Citrus Sinensis ID: 042043
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 225426819 | 305 | PREDICTED: heat stress transcription fac | 0.925 | 0.367 | 0.555 | 7e-31 | |
| 289466351 | 305 | HSP transcription factor [Vitis pseudore | 0.925 | 0.367 | 0.555 | 1e-30 | |
| 297742579 | 306 | unnamed protein product [Vitis vinifera] | 0.909 | 0.359 | 0.548 | 2e-29 | |
| 147852112 | 477 | hypothetical protein VITISV_009283 [Viti | 0.925 | 0.234 | 0.555 | 3e-29 | |
| 449452366 | 341 | PREDICTED: heat stress transcription fac | 0.958 | 0.340 | 0.453 | 8e-23 | |
| 356539790 | 355 | PREDICTED: heat stress transcription fac | 0.966 | 0.329 | 0.456 | 2e-22 | |
| 255537353 | 337 | Heat shock factor protein, putative [Ric | 0.966 | 0.347 | 0.496 | 3e-21 | |
| 402715723 | 339 | heat shock transcription factor HSFB2b [ | 0.983 | 0.351 | 0.471 | 3e-21 | |
| 671866 | 298 | heat shock transcription factor 29 [Glyc | 0.983 | 0.399 | 0.471 | 3e-21 | |
| 356497218 | 355 | PREDICTED: heat stress transcription fac | 0.983 | 0.335 | 0.471 | 3e-21 |
| >gi|225426819|ref|XP_002283139.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 137 bits (346), Expect = 7e-31, Method: Compositional matrix adjust.
Identities = 75/135 (55%), Positives = 94/135 (69%), Gaps = 23/135 (17%)
Query: 2 PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDEL--- 58
PE+L ENE+LR+EN+QL EL+QL+GLCNNILALMTNYA+GQ+D +PEG+ +D L
Sbjct: 174 PEILEENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQIDAGGIPEGRPLDLLTER 233
Query: 59 ---------------DLTPRLFGVSIGAKCARREEEEEQNQLQQQQGENEPGSDVKSEPL 103
DL+PRLFGVSIG K RR+EEEE + Q Q + +VKSEPL
Sbjct: 234 QLPVEAGQSGVKAEGDLSPRLFGVSIGVKRVRRDEEEESEKEAQTQQQ-----EVKSEPL 288
Query: 104 DANNDHHQEPPWLEL 118
D ++DHHQ+PPWLEL
Sbjct: 289 DGSSDHHQDPPWLEL 303
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|289466351|gb|ADC94861.1| HSP transcription factor [Vitis pseudoreticulata] | Back alignment and taxonomy information |
|---|
| >gi|297742579|emb|CBI34728.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147852112|emb|CAN82265.1| hypothetical protein VITISV_009283 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449452366|ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] gi|449534034|ref|XP_004173974.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356539790|ref|XP_003538376.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255537353|ref|XP_002509743.1| Heat shock factor protein, putative [Ricinus communis] gi|223549642|gb|EEF51130.1| Heat shock factor protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|402715723|gb|AFQ93675.1| heat shock transcription factor HSFB2b [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|671866|emb|CAA87075.1| heat shock transcription factor 29 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497218|ref|XP_003517459.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| TAIR|locus:2139792 | 377 | AT-HSFB2B [Arabidopsis thalian | 0.471 | 0.151 | 0.534 | 3.5e-20 | |
| TAIR|locus:2174043 | 299 | HSFB2A "AT5G62020" [Arabidopsi | 0.495 | 0.200 | 0.475 | 1.3e-09 |
| TAIR|locus:2139792 AT-HSFB2B [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 144 (55.7 bits), Expect = 3.5e-20, Sum P(2) = 3.5e-20
Identities = 31/58 (53%), Positives = 40/58 (68%)
Query: 2 PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSL-PEGKTVDEL 58
PEL+ ENE+LRK+N +L E+++LKGL NI LM N+ GQ D L PEGK +D L
Sbjct: 227 PELVEENERLRKDNERLRKEMTKLKGLYANIYTLMANFTPGQEDCAHLLPEGKPLDLL 284
|
|
| TAIR|locus:2174043 HSFB2A "AT5G62020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| PF07407 | 420 | Seadorna_VP6: Seadornavirus VP6 protein; InterPro: | 94.33 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 92.26 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 90.53 | |
| PRK14872 | 337 | rod shape-determining protein MreC; Provisional | 89.7 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 89.16 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 89.07 | |
| PF08961 | 243 | DUF1875: Domain of unknown function (DUF1875); Int | 88.86 | |
| PF07334 | 76 | IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 | 88.09 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 87.94 | |
| PF02344 | 32 | Myc-LZ: Myc leucine zipper domain; InterPro: IPR00 | 87.8 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 87.75 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 86.79 | |
| PF14645 | 116 | Chibby: Chibby family | 86.73 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 85.84 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 84.56 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 83.4 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 82.97 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 82.93 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 82.85 |
| >PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus | Back alignment and domain information |
|---|
Probab=94.33 E-value=0.034 Score=48.86 Aligned_cols=25 Identities=40% Similarity=0.462 Sum_probs=22.6
Q ss_pred CcchhhhHHHHHhhHHHHHHHHHHH
Q 042043 2 PELLGENEKLRKENAQLNNELSQLK 26 (121)
Q Consensus 2 a~L~eENerLRkeN~~L~~ELa~mK 26 (121)
.+|.+||++|||||..|..||++++
T Consensus 35 ~aLr~EN~~LKkEN~~Lk~eVerLE 59 (420)
T PF07407_consen 35 FALRMENHSLKKENNDLKIEVERLE 59 (420)
T ss_pred hhHHHHhHHHHHHHHHHHHHHHHHH
Confidence 4689999999999999999999873
|
Members of this family are typically of around 420 residues in length. The function of this family is unknown. |
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PRK14872 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF08961 DUF1875: Domain of unknown function (DUF1875); InterPro: IPR015056 MIT can be found in the Nuclear receptor-binding factor 2, it has no known function | Back alignment and domain information |
|---|
| >PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF02344 Myc-LZ: Myc leucine zipper domain; InterPro: IPR003327 This family consists of the leucine zipper dimerisation domain found in both cellular c-Myc proto-oncogenes and viral v-Myc oncogenes | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF14645 Chibby: Chibby family | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 92.56 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 92.45 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 92.13 | |
| 2j5u_A | 255 | MREC protein; bacterial cell shape determining pro | 91.78 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 88.1 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 85.93 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 85.63 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 84.97 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 84.55 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 84.25 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 82.93 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 82.05 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 82.04 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 80.84 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 80.7 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 80.41 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 80.29 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 80.05 |
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=92.56 E-value=0.05 Score=37.59 Aligned_cols=27 Identities=52% Similarity=0.694 Sum_probs=16.2
Q ss_pred cchhhhHHHHHhhHHHHHHHHHHHHHH
Q 042043 3 ELLGENEKLRKENAQLNNELSQLKGLC 29 (121)
Q Consensus 3 ~L~eENerLRkeN~~L~~ELa~mKklC 29 (121)
.|..||.+||.+...|..|+..+|.+.
T Consensus 47 ~Le~EN~~Lr~~v~~L~~E~~~Lr~ll 73 (87)
T 1hjb_A 47 ELTAENERLQKKVEQLSRELSTLRNLF 73 (87)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 355666666666666666666665543
|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00