Citrus Sinensis ID: 042526
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 284 | ||||||
| 255554328 | 496 | dead box ATP-dependent RNA helicase, put | 0.436 | 0.25 | 0.75 | 9e-44 | |
| 224107545 | 847 | predicted protein [Populus trichocarpa] | 0.436 | 0.146 | 0.703 | 7e-42 | |
| 449458872 | 848 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.419 | 0.140 | 0.715 | 7e-41 | |
| 449509127 | 784 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.419 | 0.151 | 0.715 | 8e-41 | |
| 356520440 | 810 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.429 | 0.150 | 0.730 | 1e-40 | |
| 297834580 | 831 | DEAD-box ATP-dependent RNA helicase 13 [ | 0.450 | 0.154 | 0.648 | 2e-36 | |
| 225433316 | 788 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.429 | 0.154 | 0.679 | 4e-36 | |
| 357505253 | 798 | DEAD-box ATP-dependent RNA helicase [Med | 0.419 | 0.149 | 0.693 | 4e-36 | |
| 147810431 | 458 | hypothetical protein VITISV_038405 [Viti | 0.464 | 0.288 | 0.628 | 8e-36 | |
| 227202696 | 827 | AT3G16840 [Arabidopsis thaliana] | 0.464 | 0.159 | 0.661 | 2e-35 |
| >gi|255554328|ref|XP_002518204.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223542800|gb|EEF44337.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 183 bits (464), Expect = 9e-44, Method: Compositional matrix adjust.
Identities = 96/128 (75%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
Query: 12 VGNGPDDAQEELVNEAEISTEFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQ 71
V NG DD E V+EAE F AWNELRLHPLLMKSIY+LGFKE T I KA IP AHQ
Sbjct: 141 VSNGEDDTDGESVDEAE----FHAWNELRLHPLLMKSIYRLGFKEPTPIQKACIPPAAHQ 196
Query: 72 RKDVIGAAETESGKTRAFGLPALQRLLEEREKAAKMLEEKGEEAEKYAPKGHLRALIINP 131
KDVIGAAET SGKT AFGLP LQRLLEER+KAA L+E GEEAEKY P G LRALII P
Sbjct: 197 GKDVIGAAETGSGKTLAFGLPILQRLLEERDKAANYLDEMGEEAEKYGPTGLLRALIITP 256
Query: 132 TRELALQV 139
TRELALQV
Sbjct: 257 TRELALQV 264
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224107545|ref|XP_002314517.1| predicted protein [Populus trichocarpa] gi|222863557|gb|EEF00688.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449458872|ref|XP_004147170.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449509127|ref|XP_004163501.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356520440|ref|XP_003528870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297834580|ref|XP_002885172.1| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis lyrata subsp. lyrata] gi|297331012|gb|EFH61431.1| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225433316|ref|XP_002282504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13 [Vitis vinifera] gi|296083755|emb|CBI23744.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357505253|ref|XP_003622915.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355497930|gb|AES79133.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147810431|emb|CAN65340.1| hypothetical protein VITISV_038405 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|227202696|dbj|BAH56821.1| AT3G16840 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 284 | ||||||
| TAIR|locus:2086775 | 826 | AT3G16840 [Arabidopsis thalian | 0.503 | 0.173 | 0.615 | 3.5e-37 | |
| DICTYBASE|DDB_G0281841 | 940 | ddx24 "DEAD/DEAH box helicase" | 0.341 | 0.103 | 0.371 | 7.5e-17 | |
| WB|WBGene00018890 | 746 | F55F8.2 [Caenorhabditis elegan | 0.482 | 0.183 | 0.353 | 3.5e-16 | |
| FB|FBgn0034496 | 813 | CG9143 [Drosophila melanogaste | 0.369 | 0.129 | 0.358 | 6.2e-13 | |
| ASPGD|ASPL0000042587 | 770 | AN1750 [Emericella nidulans (t | 0.380 | 0.140 | 0.449 | 2.1e-12 | |
| CGD|CAL0001091 | 581 | orf19.672 [Candida albicans (t | 0.359 | 0.175 | 0.424 | 7.5e-12 | |
| UNIPROTKB|Q59W52 | 581 | PRP28 "Pre-mRNA-splicing ATP-d | 0.359 | 0.175 | 0.424 | 7.5e-12 | |
| CGD|CAL0000625 | 631 | SPB4 [Candida albicans (taxid: | 0.397 | 0.179 | 0.347 | 2.9e-11 | |
| WB|WBGene00010280 | 959 | F58G11.2a [Caenorhabditis eleg | 0.394 | 0.116 | 0.36 | 1.1e-10 | |
| DICTYBASE|DDB_G0281711 | 783 | ddx27 "DEAD/DEAH box helicase" | 0.278 | 0.100 | 0.414 | 2.4e-09 |
| TAIR|locus:2086775 AT3G16840 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 408 (148.7 bits), Expect = 3.5e-37, P = 3.5e-37
Identities = 88/143 (61%), Positives = 100/143 (69%)
Query: 17 DDAQEELVNEAEISTEFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVI 76
DD EE V E EI EF AW+ +RLHPLLMKSIY+L FKE T I KA A+Q KDVI
Sbjct: 173 DDTVEEQVEEEEIPPEFSAWSSMRLHPLLMKSIYRLDFKEPTKIQKACFNVAAYQGKDVI 232
Query: 77 GAAETESGKTRAFGLPALQRLLEEREKAAKMLEEKGEEAEKYAPKGHLRALIINPTRELA 136
GAAET SGKT AFGLP LQRLL+EREK K+ KGEEA+KYA G+LRALII PTRELA
Sbjct: 233 GAAETGSGKTLAFGLPILQRLLDEREKVGKLYALKGEEAQKYAADGYLRALIITPTRELA 292
Query: 137 LQVLMVASPSLKSNSLTLAMAAG 159
LQV + K+ S+ + G
Sbjct: 293 LQVTEHLENAAKNLSVKVVPIVG 315
|
|
| DICTYBASE|DDB_G0281841 ddx24 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00018890 F55F8.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034496 CG9143 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000042587 AN1750 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001091 orf19.672 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59W52 PRP28 "Pre-mRNA-splicing ATP-dependent RNA helicase PRP28" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000625 SPB4 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010280 F58G11.2a [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281711 ddx27 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 284 | |||
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 1e-24 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 3e-16 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-13 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 5e-12 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 1e-11 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-10 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 1e-10 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 5e-10 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 3e-09 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 2e-07 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 3e-07 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 3e-07 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 4e-07 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 1e-06 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 2e-04 | |
| pfam05786 | 719 | pfam05786, Cnd2, Condensin complex subunit 2 | 0.002 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
Score = 97.6 bits (244), Expect = 1e-24
Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 19/110 (17%)
Query: 36 WNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVIGAAETESGKTRAFGLPALQ 95
+ EL L P L++ IY LGF++ T I IP L +DVIG A+T SGKT AF +P L+
Sbjct: 1 FEELGLSPELLRGIYALGFEKPTPIQARAIPPLL-SGRDVIGQAQTGSGKTAAFLIPILE 59
Query: 96 RLLEEREKAAKMLEEKGEEAEKYAPKGHLRALIINPTRELALQVLMVASP 145
+L K +ALI+ PTRELALQ+ VA
Sbjct: 60 KLDPSP------------------KKDGPQALILAPTRELALQIAEVARK 91
|
A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218747 pfam05786, Cnd2, Condensin complex subunit 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 100.0 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.97 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.97 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.97 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.97 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.97 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.97 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.97 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.96 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.96 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.96 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.96 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.96 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.93 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.93 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.92 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.9 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.9 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.9 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.9 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.89 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.89 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.85 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.85 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.82 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.81 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.79 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.79 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.77 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.76 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.76 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.75 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.73 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.72 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.71 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.71 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.69 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.68 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.68 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.65 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.63 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.62 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.62 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.62 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.59 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.57 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.55 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.53 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.52 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.42 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.41 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.36 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.36 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.34 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.34 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.23 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.19 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.18 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.18 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.15 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.14 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.11 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.11 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.08 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.08 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.03 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.82 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.82 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.82 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 98.77 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 98.71 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.58 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.55 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.53 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.51 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 98.51 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.5 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.48 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 98.41 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.38 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.35 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.35 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 98.34 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.28 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 98.25 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.23 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 98.22 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.21 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.2 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.18 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.18 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.13 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.1 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 98.02 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.83 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.8 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 97.77 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.68 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 97.67 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 97.65 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.65 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.62 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 97.56 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.55 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.55 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 97.49 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.26 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 97.17 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.02 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 96.98 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 96.78 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 96.72 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.71 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 96.61 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 96.59 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.42 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 96.42 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.4 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 96.39 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 96.24 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.14 | |
| KOG2340 | 698 | consensus Uncharacterized conserved protein [Funct | 96.08 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 96.07 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 96.05 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 96.0 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.95 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 95.93 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 95.83 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 95.79 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 95.79 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 95.76 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 95.73 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.68 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 95.56 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 95.38 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 95.35 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 95.12 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 95.07 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 95.06 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.95 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 94.91 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 94.87 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 94.86 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 94.83 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 94.82 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 94.8 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 94.73 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 94.63 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 94.6 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 94.49 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 94.47 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.32 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.2 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 94.15 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 93.97 | |
| PRK13764 | 602 | ATPase; Provisional | 93.89 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 93.88 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 93.68 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 93.66 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.54 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 93.5 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 93.44 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 93.25 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 93.23 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 93.21 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.13 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 93.05 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 92.96 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 92.89 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 92.79 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 92.74 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.68 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 92.66 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.65 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 92.64 | |
| PRK08181 | 269 | transposase; Validated | 92.59 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 92.55 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 92.39 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.3 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 92.29 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 92.15 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 91.89 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 91.57 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 91.49 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 91.47 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 91.4 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 90.96 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 90.56 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 90.53 | |
| PRK12377 | 248 | putative replication protein; Provisional | 90.5 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 90.23 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 90.21 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 90.19 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 89.92 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 89.84 | |
| PF10278 | 178 | Med19: Mediator of RNA pol II transcription subuni | 89.63 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 89.55 | |
| PRK13880 | 636 | conjugal transfer coupling protein TraG; Provision | 89.32 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 89.31 | |
| PRK06526 | 254 | transposase; Provisional | 89.25 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 89.25 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 89.19 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 89.18 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 89.18 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 89.17 | |
| PRK08116 | 268 | hypothetical protein; Validated | 89.09 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 88.66 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 88.48 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 88.43 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 88.42 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 88.34 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 88.25 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 88.12 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 87.78 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 87.64 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 87.57 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 87.53 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 87.44 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 87.29 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 87.08 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 86.66 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 86.52 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 86.3 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 86.02 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 85.78 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 85.76 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 85.75 | |
| PRK08727 | 233 | hypothetical protein; Validated | 85.57 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 85.5 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 85.5 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 85.12 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 85.06 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 84.91 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 84.59 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 84.5 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 84.41 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 84.36 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 84.27 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 84.25 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 84.23 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 84.17 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 83.9 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 83.75 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 83.63 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 83.47 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 83.27 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 83.11 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 83.09 | |
| PF05729 | 166 | NACHT: NACHT domain | 83.02 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 82.75 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 82.59 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 82.55 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 82.49 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 82.48 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 82.24 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 82.13 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 81.97 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 81.97 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 81.89 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 81.87 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 81.68 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 81.67 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 81.09 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 81.09 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 81.09 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 81.0 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 80.84 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 80.84 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 80.63 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 80.56 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 80.47 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 80.45 | |
| PHA02244 | 383 | ATPase-like protein | 80.32 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 80.29 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 80.23 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 80.18 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 80.05 |
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-37 Score=297.52 Aligned_cols=171 Identities=27% Similarity=0.271 Sum_probs=151.8
Q ss_pred CcccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHcCCCcEEEEccCCCCchHHhHHHHHHHHHHHHHHHHHHHhhhhhh
Q 042526 35 AWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVIGAAETESGKTRAFGLPALQRLLEEREKAAKMLEEKGEE 114 (284)
Q Consensus 35 ~F~~l~L~~~Ll~~L~~~g~~~pT~iQ~~aip~il~~G~dviv~A~TGSGKTlafllPil~~l~~~~~~~~~~~~~~~~~ 114 (284)
.|++++|++.+..+|...||+.|||||+++||.+ +.|+|++++|.|||||||||+||+|.++....
T Consensus 92 ~f~~~~ls~~~~~~lk~~g~~~PtpIQaq~wp~~-l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~------------- 157 (519)
T KOG0331|consen 92 AFQELGLSEELMKALKEQGFEKPTPIQAQGWPIA-LSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQ------------- 157 (519)
T ss_pred hhhcccccHHHHHHHHhcCCCCCchhhhccccee-ccCCceEEEeccCCcchhhhhhHHHHHHHhcc-------------
Confidence 6888999999999999999999999999999999 99999999999999999999999999998731
Q ss_pred hhhcCCCCCeEEEEEecCHHHHHHHHHHHhhhhcCCCceeEEEe-CCCcchHHHHHhcCCCcccccc---------cCCc
Q 042526 115 AEKYAPKGHLRALIINPTRELALQVLMVASPSLKSNSLTLAMAA-GSPLLTSEHSNRRKPNKRKRTR---------KGGE 184 (284)
Q Consensus 115 ~~~~~~~~~~~aLIL~PTReLa~Qi~~~~~~l~~~~~i~v~~~~-G~~~~~q~~~l~~~~~i~v~~~---------~~~~ 184 (284)
.......+|++|||+||||||.||..++..++..+.++++|++ |.+...|...+.++.++++.+. ....
T Consensus 158 -~~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~~~~~cvyGG~~~~~Q~~~l~~gvdiviaTPGRl~d~le~g~~~ 236 (519)
T KOG0331|consen 158 -GKLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLRLRSTCVYGGAPKGPQLRDLERGVDVVIATPGRLIDLLEEGSLN 236 (519)
T ss_pred -ccccCCCCCeEEEEcCcHHHHHHHHHHHHHHcCCCCccEEEEeCCCCccHHHHHHhcCCcEEEeCChHHHHHHHcCCcc
Confidence 1345567999999999999999999999999999888665555 5599999999999999988762 2235
Q ss_pred cccccccCCCCCCcccccccccchhhhcccCCCCCC
Q 042526 185 DEKLDSLKWNPLSQPKTTTLLPSSLALMNLTEGKPG 220 (284)
Q Consensus 185 ~d~l~~lv~dEAd~m~~~gflp~~~~~~~~~~r~~~ 220 (284)
+.+|.++|+||||+|++|||.|++..+++++++..+
T Consensus 237 l~~v~ylVLDEADrMldmGFe~qI~~Il~~i~~~~r 272 (519)
T KOG0331|consen 237 LSRVTYLVLDEADRMLDMGFEPQIRKILSQIPRPDR 272 (519)
T ss_pred ccceeEEEeccHHhhhccccHHHHHHHHHhcCCCcc
Confidence 779999999999999999999999999999966664
|
|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG2340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF10278 Med19: Mediator of RNA pol II transcription subunit 19 ; InterPro: IPR019403 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13880 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 284 | ||||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 2e-10 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 1e-09 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 3e-09 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 4e-09 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 3e-08 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 3e-07 | ||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 3e-07 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 1e-06 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 1e-06 | ||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 2e-06 | ||
| 1qde_A | 224 | Crystal Structure Of The Atpase Domain Of Translati | 2e-06 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 2e-06 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 4e-06 | ||
| 1qva_A | 223 | Yeast Initiation Factor 4a N-Terminal Domain Length | 5e-06 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 5e-06 | ||
| 3fhc_B | 235 | Crystal Structure Of Human Dbp5 In Complex With Nup | 8e-06 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 9e-06 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 1e-05 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 1e-05 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 1e-05 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 2e-05 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 2e-05 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 2e-05 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 2e-05 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 2e-05 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 2e-05 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 3e-05 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 3e-05 | ||
| 2kbe_A | 226 | Solution Structure Of Amino-Terminal Domain Of Dbp5 | 4e-05 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 4e-05 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 4e-05 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 4e-05 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 5e-05 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 1e-04 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 2e-04 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-04 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-04 | ||
| 2g9n_A | 221 | Structure Of The Dead Domain Of Human Eukaryotic In | 3e-04 | ||
| 1q0u_A | 219 | Crystal Structure Of The Bstdead N-Terminal Domain | 8e-04 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 8e-04 |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
|
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
| >pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 | Back alignment and structure |
| >pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 284 | |||
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 3e-26 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 2e-23 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 3e-23 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 4e-23 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 3e-22 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 8e-22 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 1e-21 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 7e-21 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 2e-20 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 4e-20 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 4e-20 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 7e-20 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 8e-20 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 7e-19 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 7e-19 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 7e-19 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 8e-19 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 1e-18 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 1e-18 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 1e-18 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 1e-18 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 3e-18 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 3e-18 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 1e-17 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 2e-17 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 2e-17 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 2e-17 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-17 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 4e-17 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 6e-14 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 1e-13 |
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
Score = 101 bits (255), Expect = 3e-26
Identities = 45/159 (28%), Positives = 68/159 (42%), Gaps = 18/159 (11%)
Query: 17 DDAQEELVNEAEIST-EFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDV 75
+ + N +I+ E +++ L +K + + ++ T I K I LA Q KDV
Sbjct: 7 ESISRLMQNYEKINVNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIG-LALQGKDV 65
Query: 76 IGAAETESGKTRAFGLPALQRLLEEREKAAKMLEEKGEEAEKYAPKGHLRALIINPTREL 135
+GAA+T SGKT AF +P L+ L + + L LII+PTREL
Sbjct: 66 LGAAKTGSGKTLAFLVPVLEALYRLQ----------------WTSTDGLGVLIISPTREL 109
Query: 136 ALQVLMVASPSLKSNSLTLAMAAGSPLLTSEHSNRRKPN 174
A Q V K++ + + G L E N
Sbjct: 110 AYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNIN 148
|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.97 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.97 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.96 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.96 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.96 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.96 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.96 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.95 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.95 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.95 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.95 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.95 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.95 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.95 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.95 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.94 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.94 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.93 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.92 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.91 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.91 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.9 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.9 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.9 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.9 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.9 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.89 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.89 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.86 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.85 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.83 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.81 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.79 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.79 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.79 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.79 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.79 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.78 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.78 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.77 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.77 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.77 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.76 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.75 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.75 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.74 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.74 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.73 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.7 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.69 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.68 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.62 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.62 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.62 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.62 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.61 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.58 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.58 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.57 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.55 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.55 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.55 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.54 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.5 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.48 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.46 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.44 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.42 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.4 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.38 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.31 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.3 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.27 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.17 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.11 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.1 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 98.76 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.7 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 98.57 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 98.41 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.4 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 98.15 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 97.01 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.99 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 96.98 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 96.9 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.82 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 96.75 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.71 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.52 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 96.39 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 95.76 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 95.74 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 94.59 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 94.44 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 94.11 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.06 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 92.29 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.19 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 89.58 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 89.2 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 88.73 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 88.55 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 88.54 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 88.47 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 88.42 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 88.27 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 87.52 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 87.35 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 87.17 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 87.08 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 86.62 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 86.48 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 86.09 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 86.01 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 85.21 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 84.67 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 84.55 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 84.15 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 84.13 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 84.07 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 83.85 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 83.52 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 83.28 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 83.09 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 82.93 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 82.04 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 81.5 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 80.89 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 80.47 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 80.32 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 80.28 |
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
Probab=99.97 E-value=6.8e-32 Score=238.21 Aligned_cols=186 Identities=21% Similarity=0.185 Sum_probs=158.7
Q ss_pred cccccccccCccccCcccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHcCCCcEEEEccCCCCchHHhHHHHHHHHHHH
Q 042526 21 EELVNEAEISTEFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVIGAAETESGKTRAFGLPALQRLLEE 100 (284)
Q Consensus 21 ~~~~~~~~~p~~~~~F~~l~L~~~Ll~~L~~~g~~~pT~iQ~~aip~il~~G~dviv~A~TGSGKTlafllPil~~l~~~ 100 (284)
...+.+.+.|.|+.+|.+++|++.++++|.++||..|||+|.++||.+ +.|+|++++||||||||++|++|++.++...
T Consensus 16 ~i~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~-~~g~~~l~~apTGsGKT~~~~l~~l~~l~~~ 94 (242)
T 3fe2_A 16 EITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVA-LSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ 94 (242)
T ss_dssp TEEEESSCCCCCCSSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHH-HHTCCEEEEECTTSCHHHHHHHHHHHHHHTS
T ss_pred ceEEeCCCCCCccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHH-hCCCCEEEECCCcCHHHHHHHHHHHHHHHhc
Confidence 346678889999999999999999999999999999999999999998 8999999999999999999999999987643
Q ss_pred HHHHHHHHhhhhhhhhhcCCCCCeEEEEEecCHHHHHHHHHHHhhhhcCCCceeEEEeCC-CcchHHHHHhcCCCccccc
Q 042526 101 REKAAKMLEEKGEEAEKYAPKGHLRALIINPTRELALQVLMVASPSLKSNSLTLAMAAGS-PLLTSEHSNRRKPNKRKRT 179 (284)
Q Consensus 101 ~~~~~~~~~~~~~~~~~~~~~~~~~aLIL~PTReLa~Qi~~~~~~l~~~~~i~v~~~~G~-~~~~q~~~l~~~~~i~v~~ 179 (284)
. ......++++|||+|||+||.|+++.++.+....++.+.+++|+ ....+...+..++++++.+
T Consensus 95 ~---------------~~~~~~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~I~v~T 159 (242)
T 3fe2_A 95 P---------------FLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIAT 159 (242)
T ss_dssp C---------------CCCTTCCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHCCSEEEEC
T ss_pred c---------------ccccCCCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEECCCChHHHHHHhcCCCCEEEEC
Confidence 1 11223578899999999999999999999999889988888776 4555667777888887766
Q ss_pred c---------cCCccccccccCCCCCCcccccccccchhhhcccCCCCCCCc
Q 042526 180 R---------KGGEDEKLDSLKWNPLSQPKTTTLLPSSLALMNLTEGKPGKK 222 (284)
Q Consensus 180 ~---------~~~~~d~l~~lv~dEAd~m~~~gflp~~~~~~~~~~r~~~~~ 222 (284)
. ....+.++..+|+|||++|.+.||.+....++...+...|..
T Consensus 160 p~~l~~~l~~~~~~~~~~~~lViDEah~l~~~~~~~~~~~i~~~~~~~~q~~ 211 (242)
T 3fe2_A 160 PGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTL 211 (242)
T ss_dssp HHHHHHHHHHTSCCCTTCCEEEETTHHHHHHTTCHHHHHHHHTTSCSSCEEE
T ss_pred HHHHHHHHHcCCCCcccccEEEEeCHHHHhhhCcHHHHHHHHHhCCccceEE
Confidence 2 223577889999999999999999999999988876665543
|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 284 | ||||
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 1e-12 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 1e-08 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 4e-08 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 4e-08 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 5e-08 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 6e-08 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 7e-08 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 9e-08 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 5e-07 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 1e-06 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 2e-04 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 6e-04 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 0.002 |
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: putative ATP-dependent RNA helicase VlgB species: Flatworm (Dugesia japonica) [TaxId: 6161]
Score = 63.8 bits (154), Expect = 1e-12
Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 12/135 (8%)
Query: 25 NEAEISTEFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVIGAAETESG 84
+ + + ++EL+L P + +I ++ T I K IPA+ + +D++ A+T SG
Sbjct: 12 PDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAIL-EHRDIMACAQTGSG 70
Query: 85 KTRAFGLPALQRLLEEREKAAKMLEEKGEEAEKYAPKGHLRALIINPTRELALQVLMVAS 144
KT AF +P + L+ + ++Y+ + + LI+ PTRELA+Q+L +
Sbjct: 71 KTAAFLIPIINHLVCQDLN-----------QQRYSKTAYPKCLILAPTRELAIQILSESQ 119
Query: 145 PSLKSNSLTLAMAAG 159
+ L + G
Sbjct: 120 KFSLNTPLRSCVVYG 134
|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 100.0 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 100.0 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 100.0 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.98 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.97 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.96 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.87 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.78 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.77 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.6 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.41 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.21 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.2 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.07 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.93 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.77 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.67 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.62 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.22 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.1 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 96.71 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.3 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 96.23 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 96.19 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 95.76 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 95.37 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.65 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.01 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 91.6 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.55 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 90.57 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 90.51 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 90.36 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.14 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.81 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 88.2 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 88.18 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 88.07 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 87.94 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 87.5 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 87.45 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.91 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 86.54 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 86.22 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 86.16 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 84.66 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 84.66 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 84.22 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 83.43 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 82.48 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 82.34 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 82.33 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 81.45 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.4 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 81.34 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 81.14 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 81.07 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 80.19 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 80.09 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.4e-39 Score=281.16 Aligned_cols=172 Identities=19% Similarity=0.224 Sum_probs=153.4
Q ss_pred ccccCcccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHcCCCcEEEEccCCCCchHHhHHHHHHHHHHHHHHHHHHHhh
Q 042526 31 TEFDAWNELRLHPLLMKSIYKLGFKESTSILKARIPALAHQRKDVIGAAETESGKTRAFGLPALQRLLEEREKAAKMLEE 110 (284)
Q Consensus 31 ~~~~~F~~l~L~~~Ll~~L~~~g~~~pT~iQ~~aip~il~~G~dviv~A~TGSGKTlafllPil~~l~~~~~~~~~~~~~ 110 (284)
....+|++|+|++.|+++|.++||+.|||||++|||.+ +.|+|++++|+||||||+||++|+++++...
T Consensus 14 ~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~i-l~g~dvi~~a~TGSGKTlayllPil~~l~~~---------- 82 (222)
T d2j0sa1 14 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQI-IKGRDVIAQSQSGTGKTATFSISVLQCLDIQ---------- 82 (222)
T ss_dssp CCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHH-HTTCCEEEECCTTSSHHHHHHHHHHHTCCTT----------
T ss_pred CCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHH-HCCCCeEEEcCcchhhhhhhccccccccccc----------
Confidence 45568999999999999999999999999999999999 8999999999999999999999999877543
Q ss_pred hhhhhhhcCCCCCeEEEEEecCHHHHHHHHHHHhhhhcCCCceeEEEeCC-CcchHHHHHhcCCCccccc---------c
Q 042526 111 KGEEAEKYAPKGHLRALIINPTRELALQVLMVASPSLKSNSLTLAMAAGS-PLLTSEHSNRRKPNKRKRT---------R 180 (284)
Q Consensus 111 ~~~~~~~~~~~~~~~aLIL~PTReLa~Qi~~~~~~l~~~~~i~v~~~~G~-~~~~q~~~l~~~~~i~v~~---------~ 180 (284)
...+++||++||||||.|+++++..++++.++++.+++|+ ....+...+..+++|++.+ .
T Consensus 83 ----------~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~ 152 (222)
T d2j0sa1 83 ----------VRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRR 152 (222)
T ss_dssp ----------SCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHT
T ss_pred ----------ccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccc
Confidence 2578999999999999999999999999999999777766 5566677788889998766 2
Q ss_pred cCCccccccccCCCCCCcccccccccchhhhcccCCCCCCCcc
Q 042526 181 KGGEDEKLDSLKWNPLSQPKTTTLLPSSLALMNLTEGKPGKKL 223 (284)
Q Consensus 181 ~~~~~d~l~~lv~dEAd~m~~~gflp~~~~~~~~~~r~~~~~~ 223 (284)
....++++.++|+||||+|+++||.+++..++..+++.+|..+
T Consensus 153 ~~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~il 195 (222)
T d2j0sa1 153 RSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVL 195 (222)
T ss_dssp TSSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEE
T ss_pred cccccccceeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEEE
Confidence 3346789999999999999999999999999999999888766
|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|