gg~~~-~~~~r~~~~gi~~aDSi~~d~HK~l~~P~~~g~l~~r~~~~l~~~~~~~~~yl~~~~~~~~~~~~~~~~~~~   80 (218)
                      ||||+++ ++++|+++.||++||||++|+||||++|++||++++|++..+..++...+.|+.....+..      ...++
T Consensus       273 A~Gg~~~~~~~~~~~~~gi~~aDSit~d~HK~l~~P~~~g~~l~r~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~  346 (476)
T d1js3a_         273 AYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGSG------LITDY  346 (476)
T ss_dssp             TTGGGGGGSTTTGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESCHHHHHGGGC------------CC------SCCCG
T ss_pred             ccchhhhhhcchhhhhcCCcccceeeecCccccccCCcceeecccchHHHHHHHhcChhhhcccccccc------ccccc
Confidence            8999655 6999999999999999999999999999999999999998887778888888876554322      45678


Q ss_pred             cCccccCCCCCchhHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCCceeEEEEecCCCc---chHHH
Q 041549           81 KDWQIALSRRFKALKLWTVIRKHGYSGLMYHIRSDVNMAKRFEAMVAKDERFETVEPRKCALVCFRLKPKRE---SDGSE  157 (218)
Q Consensus        81 ~~~tl~~sR~~~al~~w~~l~~~G~~g~~~~i~~~~~la~~l~~~L~~~~~~el~~~~~~~iV~Fr~~~~~~---~~~~~  157 (218)
                      .++++++||+++|+|+|++|+.+|.+||++++++.+++|++|++.|+++|+||++.||.+++||||+++.+.   ...++
T Consensus       347 ~~~~~~~sr~~~al~lw~~l~~~G~~g~~~~i~~~~~lA~~l~~~l~~~~~fel~~~p~l~iV~Fr~~~~d~~n~~l~~~  426 (476)
T d1js3a_         347 RHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLER  426 (476)
T ss_dssp             GGSSSCSCCCCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTEEECSCCCSSEEEEEESSCHHHHHHHHHH
T ss_pred             cccccccchhhHHHHHHHHHHHHhHhHHHHHHHHHHHHHHHHHHHHhcCCCeEEECCCceEEEEEEccCChHHHHHHHHH
Confidence            899999999999999999999999999999999999999999999999999999999999999999987642   22345


Q ss_pred             hhc---eeecceEECCEEEEEEecCCCCCcHHHHHHHHHHHHHHHHHHHh
Q 041549          158 LNQ---LSLTQATLGGVYVIRCSIGTTLTQDRHIDDLRKLIQEKADRLLL  204 (218)
Q Consensus       158 Ln~---~~vs~~~~~g~~~lR~~~~n~~tt~~di~~l~~~l~~~~~~~~~  204 (218)
                      |++   .|++++.++|+.+||++++||+|+++||+.+++.|++++.++++
T Consensus       427 l~~~G~~~~s~t~~~g~~~lR~~i~n~~Tt~~did~~~~~i~~~a~~lla  476 (476)
T d1js3a_         427 INSARKIHLVPCRLRGQFVLRFAICSRKVESGHVRLAWEHIRGLAAELLA  476 (476)
T ss_dssp             HHHHTSCBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHhcCCEEEeeeeECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHhC
Confidence            555   68999999999999999999999999999999999999999874
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure