Citrus Sinensis ID: 041741


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------75
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYSLG
cccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEHHHHHHHHHcccccccccHHHcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHcHHHccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccc
cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccc
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQhlfdkmphkdiyswNAILSAQCKSDDLEFAYKLFdempernvVSWNNLISALVRNGLEEKALSVYNKmsnegfvpTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKcgwtkhavpvfeemsepnevTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVcaregcgvesdvfaqsdnkfsrnvhgqqvhcLTIKLGFEADLHLSNSLLDMyakngdmdsaEVIFsnlpersvVSWNVMIAGYGQKYQSTKAIELLQRMkscgfepdevTSINMLVACVrsgdiktgremfdsmpspsvssWNAMLSSYSQSENHKEAIKLFREMqfrgvkpdrTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERvfhripeldivCWNSMiaglslnsLDIEAFMFFKQMrqnemyptqfSFATVLSSCAKLSSSFQGRQVHAQIekdgyvndIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIasgvkpddiTFVAILTACSHSGLVDVGVEIFNSmqldhgvepildHYTCMIdclgraghfheaemlidempckddpVIWEVLLSSCRLHANVRLAKRAAEELfrldpknsapySLLANIYSSLGRWDDLRAVRELMSencivkdpayslg
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELfrldpknsapySLLANIYSSLGRWDDLRAVRELMsencivkdpayslg
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAvsidsvslssvlgvCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYSLG
****VAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDI**********************************IKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVK*******
*KAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYSL*
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYSLG
*KAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDP*YSLG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAILSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYSLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query748 2.2.26 [Sep-21-2011]
Q9SVH0774 Pentatricopeptide repeat- yes no 0.986 0.953 0.548 0.0
Q9FWA6903 Pentatricopeptide repeat- no no 0.966 0.800 0.334 1e-130
Q9SS831028 Pentatricopeptide repeat- no no 0.965 0.702 0.329 1e-122
Q9SVP7 1064 Pentatricopeptide repeat- no no 0.922 0.648 0.312 1e-116
Q9SMZ2 990 Pentatricopeptide repeat- no no 0.939 0.710 0.308 1e-114
Q9CA56895 Pentatricopeptide repeat- no no 0.895 0.748 0.324 1e-113
Q9SVA5834 Pentatricopeptide repeat- no no 0.913 0.818 0.316 1e-113
Q7Y211 890 Pentatricopeptide repeat- no no 0.856 0.720 0.333 1e-111
Q9LFL5 850 Pentatricopeptide repeat- no no 0.889 0.782 0.327 1e-110
Q0WN60 970 Pentatricopeptide repeat- no no 0.909 0.701 0.305 1e-108
>sp|Q9SVH0|PP329_ARATH Pentatricopeptide repeat-containing protein At4g20770 OS=Arabidopsis thaliana GN=PCMP-E35 PE=3 SV=2 Back     alignment and function desciption
 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/750 (54%), Positives = 560/750 (74%), Gaps = 12/750 (1%)

Query: 1   KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAI 60
           ++  ++GK++H  I+R G+  DT+LCNRL++LY +C +   A+ +FD+M  +D+YSWNA 
Sbjct: 19  ERCKLSGKVIHGFIVRMGMKSDTYLCNRLLDLYIECGDGDYARKVFDEMSVRDVYSWNAF 78

Query: 61  LSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTH 120
           L+ +CK  DL  A ++FD MPER+VVSWNN+IS LVR G EEKAL VY +M  +GF+P+ 
Sbjct: 79  LTFRCKVGDLGEACEVFDGMPERDVVSWNNMISVLVRKGFEEKALVVYKRMVCDGFLPSR 138

Query: 121 ITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGW-TKHAVPVFE 179
            TLASV  A + +LD   G RCHG+ +K GLDKNI+V NALLS+YAKCG+   + V VFE
Sbjct: 139 FTLASVLSACSKVLDGVFGMRCHGVAVKTGLDKNIFVGNALLSMYAKCGFIVDYGVRVFE 198

Query: 180 EMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCA-REGCGV 238
            +S+PNEV++TA++ GLA+ ++V+EA++MFRLM  K V +DSV LS++L + A REGC  
Sbjct: 199 SLSQPNEVSYTAVIGGLARENKVLEAVQMFRLMCEKGVQVDSVCLSNILSISAPREGCDS 258

Query: 239 ESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNL 298
            S+++         N  G+Q+HCL ++LGF  DLHL+NSLL++YAKN DM+ AE+IF+ +
Sbjct: 259 LSEIYG--------NELGKQIHCLALRLGFGGDLHLNNSLLEIYAKNKDMNGAELIFAEM 310

Query: 299 PERSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGR 358
           PE +VVSWN+MI G+GQ+Y+S K++E L RM+  GF+P+EVT I++L AC RSGD++TGR
Sbjct: 311 PEVNVVSWNIMIVGFGQEYRSDKSVEFLTRMRDSGFQPNEVTCISVLGACFRSGDVETGR 370

Query: 359 EMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMG 418
            +F S+P PSVS+WNAMLS YS  E+++EAI  FR+MQF+ +KPD+TTL++ILSSCA + 
Sbjct: 371 RIFSSIPQPSVSAWNAMLSGYSNYEHYEEAISNFRQMQFQNLKPDKTTLSVILSSCARLR 430

Query: 419 ILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHR-IPELDIVCWNSMI 477
            LE GKQ+H   ++T    ++++ SGLI +YS+C++ E++E +F   I ELDI CWNSMI
Sbjct: 431 FLEGGKQIHGVVIRTEISKNSHIVSGLIAVYSECEKMEISECIFDDCINELDIACWNSMI 490

Query: 478 AGLSLNSLDIEAFMFFKQMRQNE-MYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGY 536
           +G   N LD +A + F++M Q   + P + SFATVLSSC++L S   GRQ H  + K GY
Sbjct: 491 SGFRHNMLDTKALILFRRMHQTAVLCPNETSFATVLSSCSRLCSLLHGRQFHGLVVKSGY 550

Query: 537 VNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKD 596
           V+D FV +AL +MYCKCG+I  ARQFFD +  KNTV WNEMIHGY  NG GDEAV LY+ 
Sbjct: 551 VSDSFVETALTDMYCKCGEIDSARQFFDAVLRKNTVIWNEMIHGYGHNGRGDEAVGLYRK 610

Query: 597 MIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAG 656
           MI+SG KPD ITFV++LTACSHSGLV+ G+EI +SMQ  HG+EP LDHY C++DCLGRAG
Sbjct: 611 MISSGEKPDGITFVSVLTACSHSGLVETGLEILSSMQRIHGIEPELDHYICIVDCLGRAG 670

Query: 657 HFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLAN 716
              +AE L +  P K   V+WE+LLSSCR+H +V LA+R AE+L RLDP++SA Y LL+N
Sbjct: 671 RLEDAEKLAEATPYKSSSVLWEILLSSCRVHGDVSLARRVAEKLMRLDPQSSAAYVLLSN 730

Query: 717 IYSSLGRWDDLRAVRELMSENCIVKDPAYS 746
            YSSL +WDD  A++ LM++N + K P  S
Sbjct: 731 TYSSLRQWDDSAALQGLMNKNRVHKTPGQS 760





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=3 SV=1 Back     alignment and function description
>sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protein At1g74600, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E69 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description
>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query748
359483750847 PREDICTED: pentatricopeptide repeat-cont 0.994 0.878 0.714 0.0
297740913768 unnamed protein product [Vitis vinifera] 0.955 0.930 0.687 0.0
356495733770 PREDICTED: pentatricopeptide repeat-cont 0.987 0.959 0.632 0.0
357481329831 Pentatricopeptide repeat-containing prot 0.990 0.891 0.631 0.0
334186756774 pentatricopeptide repeat-containing prot 0.986 0.953 0.548 0.0
297799986760 predicted protein [Arabidopsis lyrata su 0.966 0.951 0.556 0.0
255586231617 pentatricopeptide repeat-containing prot 0.799 0.969 0.693 0.0
5262217740 putative protein [Arabidopsis thaliana] 0.963 0.974 0.553 0.0
357136755805 PREDICTED: pentatricopeptide repeat-cont 0.969 0.900 0.526 0.0
49387750803 putative pentatricopeptide (PPR) repeat- 0.957 0.891 0.521 0.0
>gi|359483750|ref|XP_002269533.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/746 (71%), Positives = 622/746 (83%), Gaps = 2/746 (0%)

Query: 1   KKAHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPHKDIYSWNAI 60
           KKAH+AGKL+HAH+LR+ L DDTFL NRLIE Y+KCN   +++ LFD+MP +DIY+WNAI
Sbjct: 18  KKAHLAGKLIHAHMLRSRLSDDTFLSNRLIEFYAKCNAIDASRRLFDQMPKRDIYTWNAI 77

Query: 61  LSAQCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTH 120
           L A CK+ +LE A+ LF EMPERN+VSWN LISAL RNG E+KAL VY +MS EGFVPTH
Sbjct: 78  LGAYCKASELEDAHVLFAEMPERNIVSWNTLISALTRNGFEQKALGVYYRMSREGFVPTH 137

Query: 121 ITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEE 180
            TLASV  A  AL+DVE GRRCHG+ IKIGLD NIYV NALL +YAKC     A+  F +
Sbjct: 138 FTLASVLSACGALVDVECGRRCHGISIKIGLDNNIYVGNALLGMYAKCRCIGDAIQAFGD 197

Query: 181 MSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVES 240
           + EPNEV+FTAMM GLA +D+V EA  +FRLM+R  + +DSVSLSSVLGVC+R GCG   
Sbjct: 198 VPEPNEVSFTAMMGGLADSDQVNEAFRLFRLMLRNRIHVDSVSLSSVLGVCSRGGCGEFG 257

Query: 241 DVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPE 300
                S++  S +VHGQQVHCLTIK GFE+DLHL+NSLLDMYAKNG+MDSAE+IF N+PE
Sbjct: 258 --LHDSNDVLSSDVHGQQVHCLTIKHGFESDLHLNNSLLDMYAKNGNMDSAEMIFVNMPE 315

Query: 301 RSVVSWNVMIAGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREM 360
            SVVSWNVMIAGYGQK QS+KAIE LQRM+  GFEPDE+T +NMLVAC++SGDI+ GR+M
Sbjct: 316 VSVVSWNVMIAGYGQKSQSSKAIEYLQRMQYHGFEPDEITYVNMLVACIKSGDIEAGRQM 375

Query: 361 FDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGIL 420
           FD M SPS+SSWN +LS YSQ+ENHKEA+KLFREMQFR V PDRTTLAIILSS A M +L
Sbjct: 376 FDGMSSPSLSSWNTILSGYSQNENHKEAVKLFREMQFRSVHPDRTTLAIILSSLAGMMLL 435

Query: 421 ESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGL 480
           E G+QVHA S K     D Y+ASGLIG+YSKC + E+A+R+F RI ELDIVCWNSM+AGL
Sbjct: 436 EGGRQVHAVSQKAVFRTDIYLASGLIGMYSKCGKVEMAKRIFDRIAELDIVCWNSMMAGL 495

Query: 481 SLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDI 540
           SLNSLD EAF FFK+MR+  M+P+QFS+ATVLS CAKLSS  QGRQVH+QI ++GY+ND 
Sbjct: 496 SLNSLDKEAFTFFKKMREKGMFPSQFSYATVLSCCAKLSSLSQGRQVHSQIAREGYMNDA 555

Query: 541 FVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIAS 600
           FVGSALI+MY KCGD+  AR  FDMM GKNTVTWNEMIHGYAQNG GDEAV LY+DMI S
Sbjct: 556 FVGSALIDMYSKCGDVDAARWVFDMMLGKNTVTWNEMIHGYAQNGCGDEAVLLYEDMIGS 615

Query: 601 GVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHE 660
           G KPD ITFVA+LTACSHSGLVD G++IFNSMQ +HGVEP++DHYTC+ID LGRAG  HE
Sbjct: 616 GEKPDGITFVAVLTACSHSGLVDTGIKIFNSMQQEHGVEPLVDHYTCIIDSLGRAGRLHE 675

Query: 661 AEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSS 720
           AE+LID+MPCK DP+IWEVLLSSCR++A+V LA+RAAEELF LDP+NSAPY LLANIYSS
Sbjct: 676 AEVLIDKMPCKYDPIIWEVLLSSCRVYADVSLARRAAEELFHLDPQNSAPYVLLANIYSS 735

Query: 721 LGRWDDLRAVRELMSENCIVKDPAYS 746
           LGRWDD +AVRELMS N +VKDP YS
Sbjct: 736 LGRWDDAKAVRELMSYNQVVKDPGYS 761




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297740913|emb|CBI31095.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356495733|ref|XP_003516728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Glycine max] Back     alignment and taxonomy information
>gi|357481329|ref|XP_003610950.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512285|gb|AES93908.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|334186756|ref|NP_193809.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635629|sp|Q9SVH0.2|PP329_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g20770 gi|332658959|gb|AEE84359.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799986|ref|XP_002867877.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313713|gb|EFH44136.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255586231|ref|XP_002533770.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526307|gb|EEF28615.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|5262217|emb|CAB45843.1| putative protein [Arabidopsis thaliana] gi|7268873|emb|CAB79077.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357136755|ref|XP_003569969.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|49387750|dbj|BAD26238.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gi|218190136|gb|EEC72563.1| hypothetical protein OsI_05996 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query748
TAIR|locus:2119440 1064 AT4G13650 [Arabidopsis thalian 0.528 0.371 0.349 3.5e-113
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.537 0.482 0.369 2.8e-105
TAIR|locus:2103483 890 OTP84 "ORGANELLE TRANSCRIPT PR 0.525 0.441 0.374 5.8e-105
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.545 0.471 0.357 4.6e-103
TAIR|locus:2032840 937 AT1G16480 "AT1G16480" [Arabido 0.540 0.431 0.339 4.6e-101
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.546 0.551 0.393 2.9e-99
TAIR|locus:2140235 781 AT4G02750 [Arabidopsis thalian 0.609 0.583 0.369 5.4e-96
TAIR|locus:2007116787 AT1G69350 "AT1G69350" [Arabido 0.601 0.571 0.311 4.8e-95
TAIR|locus:2125899 990 AT4G33170 [Arabidopsis thalian 0.525 0.396 0.375 2.6e-94
TAIR|locus:2063771689 AT2G03380 [Arabidopsis thalian 0.622 0.676 0.336 1.7e-90
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 708 (254.3 bits), Expect = 3.5e-113, Sum P(3) = 3.5e-113
 Identities = 138/395 (34%), Positives = 227/395 (57%)

Query:   352 GDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIIL 411
             G + T  ++        V SW  M++ Y+Q     +A+  FR+M  RG++ D   L   +
Sbjct:   539 GKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVGLTNAV 598

Query:   412 SSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIV 471
             S+CA +  L+ G+Q+HA +  +    D    + L+ +YS+C + E +   F +    D +
Sbjct:   599 SACAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTEAGDNI 658

Query:   472 CWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQI 531
              WN++++G   +  + EA   F +M +  +    F+F + + + ++ ++  QG+QVHA I
Sbjct:   659 AWNALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAVI 718

Query:   532 EKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAV 591
              K GY ++  V +ALI MY KCG I  A + F  +  KN V+WN +I+ Y+++G+G EA+
Sbjct:   719 TKTGYDSETEVCNALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSEAL 778

Query:   592 RLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDC 651
               +  MI S V+P+ +T V +L+ACSH GLVD G+  F SM  ++G+ P  +HY C++D 
Sbjct:   779 DSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYVCVVDM 838

Query:   652 LGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPY 711
             L RAG    A+  I EMP K D ++W  LLS+C +H N+ + + AA  L  L+P++SA Y
Sbjct:   839 LTRAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPEDSATY 898

Query:   712 SLLANIYSSLGRWDDLRAVRELMSENCIVKDPAYS 746
              LL+N+Y+   +WD     R+ M E  + K+P  S
Sbjct:   899 VLLSNLYAVSKKWDARDLTRQKMKEKGVKKEPGQS 933


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007116 AT1G69350 "AT1G69350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063771 AT2G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SVH0PP329_ARATHNo assigned EC number0.5480.98660.9534yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query748
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-141
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-104
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-77
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-60
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-60
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-58
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-54
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-44
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-41
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-38
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-30
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-14
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-12
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-10
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-06
pfam0153531 pfam01535, PPR, PPR repeat 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.003
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  434 bits (1118), Expect = e-141
 Identities = 230/694 (33%), Positives = 365/694 (52%), Gaps = 55/694 (7%)

Query: 89  NNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIK 148
           N+ + AL  +G  E+AL +   M             ++F+       VE G R     + 
Sbjct: 55  NSQLRALCSHGQLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALS 114

Query: 149 IGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEM 208
                 + + NA+LS++ + G   HA  VF +M E +  ++  ++ G AK     EAL +
Sbjct: 115 SHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCL 174

Query: 209 FRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGF 268
           +  M+   V  D  +   VL       CG   D+             G++VH   ++ GF
Sbjct: 175 YHRMLWAGVRPDVYTFPCVL-----RTCGGIPDL-----------ARGREVHAHVVRFGF 218

Query: 269 EADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQSTKAIELLQR 328
           E D+ + N+L+ MY K GD+ SA ++F  +P R  +SWN MI+GY +  +  + +EL   
Sbjct: 219 ELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFT 278

Query: 329 MKSCGFEPDEVTSINMLVACVRSGDIKTGREM---------------------------- 360
           M+    +PD +T  +++ AC   GD + GREM                            
Sbjct: 279 MRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGS 338

Query: 361 -------FDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSS 413
                  F  M +    SW AM+S Y ++    +A++ +  M+   V PD  T+A +LS+
Sbjct: 339 WGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSA 398

Query: 414 CAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCW 473
           CA +G L+ G ++H  + +        VA+ LI +YSKC+  + A  VFH IPE D++ W
Sbjct: 399 CACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISW 458

Query: 474 NSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEK 533
            S+IAGL LN+   EA +FF+QM    + P   +    LS+CA++ +   G+++HA + +
Sbjct: 459 TSIIAGLRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLR 517

Query: 534 DGYVNDIFVGSALIEMYCKCGDI-YGARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVR 592
            G   D F+ +AL+++Y +CG + Y   QF    H K+ V+WN ++ GY  +G G  AV 
Sbjct: 518 TGIGFDGFLPNALLDLYVRCGRMNYAWNQF--NSHEKDVVSWNILLTGYVAHGKGSMAVE 575

Query: 593 LYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCL 652
           L+  M+ SGV PD++TF+++L ACS SG+V  G+E F+SM+  + + P L HY C++D L
Sbjct: 576 LFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLL 635

Query: 653 GRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYS 712
           GRAG   EA   I++MP   DP +W  LL++CR+H +V L + AA+ +F LDP +   Y 
Sbjct: 636 GRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYI 695

Query: 713 LLANIYSSLGRWDDLRAVRELMSENCIVKDPAYS 746
           LL N+Y+  G+WD++  VR+ M EN +  DP  S
Sbjct: 696 LLCNLYADAGKWDEVARVRKTMRENGLTVDPGCS 729


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 748
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.98
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
PRK11788389 tetratricopeptide repeat protein; Provisional 99.79
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.78
KOG2076895 consensus RNA polymerase III transcription factor 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.76
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
KOG2076895 consensus RNA polymerase III transcription factor 99.72
KOG2003 840 consensus TPR repeat-containing protein [General f 99.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.72
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.7
KOG2003 840 consensus TPR repeat-containing protein [General f 99.7
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.56
KOG0547606 consensus Translocase of outer mitochondrial membr 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.54
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.52
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.52
KOG1126638 consensus DNA-binding cell division cycle control 99.52
KOG1915677 consensus Cell cycle control protein (crooked neck 99.5
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.45
KOG1915677 consensus Cell cycle control protein (crooked neck 99.44
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.42
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.38
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.38
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.36
KOG0547606 consensus Translocase of outer mitochondrial membr 99.36
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.36
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.33
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.33
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.32
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.31
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.3
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.3
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.27
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.23
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.2
PRK12370553 invasion protein regulator; Provisional 99.18
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.17
PF1304150 PPR_2: PPR repeat family 99.17
KOG1129478 consensus TPR repeat-containing protein [General f 99.16
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.16
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.13
PRK12370553 invasion protein regulator; Provisional 99.13
KOG2376652 consensus Signal recognition particle, subunit Srp 99.12
PF1304150 PPR_2: PPR repeat family 99.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.11
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.11
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.09
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.05
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.04
PRK11189296 lipoprotein NlpI; Provisional 98.98
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.96
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.91
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.9
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.88
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.88
KOG1125579 consensus TPR repeat-containing protein [General f 98.84
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.81
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.8
PRK10370198 formate-dependent nitrite reductase complex subuni 98.79
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.73
PRK15359144 type III secretion system chaperone protein SscB; 98.71
PRK15359144 type III secretion system chaperone protein SscB; 98.69
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.67
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.66
PRK04841 903 transcriptional regulator MalT; Provisional 98.66
PLN02789320 farnesyltranstransferase 98.57
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.56
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.55
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.52
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.51
PRK10370198 formate-dependent nitrite reductase complex subuni 98.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.47
KOG1125579 consensus TPR repeat-containing protein [General f 98.45
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.45
PRK04841903 transcriptional regulator MalT; Provisional 98.45
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.43
PF1285434 PPR_1: PPR repeat 98.43
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.42
PF1285434 PPR_1: PPR repeat 98.41
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.4
KOG1128777 consensus Uncharacterized conserved protein, conta 98.39
PLN02789320 farnesyltranstransferase 98.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.37
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.34
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.3
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.29
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.27
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.25
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.2
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.17
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.17
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.17
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.17
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.16
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.12
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.08
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.06
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.03
PRK15331165 chaperone protein SicA; Provisional 97.98
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.95
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.94
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.94
KOG0553304 consensus TPR repeat-containing protein [General f 97.93
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.92
COG4700251 Uncharacterized protein conserved in bacteria cont 97.9
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.89
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.89
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.87
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.86
COG4700251 Uncharacterized protein conserved in bacteria cont 97.84
PF1337173 TPR_9: Tetratricopeptide repeat 97.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.81
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.77
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.76
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.73
KOG0553304 consensus TPR repeat-containing protein [General f 97.72
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.69
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.65
PF1343134 TPR_17: Tetratricopeptide repeat 97.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.6
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.52
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.51
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.51
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.48
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.46
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.45
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.45
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.44
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.41
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.4
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.39
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.37
PF1342844 TPR_14: Tetratricopeptide repeat 97.37
PRK10803263 tol-pal system protein YbgF; Provisional 97.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.34
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.34
PF12688120 TPR_5: Tetratrico peptide repeat 97.33
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.32
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.3
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.3
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.29
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.27
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.25
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.25
PF1337173 TPR_9: Tetratricopeptide repeat 97.24
PRK10803263 tol-pal system protein YbgF; Provisional 97.21
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.17
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.12
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.1
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.08
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.95
KOG20411189 consensus WD40 repeat protein [General function pr 96.92
PRK11906458 transcriptional regulator; Provisional 96.91
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.89
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.89
PF13512142 TPR_18: Tetratricopeptide repeat 96.87
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.86
PF12688120 TPR_5: Tetratrico peptide repeat 96.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.83
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.78
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.76
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.75
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.72
KOG4555175 consensus TPR repeat-containing protein [Function 96.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.67
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.61
COG3898531 Uncharacterized membrane-bound protein [Function u 96.59
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.56
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.56
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.54
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.49
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.36
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.35
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.31
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.29
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.27
PRK11619 644 lytic murein transglycosylase; Provisional 96.13
KOG4234271 consensus TPR repeat-containing protein [General f 95.98
KOG20411189 consensus WD40 repeat protein [General function pr 95.97
KOG1585308 consensus Protein required for fusion of vesicles 95.96
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.94
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.88
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.81
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.81
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.67
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.59
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.56
KOG1258577 consensus mRNA processing protein [RNA processing 95.56
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.54
PRK15331165 chaperone protein SicA; Provisional 95.53
PRK11906458 transcriptional regulator; Provisional 95.44
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.41
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.28
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.25
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.21
PF13512142 TPR_18: Tetratricopeptide repeat 94.96
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.84
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.69
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.66
KOG4555175 consensus TPR repeat-containing protein [Function 94.63
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.49
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.46
KOG1586288 consensus Protein required for fusion of vesicles 94.45
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.43
smart00299140 CLH Clathrin heavy chain repeat homology. 94.3
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.24
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.21
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.1
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.07
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.06
KOG3941406 consensus Intermediate in Toll signal transduction 94.06
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 93.92
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.88
PF1342844 TPR_14: Tetratricopeptide repeat 93.35
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.35
smart00299140 CLH Clathrin heavy chain repeat homology. 93.3
KOG1258 577 consensus mRNA processing protein [RNA processing 93.2
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.17
KOG3941 406 consensus Intermediate in Toll signal transduction 93.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.91
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.75
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.75
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.72
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.62
COG3629280 DnrI DNA-binding transcriptional activator of the 92.57
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.55
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.47
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.24
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.09
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.03
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.81
PRK09687280 putative lyase; Provisional 91.77
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.76
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.35
KOG2610 491 consensus Uncharacterized conserved protein [Funct 91.32
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.21
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.21
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 91.17
KOG1941 518 consensus Acetylcholine receptor-associated protei 91.14
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.06
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 91.03
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.68
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.44
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.25
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.07
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.56
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 89.26
KOG4648 536 consensus Uncharacterized conserved protein, conta 89.25
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.67
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.56
COG3947361 Response regulator containing CheY-like receiver a 88.55
PRK10941269 hypothetical protein; Provisional 88.48
COG3629280 DnrI DNA-binding transcriptional activator of the 88.47
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.33
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 88.22
PRK09687280 putative lyase; Provisional 88.19
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.18
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.13
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.09
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.96
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.91
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.85
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.81
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 87.77
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.72
KOG1586288 consensus Protein required for fusion of vesicles 87.67
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 87.66
KOG1585308 consensus Protein required for fusion of vesicles 87.56
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.53
KOG4234271 consensus TPR repeat-containing protein [General f 87.26
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.24
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 87.03
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.98
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 86.61
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.51
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.4
COG4455 273 ImpE Protein of avirulence locus involved in tempe 86.16
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 86.13
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.9
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.72
PRK12798421 chemotaxis protein; Reviewed 84.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.55
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.06
COG1747 711 Uncharacterized N-terminal domain of the transcrip 83.99
KOG4507 886 consensus Uncharacterized conserved protein, conta 83.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.59
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.08
KOG1550 552 consensus Extracellular protein SEL-1 and related 83.06
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.44
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 81.95
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.58
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.19
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.5e-91  Score=777.97  Aligned_cols=661  Identities=33%  Similarity=0.588  Sum_probs=638.8

Q ss_pred             cchhhhHHHHHHHHhCCCCCcchhhHHHHHHHccCCchhhhhhhhcCCC----CchhhhhHHHHHhhcCCChhHHHHhhc
Q 041741            3 AHVAGKLLHAHILRNGLFDDTFLCNRLIELYSKCNNTHSAQHLFDKMPH----KDIYSWNAILSAQCKSDDLEFAYKLFD   78 (748)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~----~~~~~~~~l~~~~~~~~~~~~a~~~~~   78 (748)
                      .+..|..++..+...|.+|+..+|..++.+|.+.+..+.|..++..+.+    ++...++.++..|++.|+++.|.++|+
T Consensus        66 ~~~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~  145 (857)
T PLN03077         66 QLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFG  145 (857)
T ss_pred             CHHHHHHHHHHHHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHHHh
Confidence            4678899999999999999999999999999999999999999987653    788899999999999999999999999


Q ss_pred             cCCCCCchhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCcchHHHHHHHhccccCcHHHhHHHHHHHHHCCCCcHhHH
Q 041741           79 EMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCHGLVIKIGLDKNIYVA  158 (748)
Q Consensus        79 ~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  158 (748)
                      +|++||..+|+.+|.+|++.|++++|+++|++|...|+.||..||+.++++|+..+++..+.+++..|.+.|+.|+..++
T Consensus       146 ~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~  225 (857)
T PLN03077        146 KMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVV  225 (857)
T ss_pred             cCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCChhhHHHHHhcCCCCCeehHHHHHHHHHcCCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhccCCCC
Q 041741          159 NALLSLYAKCGWTKHAVPVFEEMSEPNEVTFTAMMSGLAKTDRVVEALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGV  238 (748)
Q Consensus       159 ~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~t~~~ll~~~~~~~~~~  238 (748)
                      +.|+.+|+++|++++|.++|++|.+||..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.+|.+|+.     
T Consensus       226 n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~-----  300 (857)
T PLN03077        226 NALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACEL-----  300 (857)
T ss_pred             hHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHh-----
Confidence            999999999999999999999999999999999999999999999999999999999887777776666655544     


Q ss_pred             CcchhcccccccccccchhHHHHHHHHhcCCCchHHHHHHHHHHHhcCChhHHHHHhccCCCCCcccHHHHHHHHHhcCC
Q 041741          239 ESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAKNGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQ  318 (748)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~  318 (748)
                                                                                                   .|+
T Consensus       301 -----------------------------------------------------------------------------~g~  303 (857)
T PLN03077        301 -----------------------------------------------------------------------------LGD  303 (857)
T ss_pred             -----------------------------------------------------------------------------cCC
Confidence                                                                                         345


Q ss_pred             hhHHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCCHHHHHHHhccCCCCCcchHHHHHHHHHccCCHHHHHHHHHHHHHc
Q 041741          319 STKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPSPSVSSWNAMLSSYSQSENHKEAIKLFREMQFR  398 (748)
Q Consensus       319 ~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~  398 (748)
                      .+.+.+++..|.+.|+.||..+|+.++.+|++.|++++|.++|+.|..||..+|+.++.+|++.|++++|+++|++|.+.
T Consensus       304 ~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~  383 (857)
T PLN03077        304 ERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQD  383 (857)
T ss_pred             hHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHh
Confidence            56677888889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHhhHHHHHHHhhccCChHHHHHHHHHHHhhcCCchhHHHHHHHHHHHhcCChHHHHHHHhhCCCCCcchHHHHHH
Q 041741          399 GVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIA  478 (748)
Q Consensus       399 g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~  478 (748)
                      |+.||..||..++.+|++.|+++.+.++++.+.+.|..++..+++.++.+|++.|++++|.++|+++.++|+.+|+++|.
T Consensus       384 g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~  463 (857)
T PLN03077        384 NVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIA  463 (857)
T ss_pred             CCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCchHHHHHHHHHHHCCCCCCHHHHHHHHHhhcCCCCchhHHHHHHHHHHhCCCCchHHHHHHHHHHHhcCCHHH
Q 041741          479 GLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYG  558 (748)
Q Consensus       479 ~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  558 (748)
                      +|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|+.+.+.+++..+.+.|+.++..++++++.+|+++|++++
T Consensus       464 ~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~  542 (857)
T PLN03077        464 GLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNY  542 (857)
T ss_pred             HHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHH
Confidence            99999999999999999986 58999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhcCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHhcCCCChHHHHHHHHHhhhhhCC
Q 041741          559 ARQFFDMMHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDHGV  638 (748)
Q Consensus       559 A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~  638 (748)
                      |.++|+.+ .+|..+|++++.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|.+.|++++|.++|+.|....|+
T Consensus       543 A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi  621 (857)
T PLN03077        543 AWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSI  621 (857)
T ss_pred             HHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCC
Confidence            99999999 99999999999999999999999999999999999999999999999999999999999999999668999


Q ss_pred             CCChhHHHHHHHHHHhcCChHHHHHHHhhCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCcchHHHhHHH
Q 041741          639 EPILDHYTCMIDCLGRAGHFHEAEMLIDEMPCKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIY  718 (748)
Q Consensus       639 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~  718 (748)
                      .|+..+|..++++|.+.|++++|.+++++|+.+|+..+|..++.+|...|+.+.++.+.+++++++|+++..|..|+++|
T Consensus       622 ~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~y  701 (857)
T PLN03077        622 TPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLY  701 (857)
T ss_pred             CCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCChHHHHHHHHHHHhcCCCCCCCCCC
Q 041741          719 SSLGRWDDLRAVRELMSENCIVKDPAYSL  747 (748)
Q Consensus       719 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  747 (748)
                      ...|+|++|.++.+.|+++|++++||+||
T Consensus       702 a~~g~~~~a~~vr~~M~~~g~~k~~g~s~  730 (857)
T PLN03077        702 ADAGKWDEVARVRKTMRENGLTVDPGCSW  730 (857)
T ss_pred             HHCCChHHHHHHHHHHHHcCCCCCCCccE
Confidence            99999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query748
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 76.4 bits (186), Expect = 2e-14
 Identities = 26/188 (13%), Positives = 52/188 (27%), Gaps = 7/188 (3%)

Query: 494 KQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKC 553
              RQ    P +   A +L       S    +    Q  +           A  +     
Sbjct: 81  DCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLT 140

Query: 554 GDIYGARQFFDMMHGK-------NTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDD 606
             +  A     + HG+           +N ++ G+A+ G   E V +   +  +G+ PD 
Sbjct: 141 DQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDL 200

Query: 607 ITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLID 666
           +++ A L            +E         G++        ++    RA        +  
Sbjct: 201 LSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKP 260

Query: 667 EMPCKDDP 674
                   
Sbjct: 261 TFSLPPQL 268


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query748
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.6
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.54
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.52
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.47
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.45
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.44
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.43
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.37
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.31
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.29
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.26
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.25
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.18
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.13
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.07
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.07
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.02
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.01
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.0
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.99
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.98
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.95
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.92
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.91
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.87
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.83
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.75
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.66
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.64
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.61
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.59
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.59
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.59
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.59
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.58
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.57
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.57
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.56
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.53
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.44
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.44
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.42
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.42
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.41
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.4
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.38
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.36
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.32
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.32
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.28
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.27
3k9i_A117 BH0479 protein; putative protein binding protein, 98.27
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.27
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.16
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.16
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.15
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.14
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.13
3k9i_A117 BH0479 protein; putative protein binding protein, 98.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.11
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.1
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.05
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.02
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.99
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.97
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.96
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.92
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.92
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.9
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.89
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.88
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.87
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.81
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.74
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.62
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.59
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.54
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.49
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.41
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.37
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.31
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.22
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.2
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.99
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.97
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.93
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.85
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.79
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.59
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.54
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.36
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.3
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.13
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.83
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.69
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.35
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.21
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.18
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.82
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.34
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.33
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.12
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.11
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.65
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 93.52
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.34
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.96
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.94
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 90.87
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.66
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.58
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.36
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 90.33
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.47
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.1
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 88.56
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.74
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 85.52
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.94
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.43
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 82.59
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 82.54
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.75
2p58_C116 Putative type III secretion protein YSCG; type III 80.5
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.36
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.2e-38  Score=341.40  Aligned_cols=500  Identities=7%  Similarity=-0.049  Sum_probs=350.7

Q ss_pred             hhcCCChhHHHHhhccCCCCCchhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCcchHHHHHHHhccccCcHHHhHHH
Q 041741           64 QCKSDDLEFAYKLFDEMPERNVVSWNNLISALVRNGLEEKALSVYNKMSNEGFVPTHITLASVFKASTALLDVEHGRRCH  143 (748)
Q Consensus        64 ~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~  143 (748)
                      ....+.+..+...+..++.+++..|+.++..+.+.|++++|+.+|++|..  ..|+..++..+..++.+.|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45567777888888888888899999999999999999999999999985  5678889999999999999999999999


Q ss_pred             HHHHHHCCCCcHhHHHHHHHHHHhcCChhhHHHHHhcCCCC-------------------CeehHHHHHHHHHcCCCHHH
Q 041741          144 GLVIKIGLDKNIYVANALLSLYAKCGWTKHAVPVFEEMSEP-------------------NEVTFTAMMSGLAKTDRVVE  204 (748)
Q Consensus       144 ~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  204 (748)
                      +.+...  +++..+++.++.+|.+.|++++|.++|+++...                   +..+|+.++..|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            987543  678889999999999999999999999965432                   25567777777777777777


Q ss_pred             HHHHHHHHHHcCCCCCcccHHHHHHHHhccCCCCCcchhcccccccccccchhHHHHHHHHhcCCCchHHHHHHHHHHHh
Q 041741          205 ALEMFRLMIRKAVSIDSVSLSSVLGVCAREGCGVESDVFAQSDNKFSRNVHGQQVHCLTIKLGFEADLHLSNSLLDMYAK  284 (748)
Q Consensus       205 a~~~~~~m~~~g~~~~~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~  284 (748)
                      |+++|++|.+.+  |+..+.                                                            
T Consensus       219 A~~~~~~~~~~~--p~~~~~------------------------------------------------------------  236 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEA------------------------------------------------------------  236 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHH------------------------------------------------------------
T ss_pred             HHHHHHHHHHhC--chhhHH------------------------------------------------------------
Confidence            777777776542  221111                                                            


Q ss_pred             cCChhHHHHHhccCCCCCcccHHHHHHHHHhcCChh--HHHHH-HHHHHhcCCCCChhhHHHHHHHHHhcCCHHHHHHHh
Q 041741          285 NGDMDSAEVIFSNLPERSVVSWNVMIAGYGQKYQST--KAIEL-LQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMF  361 (748)
Q Consensus       285 ~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~--~a~~~-~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~  361 (748)
                                           +..+...+...+..+  .+..+ +..+...+..+...+|..++..|.+.|++++|.++|
T Consensus       237 ---------------------~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~  295 (597)
T 2xpi_A          237 ---------------------FDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYL  295 (597)
T ss_dssp             ---------------------HHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHH
T ss_pred             ---------------------HHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHH
Confidence                                 111111110000000  00011 233333333444445555566666777777777777


Q ss_pred             ccCCC--CCcchHHHHHHHHHccCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHhhccCChHHHHHHHHHHHhhcCCchh
Q 041741          362 DSMPS--PSVSSWNAMLSSYSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDN  439 (748)
Q Consensus       362 ~~~~~--~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~  439 (748)
                      +.+..  ++..+++.++..|.+.|++++|+++|+++.+.+  |+                                    
T Consensus       296 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~------------------------------------  337 (597)
T 2xpi_A          296 SSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID--PY------------------------------------  337 (597)
T ss_dssp             HTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TT------------------------------------
T ss_pred             HHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC--cc------------------------------------
Confidence            77765  666777777777777777777777777776542  11                                    


Q ss_pred             HHHHHHHHHHHhcCChHHHHHHHhhCCCCCcchHHHHHHHHHhCCCchHHHHHHHHHHHCCCCCCHHHHHHHHHhhcCCC
Q 041741          440 YVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLS  519 (748)
Q Consensus       440 ~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~  519 (748)
                                                   +..+++.++.++.+.|++++|..+++++.... +.+..++..++..|.+.|
T Consensus       338 -----------------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g  387 (597)
T 2xpi_A          338 -----------------------------NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVN  387 (597)
T ss_dssp             -----------------------------CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTT
T ss_pred             -----------------------------cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhc
Confidence                                         33344455555555555555555555555331 334555556666666666


Q ss_pred             CchhHHHHHHHHHHhCCCCchHHHHHHHHHHHhcCCHHHHHHHhhhcCC---CCHHHHHHHHHHHHHcCChhHHHHHHHH
Q 041741          520 SSFQGRQVHAQIEKDGYVNDIFVGSALIEMYCKCGDIYGARQFFDMMHG---KNTVTWNEMIHGYAQNGYGDEAVRLYKD  596 (748)
Q Consensus       520 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~  596 (748)
                      ++++|..+|+.+.+.. +.+..+++.++.+|.+.|++++|.++|+++.+   ++..+|..++.+|.+.|++++|.++|++
T Consensus       388 ~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  466 (597)
T 2xpi_A          388 KISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQS  466 (597)
T ss_dssp             CHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            6666666666665543 33566777888888888888888888887652   4778888899999999999999999999


Q ss_pred             HHHcCCCCCHHHHHHHHHHhcCCCChHHHHHHHHHhhhhh---CCCCC--hhHHHHHHHHHHhcCChHHHHHHHhhCC--
Q 041741          597 MIASGVKPDDITFVAILTACSHSGLVDVGVEIFNSMQLDH---GVEPI--LDHYTCMIDCLGRAGHFHEAEMLIDEMP--  669 (748)
Q Consensus       597 m~~~~~~p~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~---~~~~~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~--  669 (748)
                      +.+.. +.+..+|..++..|.+.|++++|+.+|+++....   +..|+  ..++..++.+|.+.|++++|.+.++++.  
T Consensus       467 ~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  545 (597)
T 2xpi_A          467 SYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLL  545 (597)
T ss_dssp             HHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHh
Confidence            98863 5567889999999999999999999999885332   55777  6789999999999999999999998875  


Q ss_pred             CCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCcchHHHhHHHhh
Q 041741          670 CKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSS  720 (748)
Q Consensus       670 ~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~  720 (748)
                      .+.++.+|..++..|...|++++|.+.++++++++|+++.++..++.+|..
T Consensus       546 ~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          546 STNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             SSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            445788999999999999999999999999999999999999999988854



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 748
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-07
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.0 bits (123), Expect = 1e-07
 Identities = 53/357 (14%), Positives = 115/357 (32%), Gaps = 17/357 (4%)

Query: 379 YSQSENHKEAIKLFREMQFRGVKPDRTTLAIILSSC-AAMGILESGKQVHAASLKTASHI 437
             Q+ + + A +   ++     +PD T + ++LSS       L+        ++K   + 
Sbjct: 9   EYQAGDFEAAERHCMQL--WRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NP 64

Query: 438 DNYVASGLIGIYSKCQRNELAERVFHRIPELDIVCWNSMIAGLSLNSLDIEAFMFFKQMR 497
               A   +G   K +         +R        +      L+   +         Q  
Sbjct: 65  LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 124

Query: 498 QNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYV--NDIFVGSALIEMYCKCGD 555
            + +      +         L +  +  +  A   K      N     S L  ++   G+
Sbjct: 125 VSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGE 184

Query: 556 IYGARQFFDM---MHGKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAI 612
           I+ A   F+    +       +  + +   +    D AV  Y   ++       +    +
Sbjct: 185 IWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHG-NL 243

Query: 613 LTACSHSGLVDVGVEIFN-SMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDE--MP 669
                  GL+D+ ++ +  +++L        D Y  + + L   G   EAE   +     
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQPH---FPDAYCNLANALKEKGSVAEAEDCYNTALRL 300

Query: 670 CKDDPVIWEVLLSSCRLHANVRLAKRAAEELFRLDPKNSAPYSLLANIYSSLGRWDD 726
           C         L +  R   N+  A R   +   + P+ +A +S LA++    G+  +
Sbjct: 301 CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQE 357


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query748
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.13
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.05
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.02
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.97
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.95
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.81
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.78
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.71
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.62
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.58
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.52
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.46
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.38
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.32
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.27
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.18
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.12
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.1
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.94
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.92
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.85
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.79
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.69
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.62
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.6
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.52
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.27
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.27
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.2
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.15
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.91
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.69
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.4
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.18
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.73
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.24
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.84
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.15
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 80.06
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=5.4e-20  Score=186.05  Aligned_cols=374  Identities=11%  Similarity=0.013  Sum_probs=257.6

Q ss_pred             HHHHhcCChhHHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCCHHHHHHHhccCCC---CCcchHHHHHHHHHccCCHHH
Q 041741          311 AGYGQKYQSTKAIELLQRMKSCGFEPDEVTSINMLVACVRSGDIKTGREMFDSMPS---PSVSSWNAMLSSYSQSENHKE  387 (748)
Q Consensus       311 ~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~---~~~~~~~~ll~~~~~~~~~~~  387 (748)
                      ..+.+.|++++|++.++++.+.. +-+...+..+..++...|++++|...|+...+   .+..++..+...+.+.|++++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccc
Confidence            44556677777777777766542 12344555555566666666666666665543   234456666677777777777


Q ss_pred             HHHHHHHHHHcCCCCCHhhHHHHHHHhhccCChHHHHHHHHHHHhhcCCchhHHHHHHHHHHHhcCChHHHHHHHhhCCC
Q 041741          388 AIKLFREMQFRGVKPDRTTLAIILSSCAAMGILESGKQVHAASLKTASHIDNYVASGLIGIYSKCQRNELAERVFHRIPE  467 (748)
Q Consensus       388 a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~  467 (748)
                      |+..+....+.. ..+..............+................                                .
T Consensus        86 A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------~  132 (388)
T d1w3ba_          86 AIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN--------------------------------P  132 (388)
T ss_dssp             HHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC--------------------------------T
T ss_pred             cccccccccccc-cccccccccccccccccccccccccccccccccc--------------------------------c
Confidence            777777766642 1222222222222222222222222222222211                                1


Q ss_pred             CCcchHHHHHHHHHhCCCchHHHHHHHHHHHCCCCCCHHHHHHHHHhhcCCCCchhHHHHHHHHHHhCCCCchHHHHHHH
Q 041741          468 LDIVCWNSMIAGLSLNSLDIEAFMFFKQMRQNEMYPTQFSFATVLSSCAKLSSSFQGRQVHAQIEKDGYVNDIFVGSALI  547 (748)
Q Consensus       468 ~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~  547 (748)
                      ................+....+...+....... +.+...+..+...+...|+++.|...+....+.. +.+...+..+.
T Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~  210 (388)
T d1w3ba_         133 DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLG  210 (388)
T ss_dssp             TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHH
T ss_pred             ccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHh
Confidence            122233334444455556666666666555442 3345566667777778888888888887777654 33566777888


Q ss_pred             HHHHhcCCHHHHHHHhhhcC---CCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCCHHHHHHHHHHhcCCCChHH
Q 041741          548 EMYCKCGDIYGARQFFDMMH---GKNTVTWNEMIHGYAQNGYGDEAVRLYKDMIASGVKPDDITFVAILTACSHSGLVDV  624 (748)
Q Consensus       548 ~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~  624 (748)
                      ..+...|++++|...++...   ..+...+..+...+...|++++|+..|+++.+.. +-+..++..+...+...|++++
T Consensus       211 ~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~  289 (388)
T d1w3ba_         211 NVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAE  289 (388)
T ss_dssp             HHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHH
T ss_pred             hhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHH
Confidence            88888899999988888755   3566778888899999999999999999999853 3445678888999999999999


Q ss_pred             HHHHHHHhhhhhCCCCChhHHHHHHHHHHhcCChHHHHHHHhhCC-CCC-CHhHHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 041741          625 GVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEMLIDEMP-CKD-DPVIWEVLLSSCRLHANVRLAKRAAEELFR  702 (748)
Q Consensus       625 A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~~-~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~  702 (748)
                      |+..++....  ..+.+...+..++.++...|++++|...+++.. ..| ++..+..++..+...|++++|...++++++
T Consensus       290 A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         290 AEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9999998743  234556778889999999999999999998875 344 577888899999999999999999999999


Q ss_pred             cCCCCCcchHHHhHHHhhcCC
Q 041741          703 LDPKNSAPYSLLANIYSSLGR  723 (748)
Q Consensus       703 ~~p~~~~~~~~l~~~~~~~g~  723 (748)
                      ++|+++.++..||.+|.+.||
T Consensus       368 l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         368 ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TCTTCHHHHHHHHHHHHHTCC
T ss_pred             hCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure