Citrus Sinensis ID: 042177

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
Protein Sequence
MVRITKMFNVLMNLFLLVLASNAQGHNSNDEDIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNCTSTPESESESEPDPDAESESETESESESESESEPDNL
Secondary Structure (PSIPRED)
ccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHEEccHHHHHHcccccccccccccEEccEEEEcccccccccccccccccccccccccccccccccccccccccc
Secondary Structure Prediction (SSPRO)
ccHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccHHEEHcHHHHHHHHcccccccHEHcEHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
Coil and Loop (DISEMBL)
MVRITKMFNVLMNLFLLVLASnaqghnsndedifkqpqvrdqgergVSKVVTAGLGLIgnallsphaaplvNATVNYATCklynnctstpesesesepdpdaesesetesesesesesepdnl
Flexible Loop (DISEMBL)
MVRITKMFNVLMNLFLLVLASNAQGHNSNDEDIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNCTstpesesesepdpdaesesetesesesesesepdnl
Low Complexity Region (SEG)
MVRITKmfnvlmnlfllvlASNAQGHNSNDEDIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNCtstpesesesepdpdaesesetesesesesesepdNL
Disordered region (IsUnstruct)
***ITKMFNVLMNLFLLVLAS*************************VSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNC*************************************
Disordered Region (DISOPRED)
*VRITKMFNVLMNLFLLVLASN**************************KVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYN***************************************
Disordered Region (DISEMBL)
MVRITKMFNVLMNLFLLVLASNAQGHNSNDEDIFKQP********GVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNC*************************************
Disordered Region (DISPRO)
MVRITKMFNVLMNLFLLVLASNA*****NDEDIFKQPQV*****RGVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNCT************************************
Transmembrane Helix (TMHMM)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
SSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (Phobius)
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MVRITKMFNVLMNLFLLVLASNAQGHNSNDEDIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNYATCKLYNNCTSTPESESESEPDPDAESESETESESESESESEPDNL
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

No confident hit detected by STRING

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	123
COG5129	303	MAK16 Nuclear protein with HMG-like acidic region	93.41
KOG1189	960	consensus Global transcriptional regulator, cell d	91.97
PF09026	101	CENP-B_dimeris: Centromere protein B dimerisation	90.39
KOG3064	303	consensus RNA-binding nuclear protein (MAK16) cont	88.11
KOG2236	483	consensus Uncharacterized conserved protein [Funct	86.53
PTZ00007	337	(NAP-L) nucleosome assembly protein -L; Provisiona	83.93

>COG5129 MAK16 Nuclear protein with HMG-like acidic region [General function prediction only]

Probab=93.41  E-value=0.035  Score=46.92  Aligned_cols=10  Identities=40%  Similarity=0.673  Sum_probs=5.4

Q ss_pred             hhHHHHHHHH
Q 042177            3 RITKMFNVLM   12 (123)
Q Consensus         3 ritkmfnvlm   12 (123)
                      |+||+-.+|+
T Consensus       110 rltkLTQyll  119 (303)
T COG5129         110 RLTKLTQYLL  119 (303)
T ss_pred             HHHHHHHHHH
Confidence            4556555553

>KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism]

Probab=91.97  E-value=0.096  Score=49.75  Aligned_cols=18  Identities=39%  Similarity=0.562  Sum_probs=10.0

Q ss_pred             CcccccCccccccccccch
Q 042177           30 DEDIFKQPQVRDQGERGVS   48 (123)
Q Consensus        30 dedifkqpqvrdqgergvs   48 (123)
                      .+--|++| .|+-|-.||.
T Consensus       739 ~~~efd~p-fr~lGF~GvP  756 (960)
T KOG1189|consen  739 SELEFDVP-FRELGFNGVP  756 (960)
T ss_pred             cceeeccc-hhhcCcCCCC
Confidence            34446554 5666666653

>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box

Probab=90.39  E-value=0.081  Score=39.12  Aligned_cols=9  Identities=56%  Similarity=0.841  Sum_probs=0.0

Q ss_pred             CCCCCCCCC
Q 042177           93 ESESEPDPD  101 (123)
Q Consensus        93 dSESEseSD  101 (123)
                      +|++|+|.|
T Consensus        11 dse~dsdEd   19 (101)
T PF09026_consen   11 DSESDSDED   19 (101)
T ss_dssp             ---------
T ss_pred             ccccccccc
Confidence            333333333

CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.

>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]

Probab=88.11  E-value=0.15  Score=43.46  Aligned_cols=17  Identities=35%  Similarity=0.507  Sum_probs=10.0

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 042177            3 RITKMFNVLMNLFLLVL   19 (123)
Q Consensus         3 ritkmfnvlmnlfllvl   19 (123)
                      |+|||-.+|.-+=-|.|
T Consensus       111 RltklTQylir~rklal  127 (303)
T KOG3064|consen  111 RLTKLTQYLIRMRKLAL  127 (303)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            56777666665544443

>KOG2236 consensus Uncharacterized conserved protein [Function unknown]

Probab=86.53  E-value=0.8  Score=41.03  Aligned_cols=9  Identities=22%  Similarity=0.157  Sum_probs=4.1

Q ss_pred             chhhhhccc
Q 042177           69 PLVNATVNY   77 (123)
Q Consensus        69 Pi~N~~~~y   77 (123)
                      ++|.-++.|
T Consensus        91 d~vd~~~~g   99 (483)
T KOG2236|consen   91 DLVDPILVG   99 (483)
T ss_pred             cccchhhcC
Confidence            344444444

>PTZ00007 (NAP-L) nucleosome assembly protein -L; Provisional

Probab=83.93  E-value=1  Score=37.89  Aligned_cols=12  Identities=25%  Similarity=0.498  Sum_probs=4.6

Q ss_pred             ccccccccCCCC
Q 042177          109 ESESESESESEP  120 (123)
Q Consensus       109 dseSdSesDSEs  120 (123)
                      |++|+++.++++
T Consensus       307 ~~~~~~~~~~~~  318 (337)
T PTZ00007        307 DSNSDVDTNEED  318 (337)
T ss_pred             cccccccccccc
Confidence            333333333333

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00