Citrus Sinensis ID: 041564
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 151 | ||||||
| 4836950 | 688 | Hypothetical protein [Arabidopsis thalia | 0.410 | 0.090 | 0.4 | 2e-05 | |
| 15223823 | 666 | armadillo/beta-catenin-like repeats-cont | 0.417 | 0.094 | 0.395 | 2e-05 | |
| 297847504 | 666 | armadillo/beta-catenin repeat family pro | 0.417 | 0.094 | 0.395 | 2e-05 |
| >gi|4836950|gb|AAD30652.1|AC006085_25 Hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 54.3 bits (129), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 34/85 (40%), Positives = 44/85 (51%), Gaps = 23/85 (27%)
Query: 23 LKNQIIGSQTKKLSFLKK----------------------LYRLILPPSRFTCGFEA-IQ 59
+KNQIIG++TKKLSFLK L + F CGFEA +Q
Sbjct: 43 VKNQIIGNRTKKLSFLKLGAIPAIASVLADADDSDECNNILVQSAAALGSFACGFEAGVQ 102
Query: 60 AMLDAGLFPDLSLIFSRRDEQVADT 84
A+LDAG+FP L + + DE+V D
Sbjct: 103 AVLDAGVFPHLLRLLTNTDEKVVDA 127
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15223823|ref|NP_175546.1| armadillo/beta-catenin-like repeats-containing protein [Arabidopsis thaliana] gi|20260482|gb|AAM13139.1| unknown protein [Arabidopsis thaliana] gi|30725506|gb|AAP37775.1| At1g51350 [Arabidopsis thaliana] gi|332194533|gb|AEE32654.1| armadillo/beta-catenin-like repeats-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297847504|ref|XP_002891633.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297337475|gb|EFH67892.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 151 | ||||||
| TAIR|locus:2008246 | 666 | AT1G51350 "AT1G51350" [Arabido | 0.218 | 0.049 | 0.558 | 1.6e-06 |
| TAIR|locus:2008246 AT1G51350 "AT1G51350" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 97 (39.2 bits), Expect = 1.6e-06, Sum P(2) = 1.6e-06
Identities = 19/34 (55%), Positives = 25/34 (73%)
Query: 51 FTCGFEA-IQAMLDAGLFPDLSLIFSRRDEQVAD 83
F CGFEA +QA+LDAG+FP L + + DE+V D
Sbjct: 93 FACGFEAGVQAVLDAGVFPHLLRLLTNTDEKVVD 126
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
No confident hit detected by STRING
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 99.16 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 97.87 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.31 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 97.14 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.02 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 96.1 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 94.22 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 93.58 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 93.46 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 92.91 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 92.24 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 91.91 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 90.26 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 85.61 |
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.16 E-value=2e-11 Score=113.78 Aligned_cols=80 Identities=21% Similarity=0.137 Sum_probs=73.4
Q ss_pred chhHHhhhhhhhcccchhHhHHHHhh--hhhh-h----------------cccccccChHH-HHHHHhcCChHHHHhhhc
Q 041564 16 SSRLNNRLKNQIIGSQTKKLSFLKKL--YRLI-L----------------PPSRFTCGFEA-IQAMLDAGLFPDLSLIFS 75 (151)
Q Consensus 16 s~rAlr~IKNqIIGNntKKlsfI~lG--PrlI-L----------------VLGSFAcG~Ea-VkaLLdaGvvP~Ll~lLs 75 (151)
-+||+...||++||++++|..+|+.| |++. | ++||+++|.++ ++++++++.+|+|+++|+
T Consensus 26 lvrai~~~kN~vig~~~~K~~~ik~GAv~~Ll~L~s~e~~s~~~k~~~~~llns~f~~eqd~v~svL~~~~ll~Ll~LLs 105 (678)
T KOG1293|consen 26 LVRAIYMSKNLVIGFTDNKETNIKLGAVELLLALLSLEDGSTELKNGFAVLLNSLFLGEQDKVDSVLRIIELLKLLQLLS 105 (678)
T ss_pred HHHHHHHhcchhhcCCCccchhhhhcchHHHHhhccccCCchhhhhhHHHHHHhHHhhccchHHHHHHHhhHHHHHHHhc
Confidence 47999999999999999999999999 5422 2 99999999999 999999999999999999
Q ss_pred cCC-HHHHHHHHHHHHHhccc
Q 041564 76 RRD-EQVADTMLLCKAEAGGM 95 (151)
Q Consensus 76 ~~D-~KVVEAcLRcLr~~~~~ 95 (151)
.+| .+++|+++||+|..=-+
T Consensus 106 ~sD~~~~le~~l~~lR~Ifet 126 (678)
T KOG1293|consen 106 ESDSLNVLEKTLRCLRTIFET 126 (678)
T ss_pred CcchHhHHHHHHHHHHHHHhc
Confidence 999 99999999999987544
|
|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 98.1 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 97.91 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.84 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.78 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 97.77 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.74 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.68 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.53 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 97.52 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 97.42 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 97.41 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 97.3 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.2 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 97.15 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.07 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.04 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 97.03 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.02 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 96.93 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 96.84 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 96.81 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 96.77 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 96.75 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 96.09 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 95.53 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 95.51 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 95.37 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 95.13 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 94.99 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 94.88 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 94.85 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 94.85 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 94.64 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 94.53 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 93.44 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 91.51 |
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
Probab=98.10 E-value=8e-06 Score=57.42 Aligned_cols=79 Identities=23% Similarity=0.301 Sum_probs=70.0
Q ss_pred chhHHhhhhhhhcccchhHhHHHHhh--hhhh--h-------------cccccccChHH-HHHHHhcCChHHHHhhhccC
Q 041564 16 SSRLNNRLKNQIIGSQTKKLSFLKKL--YRLI--L-------------PPSRFTCGFEA-IQAMLDAGLFPDLSLIFSRR 77 (151)
Q Consensus 16 s~rAlr~IKNqIIGNntKKlsfI~lG--PrlI--L-------------VLGSFAcG~Ea-VkaLLdaGvvP~Ll~lLs~~ 77 (151)
+..|...|.|-..++...+..+++.| |.++ | +||.++.+.++ .+.+++.|++|.|+.+|.++
T Consensus 29 ~~~a~~~L~~l~~~~~~~~~~i~~~g~i~~L~~lL~~~~~~v~~~a~~~L~~l~~~~~~~~~~i~~~g~i~~L~~lL~~~ 108 (210)
T 4db6_A 29 LQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSP 108 (210)
T ss_dssp HHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHTTCS
T ss_pred HHHHHHHHHHHHcCCHHHHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHhcCCcHHHHHHHHCCCHHHHHHHHcCC
Confidence 45678899999989999999999988 6533 2 89999999888 89999999999999999999
Q ss_pred CHHHHHHHHHHHHHhcc
Q 041564 78 DEQVADTMLLCKAEAGG 94 (151)
Q Consensus 78 D~KVVEAcLRcLr~~~~ 94 (151)
|+.+.+.++.+|..++.
T Consensus 109 ~~~v~~~a~~~L~~l~~ 125 (210)
T 4db6_A 109 NEQILQEALWALSNIAS 125 (210)
T ss_dssp CHHHHHHHHHHHHHHTT
T ss_pred cHHHHHHHHHHHHHHHc
Confidence 99999999999998874
|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.48 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 96.86 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 96.85 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 96.45 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 96.36 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 96.03 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 95.49 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 95.46 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 87.39 |
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Plakophilin 1 helical region domain: Plakophilin 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.76 E-value=2.7e-05 Score=54.37 Aligned_cols=79 Identities=4% Similarity=-0.025 Sum_probs=67.3
Q ss_pred chhHHhhhhhhhcccchhHhHHHHhh--hhhh--h-------------cccccccChHH-HHHHHhcCChHHHHhhhc-c
Q 041564 16 SSRLNNRLKNQIIGSQTKKLSFLKKL--YRLI--L-------------PPSRFTCGFEA-IQAMLDAGLFPDLSLIFS-R 76 (151)
Q Consensus 16 s~rAlr~IKNqIIGNntKKlsfI~lG--PrlI--L-------------VLGSFAcG~Ea-VkaLLdaGvvP~Ll~lLs-~ 76 (151)
...|.+.|+|.-.||..-|..+++.| |.++ | +|+.++.+.++ -+.+.++|++|.|+.++. .
T Consensus 19 ~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~i~~~g~v~~li~~l~~~ 98 (457)
T d1xm9a1 19 QAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRT 98 (457)
T ss_dssp HHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHHHTTC
T ss_pred HHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCChHHHHHHHhcc
Confidence 45679999999999999999999999 7644 2 78888877777 788999999999999885 4
Q ss_pred CCHHHHHHHHHHHHHhcc
Q 041564 77 RDEQVADTMLLCKAEAGG 94 (151)
Q Consensus 77 ~D~KVVEAcLRcLr~~~~ 94 (151)
.++.+.+.++.++.....
T Consensus 99 ~~~~~~~~a~~~l~~l~~ 116 (457)
T d1xm9a1 99 GNAEIQKQLTGLLWNLSS 116 (457)
T ss_dssp CCHHHHHHHHHHHHHHHT
T ss_pred CcHHHHHHHHHHHHHHHh
Confidence 588899999999988764
|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|