Citrus Sinensis ID: 042154


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MSFPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFPSEE
cccHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccEEEcccc
cHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEccc
msfpsrllscsfsttatatgpkfiGSVIRGIYKENNLKRLVDKFkkssdlgrfrtntgiyTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVfdempgrnceQTVLSFNALLGacvnskkfdevdglfkdlphklgiepdlvSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLlgfysngrfadAEKIWETMVNMnvrpnvrsynarldGLAIEKQTKKALELVGEmrskeinpdvFTFYALIKGFVNEGNLEEAKRWYnksgcgmnKAIFKLLVPFVCEKGDLDFAFNLCKrtfserclvdqapLQLVVDRLAKELRVEEAKELVELgktnsycrynlkfpsee
msfpsrllscsfsttatatgpkfigsVIRGIYKENNLKRLVDkfkkssdlgrfrtntgiytgtvqrLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGemrskeinpdVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSerclvdqaplQLVVDRLAKELRVEEAKelvelgktnsycrynlkfpsee
MSFPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFPSEE
********SCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLK*****
**FPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFP***
MSFPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFPSEE
MSFPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFPSE*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFPSRLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYNLKFPSEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query377 2.2.26 [Sep-21-2011]
Q9LK57394 Pentatricopeptide repeat- yes no 0.978 0.936 0.52 1e-105
Q9LG23398 Pentatricopeptide repeat- no no 0.989 0.937 0.507 1e-102
Q9LK58 551 Pentatricopeptide repeat- no no 0.960 0.656 0.427 2e-78
Q8GW57397 Pentatricopeptide repeat- no no 0.928 0.881 0.301 2e-43
Q8LE47408 Pentatricopeptide repeat- no no 0.862 0.796 0.316 8e-43
Q9ZU67418 Pentatricopeptide repeat- no no 0.782 0.705 0.345 3e-42
Q9M065412 Pentatricopeptide repeat- no no 0.912 0.834 0.292 8e-41
Q9SAB4405 Pentatricopeptide repeat- no no 0.872 0.812 0.297 8e-37
Q9FFE3 535 Pentatricopeptide repeat- no no 0.843 0.594 0.257 3e-29
Q9FJE6 907 Putative pentatricopeptid no no 0.875 0.363 0.247 1e-28
>sp|Q9LK57|PP226_ARATH Pentatricopeptide repeat-containing protein At3g13160, mitochondrial OS=Arabidopsis thaliana GN=At3g13160 PE=1 SV=1 Back     alignment and function desciption
 Score =  381 bits (978), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 260/375 (69%), Gaps = 6/375 (1%)

Query: 6   RLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQ 65
           R  S   +  AT + PK   S+I  +  E + K + +KFKK+     FR N  +Y  TV+
Sbjct: 22  RFFSAVTAAAATPSPPK--PSLITLVNDERDPKFITEKFKKACQAEWFRKNIAVYERTVR 79

Query: 66  RLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQ 125
           RLA AK+F W+EEILE Q +Y ++SKEGF AR+I LYG+  MFENA+KVFDEMP RNC++
Sbjct: 80  RLAAAKKFEWVEEILEEQNKYPNMSKEGFVARIINLYGRVGMFENAQKVFDEMPERNCKR 139

Query: 126 TVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTL 185
           T LSFNALL ACVNSKKFD V+G+FK+LP KL IEPD+ SYNT+IK    KGS   A  L
Sbjct: 140 TALSFNALLNACVNSKKFDLVEGIFKELPGKLSIEPDVASYNTLIKGLCGKGSFTEAVAL 199

Query: 186 LYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAI 245
           + E+E KG++ D ITFN LL   Y+ G+F + E+IW  MV  NV+ ++RSYNARL GLA+
Sbjct: 200 IDEIENKGLKPDHITFNILLHESYTKGKFEEGEQIWARMVEKNVKRDIRSYNARLLGLAM 259

Query: 246 EKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWY---NKSGCGMNKAI 302
           E ++++ + L  +++  E+ PDVFTF A+IKGFV+EG L+EA  WY    K+GC   K +
Sbjct: 260 ENKSEEMVSLFDKLKGNELKPDVFTFTAMIKGFVSEGKLDEAITWYKEIEKNGCRPLKFV 319

Query: 303 FKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGK 362
           F  L+P +C+ GDL+ A+ LCK  F++R LVD+A LQ VVD L K  + +EA+E+VEL K
Sbjct: 320 FNSLLPAICKAGDLESAYELCKEIFAKRLLVDEAVLQEVVDALVKGSKQDEAEEIVELAK 379

Query: 363 TNSYCRYNLK-FPSE 376
           TN Y +  L+ FP E
Sbjct: 380 TNDYLQCKLRLFPKE 394





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LG23|PPR82_ARATH Pentatricopeptide repeat-containing protein At1g55890, mitochondrial OS=Arabidopsis thaliana GN=At1g55890 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK58|PP225_ARATH Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW57|PP134_ARATH Pentatricopeptide repeat-containing protein At1g80150, mitochondrial OS=Arabidopsis thaliana GN=At1g80150 PE=2 SV=2 Back     alignment and function description
>sp|Q8LE47|PPR87_ARATH Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZU67|PP162_ARATH Pentatricopeptide repeat-containing protein At2g18520, mitochondrial OS=Arabidopsis thaliana GN=At2g18520 PE=2 SV=1 Back     alignment and function description
>sp|Q9M065|PP352_ARATH Pentatricopeptide repeat-containing protein At4g36680, mitochondrial OS=Arabidopsis thaliana GN=At4g36680 PE=1 SV=1 Back     alignment and function description
>sp|Q9SAB4|PPR33_ARATH Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=1 SV=1 Back     alignment and function description
>sp|Q9FFE3|PP388_ARATH Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
255555097377 pentatricopeptide repeat-containing prot 0.981 0.981 0.621 1e-124
359496226382 PREDICTED: pentatricopeptide repeat-cont 1.0 0.986 0.594 1e-118
359496216383 PREDICTED: pentatricopeptide repeat-cont 1.0 0.984 0.592 1e-118
224076660381 predicted protein [Populus trichocarpa] 0.994 0.984 0.584 1e-118
388512253376 unknown [Medicago truncatula] 0.984 0.986 0.568 1e-118
147791424383 hypothetical protein VITISV_005999 [Viti 1.0 0.984 0.587 1e-116
296090624379 unnamed protein product [Vitis vinifera] 0.915 0.910 0.602 1e-114
356521277379 PREDICTED: pentatricopeptide repeat-cont 0.973 0.968 0.566 1e-114
356524760381 PREDICTED: pentatricopeptide repeat-cont 0.938 0.929 0.571 1e-111
224114227396 predicted protein [Populus trichocarpa] 0.992 0.944 0.551 1e-109
>gi|255555097|ref|XP_002518586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542431|gb|EEF43973.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/378 (62%), Positives = 281/378 (74%), Gaps = 8/378 (2%)

Query: 1   MSFPSRLLS--CSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTG 58
           M+F  RLLS  CS ST  T TG     S ++ +YKE NLKRLV+KFKK S+  RFRT TG
Sbjct: 1   MAFVIRLLSRTCSTSTQLT-TGTAARASSVKVLYKERNLKRLVEKFKKFSENDRFRTKTG 59

Query: 59  IYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEM 118
           IY  T++RLA AKRF WIEEILE QK+YKDI KEG+ ARLI LYGK+ MF+N+RKVFDEM
Sbjct: 60  IYEETIRRLAIAKRFNWIEEILEDQKKYKDIHKEGYNARLIRLYGKSNMFDNSRKVFDEM 119

Query: 119 PGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGS 178
           P RNC++TV+SFNALL ACV SKKFDEVDGLF+ LP +L I+PD VSYNT+IK + + G+
Sbjct: 120 PDRNCKRTVVSFNALLAACVTSKKFDEVDGLFRKLPKELEIKPDTVSYNTVIKGYCEMGA 179

Query: 179 LDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNA 238
           LD A +LL EME KG   DLITFNTLL GFYSNG F D E+IW  MV  ++ P++RSYNA
Sbjct: 180 LDKAISLLVEMEMKGNPPDLITFNTLLNGFYSNGLFVDGERIWSQMVQKSIVPDIRSYNA 239

Query: 239 RLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWY----NKS 294
           +L GLA+ K+TK A+ L+ EM+SK I PDV +F ALIKGFV E NLEEAK WY    N  
Sbjct: 240 KLLGLALVKRTKDAVLLLQEMKSKGIKPDVISFNALIKGFVKEENLEEAKYWYCETRNSG 299

Query: 295 G-CGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEE 353
           G CG +K  F  L+PFVCEKGDL FAF L K   S +CLVD A L+ VV+ L KE ++++
Sbjct: 300 GDCGPDKFTFTTLIPFVCEKGDLRFAFELSKDVISRKCLVDMALLKCVVEGLVKESKIQD 359

Query: 354 AKELVELGKTNSYCRYNL 371
           A ELV+LG  N YCRY L
Sbjct: 360 ANELVKLGMNNGYCRYQL 377




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359496226|ref|XP_003635182.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496216|ref|XP_002268636.2| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224076660|ref|XP_002304977.1| predicted protein [Populus trichocarpa] gi|222847941|gb|EEE85488.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388512253|gb|AFK44188.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147791424|emb|CAN76851.1| hypothetical protein VITISV_005999 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090624|emb|CBI41008.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356521277|ref|XP_003529283.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356524760|ref|XP_003530996.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|224114227|ref|XP_002316702.1| predicted protein [Populus trichocarpa] gi|222859767|gb|EEE97314.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
TAIR|locus:2090034394 AT3G13160 [Arabidopsis thalian 0.978 0.936 0.52 5.8e-98
TAIR|locus:2012120398 AT1G55890 [Arabidopsis thalian 0.960 0.909 0.517 5.3e-95
TAIR|locus:2090014 551 AT3G13150 "AT3G13150" [Arabido 0.960 0.656 0.427 1.7e-73
TAIR|locus:2036833408 PPR336 "pentatricopeptide repe 0.944 0.872 0.303 2.4e-44
TAIR|locus:2016249397 AT1G80150 "AT1G80150" [Arabido 0.867 0.823 0.315 5.2e-42
TAIR|locus:2046288418 AT2G18520 [Arabidopsis thalian 0.787 0.710 0.347 8.4e-42
TAIR|locus:2115375412 AT4G36680 [Arabidopsis thalian 0.923 0.844 0.292 1.2e-40
TAIR|locus:2027387405 AT1G11630 [Arabidopsis thalian 0.872 0.812 0.297 6.1e-39
TAIR|locus:2171352 535 AT5G16420 "AT5G16420" [Arabido 0.843 0.594 0.257 3.4e-30
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.692 0.349 0.283 1.2e-29
TAIR|locus:2090034 AT3G13160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 973 (347.6 bits), Expect = 5.8e-98, P = 5.8e-98
 Identities = 195/375 (52%), Positives = 260/375 (69%)

Query:     6 RLLSCSFSTTATATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQ 65
             R  S   +  AT + PK   S+I  +  E + K + +KFKK+     FR N  +Y  TV+
Sbjct:    22 RFFSAVTAAAATPSPPK--PSLITLVNDERDPKFITEKFKKACQAEWFRKNIAVYERTVR 79

Query:    66 RLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAAMFENARKVFDEMPGRNCEQ 125
             RLA AK+F W+EEILE Q +Y ++SKEGF AR+I LYG+  MFENA+KVFDEMP RNC++
Sbjct:    80 RLAAAKKFEWVEEILEEQNKYPNMSKEGFVARIINLYGRVGMFENAQKVFDEMPERNCKR 139

Query:   126 TVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTL 185
             T LSFNALL ACVNSKKFD V+G+FK+LP KL IEPD+ SYNT+IK    KGS   A  L
Sbjct:   140 TALSFNALLNACVNSKKFDLVEGIFKELPGKLSIEPDVASYNTLIKGLCGKGSFTEAVAL 199

Query:   186 LYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAI 245
             + E+E KG++ D ITFN LL   Y+ G+F + E+IW  MV  NV+ ++RSYNARL GLA+
Sbjct:   200 IDEIENKGLKPDHITFNILLHESYTKGKFEEGEQIWARMVEKNVKRDIRSYNARLLGLAM 259

Query:   246 EKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYN---KSGCGMNKAI 302
             E ++++ + L  +++  E+ PDVFTF A+IKGFV+EG L+EA  WY    K+GC   K +
Sbjct:   260 ENKSEEMVSLFDKLKGNELKPDVFTFTAMIKGFVSEGKLDEAITWYKEIEKNGCRPLKFV 319

Query:   303 FKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGK 362
             F  L+P +C+ GDL+ A+ LCK  F++R LVD+A LQ VVD L K  + +EA+E+VEL K
Sbjct:   320 FNSLLPAICKAGDLESAYELCKEIFAKRLLVDEAVLQEVVDALVKGSKQDEAEEIVELAK 379

Query:   363 TNSYCRYNLK-FPSE 376
             TN Y +  L+ FP E
Sbjct:   380 TNDYLQCKLRLFPKE 394




GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2012120 AT1G55890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090014 AT3G13150 "AT3G13150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036833 PPR336 "pentatricopeptide repeat 336" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016249 AT1G80150 "AT1G80150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046288 AT2G18520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115375 AT4G36680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027387 AT1G11630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171352 AT5G16420 "AT5G16420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LK57PP226_ARATHNo assigned EC number0.520.97870.9365yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00008258001
SubName- Full=Chromosome undetermined scaffold_1327, whole genome shotgun sequence; (382 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-13
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-07
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-04
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.001
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.001
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 78.8 bits (194), Expect = 9e-16
 Identities = 58/246 (23%), Positives = 111/246 (45%), Gaps = 6/246 (2%)

Query: 126 TVLSFNALLGACVNSKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTL 185
           T+ +FN L+  C +S+  D    + + L  + G++ D   Y T+I      G +D+   +
Sbjct: 436 TLSTFNMLMSVCASSQDIDGALRVLR-LVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV 494

Query: 186 LYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAI 245
            +EM   G+  ++ TF  L+ G    G+ A A   +  M + NV+P+   +NA +     
Sbjct: 495 FHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQ 554

Query: 246 EKQTKKALELVGEMR--SKEINPDVFTFYALIKGFVNEGNLEEAKRWYN---KSGCGMNK 300
                +A +++ EM+  +  I+PD  T  AL+K   N G ++ AK  Y    +       
Sbjct: 555 SGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTP 614

Query: 301 AIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVEL 360
            ++ + V    +KGD DFA ++      +    D+     +VD       +++A E+++ 
Sbjct: 615 EVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQD 674

Query: 361 GKTNSY 366
            +    
Sbjct: 675 ARKQGI 680


Length = 1060

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 377
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
KOG2076 895 consensus RNA polymerase III transcription factor 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.72
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.71
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.7
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.69
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.69
KOG2076 895 consensus RNA polymerase III transcription factor 99.67
KOG1126638 consensus DNA-binding cell division cycle control 99.66
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
KOG0547606 consensus Translocase of outer mitochondrial membr 99.63
KOG1126638 consensus DNA-binding cell division cycle control 99.62
KOG2003 840 consensus TPR repeat-containing protein [General f 99.62
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.61
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.6
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.6
KOG1129478 consensus TPR repeat-containing protein [General f 99.59
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.58
KOG2003 840 consensus TPR repeat-containing protein [General f 99.57
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.55
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.55
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.54
PRK12370553 invasion protein regulator; Provisional 99.53
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.52
PRK12370553 invasion protein regulator; Provisional 99.52
KOG1129478 consensus TPR repeat-containing protein [General f 99.51
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.48
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.43
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.43
PF1304150 PPR_2: PPR repeat family 99.42
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.42
PF1304150 PPR_2: PPR repeat family 99.41
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.38
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.37
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.36
PRK11189296 lipoprotein NlpI; Provisional 99.35
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.33
PRK11189296 lipoprotein NlpI; Provisional 99.32
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.28
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.25
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.24
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.22
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.17
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.17
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.17
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.16
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.15
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.14
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.13
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.13
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.12
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.1
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.09
PRK04841 903 transcriptional regulator MalT; Provisional 99.06
KOG1125579 consensus TPR repeat-containing protein [General f 99.01
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.98
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.98
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.94
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.92
KOG1125579 consensus TPR repeat-containing protein [General f 98.92
PRK04841 903 transcriptional regulator MalT; Provisional 98.91
PLN02789320 farnesyltranstransferase 98.9
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 98.88
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.87
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.87
PF1285434 PPR_1: PPR repeat 98.86
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.86
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.82
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.82
PF1285434 PPR_1: PPR repeat 98.82
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.81
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.8
KOG1128777 consensus Uncharacterized conserved protein, conta 98.8
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.79
PLN02789320 farnesyltranstransferase 98.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.77
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.76
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.71
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.7
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.67
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.67
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.67
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.64
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.63
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.61
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.61
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.6
PRK15359144 type III secretion system chaperone protein SscB; 98.59
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.57
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.54
PRK15359144 type III secretion system chaperone protein SscB; 98.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.51
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.48
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.48
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.43
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.43
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.42
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.39
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.38
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.34
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.32
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.31
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.3
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.28
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.25
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.25
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.24
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.23
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.21
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.15
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.14
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.1
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.09
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.07
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.05
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.04
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.98
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.98
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.97
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.95
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.94
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.93
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.93
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.91
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.9
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.88
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.86
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.85
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.85
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.84
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.84
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.83
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.82
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.81
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.78
KOG0553304 consensus TPR repeat-containing protein [General f 97.77
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.75
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.67
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.61
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.6
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.59
KOG0553304 consensus TPR repeat-containing protein [General f 97.59
COG4700251 Uncharacterized protein conserved in bacteria cont 97.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.58
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.56
PF12688120 TPR_5: Tetratrico peptide repeat 97.56
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.55
PRK15331165 chaperone protein SicA; Provisional 97.54
PF12688120 TPR_5: Tetratrico peptide repeat 97.51
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.43
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.4
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.39
PF1337173 TPR_9: Tetratricopeptide repeat 97.39
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.32
KOG20411189 consensus WD40 repeat protein [General function pr 97.29
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.28
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.28
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.26
PRK10803263 tol-pal system protein YbgF; Provisional 97.19
PRK10803263 tol-pal system protein YbgF; Provisional 97.17
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.16
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.14
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.1
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.1
COG4700251 Uncharacterized protein conserved in bacteria cont 97.1
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 97.04
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.02
PF1337173 TPR_9: Tetratricopeptide repeat 97.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.95
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.92
PRK15331165 chaperone protein SicA; Provisional 96.91
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.88
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.85
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.82
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.8
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.79
COG3898531 Uncharacterized membrane-bound protein [Function u 96.7
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.65
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.63
KOG3941 406 consensus Intermediate in Toll signal transduction 96.55
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.53
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.52
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.45
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.43
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.39
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.37
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.36
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.23
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.11
smart00299140 CLH Clathrin heavy chain repeat homology. 96.11
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.11
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.1
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.04
PF1342844 TPR_14: Tetratricopeptide repeat 96.04
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.03
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.0
PF1342844 TPR_14: Tetratricopeptide repeat 95.98
KOG4555175 consensus TPR repeat-containing protein [Function 95.96
smart00299140 CLH Clathrin heavy chain repeat homology. 95.93
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.9
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.89
KOG1585308 consensus Protein required for fusion of vesicles 95.86
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.86
KOG3941 406 consensus Intermediate in Toll signal transduction 95.8
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.79
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.75
KOG1585308 consensus Protein required for fusion of vesicles 95.71
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.68
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.61
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.55
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.54
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.49
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.41
KOG4555175 consensus TPR repeat-containing protein [Function 95.27
PRK11906458 transcriptional regulator; Provisional 95.27
PF13512142 TPR_18: Tetratricopeptide repeat 95.2
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.06
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.99
PF1343134 TPR_17: Tetratricopeptide repeat 94.83
COG3629280 DnrI DNA-binding transcriptional activator of the 94.78
PF13512142 TPR_18: Tetratricopeptide repeat 94.64
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.49
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.47
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.46
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.44
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.3
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.29
COG3629280 DnrI DNA-binding transcriptional activator of the 94.28
PRK11906458 transcriptional regulator; Provisional 94.23
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.17
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.16
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.1
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.08
KOG4570 418 consensus Uncharacterized conserved protein [Funct 94.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.02
KOG1550552 consensus Extracellular protein SEL-1 and related 93.71
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.67
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.58
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.46
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.39
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 93.12
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.12
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.99
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 92.89
KOG1258 577 consensus mRNA processing protein [RNA processing 92.83
PF13929292 mRNA_stabil: mRNA stabilisation 92.57
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.57
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.48
KOG1550552 consensus Extracellular protein SEL-1 and related 92.39
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.38
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.35
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.17
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.15
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.97
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.96
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.69
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.62
PF1343134 TPR_17: Tetratricopeptide repeat 91.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.51
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.4
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.84
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.49
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.26
KOG4234271 consensus TPR repeat-containing protein [General f 90.24
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 90.21
KOG1258 577 consensus mRNA processing protein [RNA processing 90.17
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.06
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 89.64
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.46
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.31
PF13929292 mRNA_stabil: mRNA stabilisation 89.25
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.07
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.71
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.69
COG4455273 ImpE Protein of avirulence locus involved in tempe 88.67
COG4455273 ImpE Protein of avirulence locus involved in tempe 88.39
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.19
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.02
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.93
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 87.77
PRK09687280 putative lyase; Provisional 87.26
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.69
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.43
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.42
COG5159 421 RPN6 26S proteasome regulatory complex component [ 86.39
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 86.36
KOG0687 393 consensus 26S proteasome regulatory complex, subun 86.32
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 85.62
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.31
KOG1586288 consensus Protein required for fusion of vesicles 84.97
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.6
PF13170297 DUF4003: Protein of unknown function (DUF4003) 83.63
COG1747 711 Uncharacterized N-terminal domain of the transcrip 83.58
COG3947361 Response regulator containing CheY-like receiver a 83.44
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 82.98
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.93
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 81.98
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 81.61
KOG4234271 consensus TPR repeat-containing protein [General f 81.43
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 81.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.23
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 81.02
PRK11619 644 lytic murein transglycosylase; Provisional 80.93
KOG4507886 consensus Uncharacterized conserved protein, conta 80.73
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.63
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.29
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.7e-59  Score=438.02  Aligned_cols=351  Identities=15%  Similarity=0.214  Sum_probs=341.9

Q ss_pred             CCchHHHHHHHHhhhcccHHHHHHHHHhcccCCCCccchhhHHHHHHHHHhcCChHHHHHHHHHhhhhcCCCccchhHHH
Q 042154           19 TGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARL   98 (377)
Q Consensus        19 ~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l   98 (377)
                      |+..+|+.++.+|++.|+++.|.++|+.|.+.| +.||..+|+.+|.+|++.|++++|.++|++|.+.+..|+..+|+.+
T Consensus       435 pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~G-l~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaL  513 (1060)
T PLN03218        435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEAG-LKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGAL  513 (1060)
T ss_pred             CCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcC-CCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHH
Confidence            899999999999999999999999999999887 8999999999999999999999999999999999999999999999


Q ss_pred             HHHHHccCCHHHHHHHHHhcCCCCCCccHHHHHHHHHHHHhCCChhHHHHHHHhchhh-cCCCcCHHHHHHHHHHHHHcC
Q 042154           99 IALYGKAAMFENARKVFDEMPGRNCEQTVLSFNALLGACVNSKKFDEVDGLFKDLPHK-LGIEPDLVSYNTIIKAFVDKG  177 (377)
Q Consensus        99 ~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~-~~~~p~~~~~~~l~~~~~~~~  177 (377)
                      +.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|... .|+.||..+|+.++.+|++.|
T Consensus       514 I~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G  593 (1060)
T PLN03218        514 IDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAG  593 (1060)
T ss_pred             HHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCC
Confidence            9999999999999999999999999999999999999999999999999999999753 488999999999999999999


Q ss_pred             CHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHHcCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHH
Q 042154          178 SLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALELVG  257 (377)
Q Consensus       178 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~  257 (377)
                      ++++|.++|+.|.+.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.|++++|.++++
T Consensus       594 ~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~  673 (1060)
T PLN03218        594 QVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQ  673 (1060)
T ss_pred             CHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHH---hcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCC
Q 042154          258 EMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYN---KSGCGMNKAIFKLLVPFVCEKGDLDFAFNLCKRTFSERCLVD  334 (377)
Q Consensus       258 ~~~~~g~~p~~~~~~~l~~~~~~~~~~~~a~~~~~---~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~  334 (377)
                      +|.+.|+.||..+|+.|+.+|++.|++++|.++|+   ..++.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||
T Consensus       674 eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd  753 (1060)
T PLN03218        674 DARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPN  753 (1060)
T ss_pred             HHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCC
Confidence            99999999999999999999999999999999999   678999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHhcCCHHHHHHHHHhhccCCceeee
Q 042154          335 QAPLQLVVDRLAKELRVEEAKELVELGKTNSYCRYN  370 (377)
Q Consensus       335 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~  370 (377)
                      ..||+.++.+|++.|++++|.+++++|.+.|+.+..
T Consensus       754 ~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~  789 (1060)
T PLN03218        754 TITYSILLVASERKDDADVGLDLLSQAKEDGIKPNL  789 (1060)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCH
Confidence            999999999999999999999999999999986643



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 81.0 bits (198), Expect = 1e-16
 Identities = 35/233 (15%), Positives = 74/233 (31%), Gaps = 5/233 (2%)

Query: 140 SKKFDEVDGLFKDLPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLL---YEMEKKGIRL 196
            K   +V+        +  +           K  +    L  A+ LL   +   +K   L
Sbjct: 104 GKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLL 163

Query: 197 DLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKALE-L 255
            L  +N ++LG+   G F +   +   + +  + P++ SY A L  +  + Q    +E  
Sbjct: 164 TLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERC 223

Query: 256 VGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYNKSGCGMNKAIFKLLVPFVCEKGD 315
           + +M  + +         L+        L+   +                    + +   
Sbjct: 224 LEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYA 283

Query: 316 LDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSYCR 368
            D   +  K     + L      QL ++ LA  + V   ++     K   + R
Sbjct: 284 KDGRVSYPKLHLPLKTLQCLFEKQLHME-LASRVCVVSVEKPTLPSKEVKHAR 335


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.87
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.86
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.85
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.85
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.82
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.78
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.75
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.73
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.73
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
3u4t_A272 TPR repeat-containing protein; structural genomics 99.72
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.7
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.7
3u4t_A272 TPR repeat-containing protein; structural genomics 99.69
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.69
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.67
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.67
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.66
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.65
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.63
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.62
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.62
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.6
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.59
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.59
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.58
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.58
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.58
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.57
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.54
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.52
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.43
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.38
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.37
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.36
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.29
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.24
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.22
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.21
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.2
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.2
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.2
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.18
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.15
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.14
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.12
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.11
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.1
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.08
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.08
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.08
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.06
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.02
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.02
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.98
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.94
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.93
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.92
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.92
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.9
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.9
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.89
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.88
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.82
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.81
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.8
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.79
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.79
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.78
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.78
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.78
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.76
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.76
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.74
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.74
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.73
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.69
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.68
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.67
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.64
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.63
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.62
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.54
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.53
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.51
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.49
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.48
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.47
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.46
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.46
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.45
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.36
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.32
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.31
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.29
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.24
3k9i_A117 BH0479 protein; putative protein binding protein, 98.24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.21
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.18
3k9i_A117 BH0479 protein; putative protein binding protein, 98.18
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.17
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.14
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.14
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.11
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.08
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.08
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.98
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.98
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.93
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.91
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.85
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.76
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.75
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.74
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.73
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.72
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.54
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.49
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.32
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.26
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.22
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.2
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.13
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.12
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.03
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.97
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.92
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.84
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.8
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.6
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.48
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.48
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.23
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.2
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.11
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.91
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.86
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.36
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.32
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.13
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.99
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.84
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.76
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.73
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 94.63
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.17
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.14
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.81
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 93.59
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.45
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.36
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.04
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.42
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.34
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.18
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.97
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.86
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.64
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.27
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 90.13
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 89.99
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.69
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 88.57
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.23
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 87.93
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 87.67
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 87.28
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.65
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 85.38
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 85.16
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 84.58
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 83.09
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.42
2p58_C116 Putative type III secretion protein YSCG; type III 81.95
2zu6_B307 Programmed cell death protein 4; protein-protein c 81.13
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.6e-33  Score=255.24  Aligned_cols=343  Identities=9%  Similarity=-0.032  Sum_probs=226.4

Q ss_pred             CCCCchHHHHHHHHhhhcccHHHHHHHHHhcccCC--------------CCccchhhHHHHHHHHHhcCChHHHHHHHHH
Q 042154           17 TATGPKFIGSVIRGIYKENNLKRLVDKFKKSSDLG--------------RFRTNTGIYTGTVQRLANAKRFRWIEEILEH   82 (377)
Q Consensus        17 ~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~~~--------------~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~   82 (377)
                      .++++.+++.++.+|.+.|++++|+++|+++....              +.+++..+|..++.++.+.|++++|+++|++
T Consensus       146 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  225 (597)
T 2xpi_A          146 YNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKE  225 (597)
T ss_dssp             GGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             cccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            36788899999999999999999999998543221              2345688999999999999999999999999


Q ss_pred             hhhhcCCCccch-------------------------------------hHHHHHHHHccCCHHHHHHHHHhcCCCCCCc
Q 042154           83 QKQYKDISKEGF-------------------------------------TARLIALYGKAAMFENARKVFDEMPGRNCEQ  125 (377)
Q Consensus        83 ~~~~~~~~~~~~-------------------------------------~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~  125 (377)
                      +.+.++.....+                                     ++.++..|.+.|++++|.++|+++.+.  ++
T Consensus       226 ~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~  303 (597)
T 2xpi_A          226 ALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EK  303 (597)
T ss_dssp             HHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GG
T ss_pred             HHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--Cc
Confidence            987653322211                                     111244556777888888888888765  47


Q ss_pred             cHHHHHHHHHHHHhCCChhHHHHHHHhchhhcC--------------------------------CCcCHHHHHHHHHHH
Q 042154          126 TVLSFNALLGACVNSKKFDEVDGLFKDLPHKLG--------------------------------IEPDLVSYNTIIKAF  173 (377)
Q Consensus       126 ~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~--------------------------------~~p~~~~~~~l~~~~  173 (377)
                      +..+++.++.+|.+.|++++|+.+|+++.+...                                .+.+..+++.++..|
T Consensus       304 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~  383 (597)
T 2xpi_A          304 SSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYY  383 (597)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHH
Confidence            788888888888888888888888888764310                                122344555556666


Q ss_pred             HHcCCHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHHcCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 042154          174 VDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPNVRSYNARLDGLAIEKQTKKAL  253 (377)
Q Consensus       174 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~  253 (377)
                      .+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+|..++.+|.+.|++++|.
T Consensus       384 ~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~  461 (597)
T 2xpi_A          384 LCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLAN  461 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHH
T ss_pred             HHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHH
Confidence            66666666666666665542 2245566666666666666666666666666543 235556666666666666666666


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHH---h----cCCCCC--HHHHHHHHHHHHhcCChHHHHHHHH
Q 042154          254 ELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYN---K----SGCGMN--KAIFKLLVPFVCEKGDLDFAFNLCK  324 (377)
Q Consensus       254 ~~~~~~~~~g~~p~~~~~~~l~~~~~~~~~~~~a~~~~~---~----~~~~~~--~~~~~~l~~~~~~~g~~~~a~~~~~  324 (377)
                      ++|+++.+.. +.+..+|+.++..|.+.|++++|.++++   .    .+..|+  ..+|..++.+|.+.|++++|.++|+
T Consensus       462 ~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~  540 (597)
T 2xpi_A          462 EYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALN  540 (597)
T ss_dssp             HHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHH
Confidence            6666665542 2345666666666666666666666666   1    144555  5566666666666666666666666


Q ss_pred             HHHhcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHhhccCC
Q 042154          325 RTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNS  365 (377)
Q Consensus       325 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  365 (377)
                      ++.+.+. .+..+|..++.+|.+.|++++|.++++++.+..
T Consensus       541 ~~~~~~p-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~  580 (597)
T 2xpi_A          541 QGLLLST-NDANVHTAIALVYLHKKIPGLAITHLHESLAIS  580 (597)
T ss_dssp             HHHHHSS-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HHHHhCC-CChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcC
Confidence            6666542 255666666666666666666666666665544



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.73
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.41
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.39
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.36
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.32
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.31
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.3
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.28
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.16
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.11
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.9
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.73
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.61
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.6
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.51
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.41
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.33
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.29
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.24
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.08
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.01
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.99
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.95
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.92
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.79
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.51
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.44
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.12
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 97.05
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.84
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.52
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.5
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.33
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.39
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.35
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.33
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 94.08
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.45
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=2.6e-22  Score=172.50  Aligned_cols=330  Identities=11%  Similarity=0.037  Sum_probs=253.1

Q ss_pred             HHHHhhhcccHHHHHHHHHhcccCCCCccchhhHHHHHHHHHhcCChHHHHHHHHHhhhhcCCCccchhHHHHHHHHccC
Q 042154           27 VIRGIYKENNLKRLVDKFKKSSDLGRFRTNTGIYTGTVQRLANAKRFRWIEEILEHQKQYKDISKEGFTARLIALYGKAA  106 (377)
Q Consensus        27 li~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  106 (377)
                      +...+.+.|++++|++.|+++.+..  |.+...+..+..++...|++++|+..++++.+..+.. ...+..+..+|.+.|
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~-~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL-AEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC-HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC-HHHHHHHHHHhhhhc
Confidence            4456778899999999999887764  5567788888888999999999999999888775433 344556888899999


Q ss_pred             CHHHHHHHHHhcCCCCCCccHHHHHHHHHH----------------------------------HHhCCChhHHHHHHHh
Q 042154          107 MFENARKVFDEMPGRNCEQTVLSFNALLGA----------------------------------CVNSKKFDEVDGLFKD  152 (377)
Q Consensus       107 ~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~----------------------------------~~~~~~~~~a~~~~~~  152 (377)
                      ++++|...+....+.. +.+..........                                  ....+....+...+.+
T Consensus        82 ~~~~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             CHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             cccccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHH
Confidence            9999998888876543 1222222222222                                  2223333344444443


Q ss_pred             chhhcCCCcCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHhHHHHHHHHHcCCCHHHHHHHHHHHHhCCCCCC
Q 042154          153 LPHKLGIEPDLVSYNTIIKAFVDKGSLDSANTLLYEMEKKGIRLDLITFNTLLLGFYSNGRFADAEKIWETMVNMNVRPN  232 (377)
Q Consensus       153 ~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~  232 (377)
                      ....  .+-+...+..+...+...|++++|...+++..+... .+...+..+...+...|++++|...+++....+ +.+
T Consensus       161 ~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~  236 (388)
T d1w3ba_         161 AIET--QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNH  236 (388)
T ss_dssp             HHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTC
T ss_pred             hhcc--CcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCc-ccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhH
Confidence            3322  122445677778888899999999999999887643 367788889999999999999999999988765 356


Q ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHH--hcCCCCCHHHHHHHHHHH
Q 042154          233 VRSYNARLDGLAIEKQTKKALELVGEMRSKEINPDVFTFYALIKGFVNEGNLEEAKRWYN--KSGCGMNKAIFKLLVPFV  310 (377)
Q Consensus       233 ~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~g~~p~~~~~~~l~~~~~~~~~~~~a~~~~~--~~~~~~~~~~~~~l~~~~  310 (377)
                      ...+..+...+.+.|++++|+..|++..+.. +-+..++..+...+...|++++|.+.++  ....+.+...+..+...+
T Consensus       237 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHH
Confidence            6778888899999999999999999988853 3356788889999999999999999999  333455777888899999


Q ss_pred             HhcCChHHHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHhhccCCc
Q 042154          311 CEKGDLDFAFNLCKRTFSERCLVDQAPLQLVVDRLAKELRVEEAKELVELGKTNSY  366 (377)
Q Consensus       311 ~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  366 (377)
                      ...|++++|++.|++.++..+. +..++..+..+|.+.|++++|.+.++++.+..+
T Consensus       316 ~~~~~~~~A~~~~~~al~~~p~-~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P  370 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVFPE-FAAAHSNLASVLQQQGKLQEALMHYKEAIRISP  370 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSCTT-CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCT
T ss_pred             HHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC
Confidence            9999999999999999886433 567888899999999999999999999987654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure