Citrus Sinensis ID: 042043


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MPELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIGAKCARREEEEEQNQLQQQQGENEPGSDVKSEPLDANNDHHQEPPWLELGKS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHccccccEcEEEEcEEEcccccccccccccccccccccccccccccccccccccccccHHHcccc
mpellgenEKLRKENAQLNNELSQLKGLCNNILALMTNyasgqldnvslpegktvdeldltprlfgvsigakcarREEEEEQNQLQQqqgenepgsdvksepldanndhhqeppwlelgks
MPELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIGAKCARREEEEEQNQlqqqqgenepgsdVKSEpldanndhhqeppwlelgks
MPELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIGAKCARReeeeeqnqlqqqqgenePGSDVKSEPLDANNDHHQEPPWLELGKS
***********************QLKGLCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIG***************************************************
**ELL**NEKLRKENAQLNNELSQLKGLCNNILALMTN*************************LFGVSIGA*******************************************WLEL***
********EKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIGAKCA*************************SEPLDANNDHHQEPPWLELGKS
*PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASG*L**********VDELDLTPRLFGVSIGAKCA***********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxCNNILALMTNYASGQLDNVSLPEGKTVDELDLTPRLFGVSIGxxxxxxxxxxxxxxxxxxxxxNEPGSDVKSEPLDANNDHHQEPPWLELGKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q9T0D3377 Heat stress transcription yes no 0.966 0.310 0.431 1e-20
Q9SCW4299 Heat stress transcription no no 0.801 0.324 0.353 2e-11
Q6Z9C8390 Heat stress transcription yes no 0.727 0.225 0.333 1e-08
Q652B0454 Heat stress transcription no no 0.826 0.220 0.328 1e-07
Q7XRX3305 Heat stress transcription no no 0.553 0.219 0.361 3e-05
>sp|Q9T0D3|HFB2B_ARATH Heat stress transcription factor B-2b OS=Arabidopsis thaliana GN=HSFB2B PE=2 SV=1 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 85/153 (55%), Gaps = 36/153 (23%)

Query: 2   PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVS-LPEGKTVDEL-- 58
           PEL+ ENE+LRK+N +L  E+++LKGL  NI  LM N+  GQ D    LPEGK +D L  
Sbjct: 227 PELVEENERLRKDNERLRKEMTKLKGLYANIYTLMANFTPGQEDCAHLLPEGKPLDLLPE 286

Query: 59  -----------------------DLTPRLFGVSIGAKCARR--------EEEEEQNQLQQ 87
                                  DLTPRLFGVSIG K ARR        EE++++ +   
Sbjct: 287 RQEMSEAIMASEIETGIGLKLGEDLTPRLFGVSIGVKRARREEELGAAEEEDDDRREAAA 346

Query: 88  QQGENEPGSDVKSEPLDANNDHHQEPPWLELGK 120
           Q+GE    SDVK+EP++ NN  +    WLELGK
Sbjct: 347 QEGEQ--SSDVKAEPMEENNSGNHNGSWLELGK 377




Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SCW4|HFB2A_ARATH Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1 Back     alignment and function description
>sp|Q6Z9C8|HFB2B_ORYSJ Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1 Back     alignment and function description
>sp|Q652B0|HFB2C_ORYSJ Heat stress transcription factor B-2c OS=Oryza sativa subsp. japonica GN=HSFB2C PE=2 SV=1 Back     alignment and function description
>sp|Q7XRX3|HFB2A_ORYSJ Heat stress transcription factor B-2a OS=Oryza sativa subsp. japonica GN=HSFB2A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
225426819 305 PREDICTED: heat stress transcription fac 0.925 0.367 0.555 7e-31
289466351 305 HSP transcription factor [Vitis pseudore 0.925 0.367 0.555 1e-30
297742579 306 unnamed protein product [Vitis vinifera] 0.909 0.359 0.548 2e-29
147852112 477 hypothetical protein VITISV_009283 [Viti 0.925 0.234 0.555 3e-29
449452366 341 PREDICTED: heat stress transcription fac 0.958 0.340 0.453 8e-23
356539790 355 PREDICTED: heat stress transcription fac 0.966 0.329 0.456 2e-22
255537353 337 Heat shock factor protein, putative [Ric 0.966 0.347 0.496 3e-21
402715723 339 heat shock transcription factor HSFB2b [ 0.983 0.351 0.471 3e-21
671866 298 heat shock transcription factor 29 [Glyc 0.983 0.399 0.471 3e-21
356497218 355 PREDICTED: heat stress transcription fac 0.983 0.335 0.471 3e-21
>gi|225426819|ref|XP_002283139.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera] Back     alignment and taxonomy information
 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 94/135 (69%), Gaps = 23/135 (17%)

Query: 2   PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSLPEGKTVDEL--- 58
           PE+L ENE+LR+EN+QL  EL+QL+GLCNNILALMTNYA+GQ+D   +PEG+ +D L   
Sbjct: 174 PEILEENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQIDAGGIPEGRPLDLLTER 233

Query: 59  ---------------DLTPRLFGVSIGAKCARREEEEEQNQLQQQQGENEPGSDVKSEPL 103
                          DL+PRLFGVSIG K  RR+EEEE  +  Q Q +     +VKSEPL
Sbjct: 234 QLPVEAGQSGVKAEGDLSPRLFGVSIGVKRVRRDEEEESEKEAQTQQQ-----EVKSEPL 288

Query: 104 DANNDHHQEPPWLEL 118
           D ++DHHQ+PPWLEL
Sbjct: 289 DGSSDHHQDPPWLEL 303




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|289466351|gb|ADC94861.1| HSP transcription factor [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|297742579|emb|CBI34728.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852112|emb|CAN82265.1| hypothetical protein VITISV_009283 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452366|ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] gi|449534034|ref|XP_004173974.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356539790|ref|XP_003538376.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine max] Back     alignment and taxonomy information
>gi|255537353|ref|XP_002509743.1| Heat shock factor protein, putative [Ricinus communis] gi|223549642|gb|EEF51130.1| Heat shock factor protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|402715723|gb|AFQ93675.1| heat shock transcription factor HSFB2b [Glycine max] Back     alignment and taxonomy information
>gi|671866|emb|CAA87075.1| heat shock transcription factor 29 [Glycine max] Back     alignment and taxonomy information
>gi|356497218|ref|XP_003517459.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2139792377 AT-HSFB2B [Arabidopsis thalian 0.471 0.151 0.534 3.5e-20
TAIR|locus:2174043299 HSFB2A "AT5G62020" [Arabidopsi 0.495 0.200 0.475 1.3e-09
TAIR|locus:2139792 AT-HSFB2B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 3.5e-20, Sum P(2) = 3.5e-20
 Identities = 31/58 (53%), Positives = 40/58 (68%)

Query:     2 PELLGENEKLRKENAQLNNELSQLKGLCNNILALMTNYASGQLDNVSL-PEGKTVDEL 58
             PEL+ ENE+LRK+N +L  E+++LKGL  NI  LM N+  GQ D   L PEGK +D L
Sbjct:   227 PELVEENERLRKDNERLRKEMTKLKGLYANIYTLMANFTPGQEDCAHLLPEGKPLDLL 284


GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0010200 "response to chitin" evidence=IEP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2174043 HSFB2A "AT5G62020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 94.33
PRK13922276 rod shape-determining protein MreC; Provisional 92.26
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 90.53
PRK14872 337 rod shape-determining protein MreC; Provisional 89.7
smart0033865 BRLZ basic region leucin zipper. 89.16
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 89.07
PF08961243 DUF1875: Domain of unknown function (DUF1875); Int 88.86
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 88.09
PRK13169110 DNA replication intiation control protein YabA; Re 87.94
PF0234432 Myc-LZ: Myc leucine zipper domain; InterPro: IPR00 87.8
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 87.75
KOG4196135 consensus bZIP transcription factor MafK [Transcri 86.79
PF14645116 Chibby: Chibby family 86.73
KOG3119269 consensus Basic region leucine zipper transcriptio 85.84
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 84.56
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 83.4
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 82.97
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 82.93
smart0033865 BRLZ basic region leucin zipper. 82.85
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
Probab=94.33  E-value=0.034  Score=48.86  Aligned_cols=25  Identities=40%  Similarity=0.462  Sum_probs=22.6

Q ss_pred             CcchhhhHHHHHhhHHHHHHHHHHH
Q 042043            2 PELLGENEKLRKENAQLNNELSQLK   26 (121)
Q Consensus         2 a~L~eENerLRkeN~~L~~ELa~mK   26 (121)
                      .+|.+||++|||||..|..||++++
T Consensus        35 ~aLr~EN~~LKkEN~~Lk~eVerLE   59 (420)
T PF07407_consen   35 FALRMENHSLKKENNDLKIEVERLE   59 (420)
T ss_pred             hhHHHHhHHHHHHHHHHHHHHHHHH
Confidence            4689999999999999999999873



Members of this family are typically of around 420 residues in length. The function of this family is unknown.

>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK14872 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF08961 DUF1875: Domain of unknown function (DUF1875); InterPro: IPR015056 MIT can be found in the Nuclear receptor-binding factor 2, it has no known function Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF02344 Myc-LZ: Myc leucine zipper domain; InterPro: IPR003327 This family consists of the leucine zipper dimerisation domain found in both cellular c-Myc proto-oncogenes and viral v-Myc oncogenes Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PF14645 Chibby: Chibby family Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 92.56
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 92.45
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 92.13
2j5u_A 255 MREC protein; bacterial cell shape determining pro 91.78
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 88.1
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 85.93
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 85.63
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 84.97
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 84.55
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 84.25
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 82.93
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 82.05
2wt7_B90 Transcription factor MAFB; transcription, transcri 82.04
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 80.84
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 80.7
3m48_A33 General control protein GCN4; leucine zipper, synt 80.41
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 80.29
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 80.05
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
Probab=92.56  E-value=0.05  Score=37.59  Aligned_cols=27  Identities=52%  Similarity=0.694  Sum_probs=16.2

Q ss_pred             cchhhhHHHHHhhHHHHHHHHHHHHHH
Q 042043            3 ELLGENEKLRKENAQLNNELSQLKGLC   29 (121)
Q Consensus         3 ~L~eENerLRkeN~~L~~ELa~mKklC   29 (121)
                      .|..||.+||.+...|..|+..+|.+.
T Consensus        47 ~Le~EN~~Lr~~v~~L~~E~~~Lr~ll   73 (87)
T 1hjb_A           47 ELTAENERLQKKVEQLSRELSTLRNLF   73 (87)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            355666666666666666666665543



>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00