Citrus Sinensis ID: 042553


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130-
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAPSPSLSIRTNSPRLNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPHSSLGKSDLSSRSDSESASFKEVPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEHSRRDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGSSRYKQTEIEEEDGERSQAQKPLRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
ccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHcccccccccccHHHHHHHcEEEEEEccEEEEEEEEccEEEEEEEccccccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccEEcccccccccccEEEcccHHHHHHHHHcccccccEEEEEEccccEEEEccccccEEEEcccccHHHHHcHHHHHHHccccccccccccccccccccccEEEEcccccccccEEEEEEEcccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEccHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccccccccccHHHHHccccccccHHHHcccccccccEEEEEEEEEccccccccHHHHHcccccccccccccccccHHHHHHHHHHcccEEEEEEEcccccccEEEEEEEccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccEEccccccccHHHHHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccccccccccccccccEEEEEcccccccHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHccccccccccccHHHHHHHHHHHc
ccHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEcccEEEEEccccccEEEEccccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccEcccccccccccEEEEEEEccccEEEEEccHHHHHHHHHHHHcHccccEEEEEEcccEEEEEccccccEEEcccccEEEEEEcccccccccccHHHHcccccccEEEEcccEEEEEcHEEEHccccEEEEEEEcHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccHHHccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccEEEEEEccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHcccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccEEEEEcccccccHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHcccHEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccEEEccccccccccEEcccccccHcHHHHHHHHHcccEEEEEEcccccccccEEEEEEEccccccccccccccccccccccHHccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccccHHHcccccccccEEEEEcccccccHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHccccHHccccccHHHHHHHHHHcc
MQALSVlllpaslipYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSslnngtelsfsEIETKISYIGLDGLFISYYVdgnqtlalysnssfspnpngfpiakgkytwykqpvdrdtgklygeaivtkpssvstSTWFLKALnstdglgslgtgwskARDALFLNtagingtrgavslgfpvkpitnlfaginlyggrlsiatndgkvlvqgipntrmtivndsISFQLITNTKTraqqmnpvknvsctsgngtlsiGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCyveagpgseletNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEvvldpsdgsvlkfskvkgdrVKLKQILSNLLSNAVKFTSEGHISVRAcvkkpsaignpslsssrhgfLQSISCLfyknkkargdlEAVNAAQrdenameftfevddtgkgipkekrKTVFENYVQVkegeggtglgLGIVQSLVRLMggdieivdkengergtcfRFNVFLAIREAsandnntqgekelaggdsaagdtqlqhmnltvkapspslsirtnsprlnilspgsrhegsHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLkskfgsihsphsslgksdlssrsdsesasfkevplsamegtehklqgykrrgapSFILLVIDATAGPFLELFNIVAEFRRDLQcnckvvwldkptsrsinfdgledetmdpnddvllkpfhgsrlYKVIKLLpefggvqskrhgkasrdagsssyskhpyrtgksrskagrheiqeegssssehsrrdimpNASVLLktgnssgegprrdimpnASVLLKtgnssgegssrykqteieeedgersqaqkplrgkkilvadDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGlndqrdlgaphilpydyilmdcempimnGYEATRKIREEEKRNQVHIPIIALtahisgeeadkTIEAGmdvhlgkplnRDHLMEAIKYLH
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSlnngtelsfSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVtkpssvstsTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEvvldpsdgsvlkfskvkgdrvKLKQILSNLLSNAVKFTSEGHISVRACVKKPsaignpslsssrHGFLQSISCLFYKNKKARGDLEAVNaaqrdenameftfevddtgkgipkekrktVFENYVQVkegeggtglglGIVQSLVRLMGGDIeivdkengergTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLtvkapspslsirtnsPRLNilspgsrhegsHVVLLIANEERRRIAQKFMEnlginvsavsRWERLHSTLKRlkskfgsihsphsslgksdlssrsdsesasfkevplsamegteHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCkvvwldkptsrsinfdgledetmdpnDDVLLKPFHGSRLYKVIKLLPEfggvqskrhgkasrdagsssyskhpyrtgksrskagrheiqeegssssehsrrdIMPNASVLLKtgnssgegprrdIMPNASVLLktgnssgegssrykqteieeedgersqaqkplrgkkilvaddsMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYsnssfspnpngfpIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKegeggtglglgIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAPSPSLSIRTNSPRLNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHsphsslgksdlssrsdsesasFKEVPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQeegssssehsRRDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGSSRYKQTEIEEEDGERSQAQKPLRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
***LSVLLLPASLIPYWYKMTKHIEEDVAL*************ESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIK*****************AFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKK*************HGFLQSISCLFYKNKKAR*****************FTFEV************KTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIR**************************************************************HVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTL****************************************************RRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGL********DDVLLKPFHGSRLYKVIKLLPEFGG**********************************************************************************************************************ILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEA*KTIEAGMDVHL*****************
*QALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSF*********AKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKP******************ISCLFYKN**************RDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIR*******************************************************GSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPHSSLGKSDLSSRSDSESASFKEVPLSAME***************SFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEHSRRDI***********************************SGEGSSRY**********************KILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQME*********MNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAPSPSLSIRTNSPRLNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFG***************************VPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGV************************************************RDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTG****************************LRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKP*****************SISCL*YK*****************ENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIR**********************************************S**LNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPHSSLGKSDLSSRSDSESASFKEVPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEHSRRDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTG***************************PLRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQ*****PHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLARVISSSLNNGTELSFSEIETKISYIGLDGLFISYYVDGNQTLALYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTDGLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDGKVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAPSPSLSIRTNSPRLNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPHSSLGKSDLSSRSDSESASFKEVPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEHSRRDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGSSRYKQTEIEEEDGERSQAQKPLRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1131 2.2.26 [Sep-21-2011]
O222671122 Histidine kinase CKI1 OS= yes no 0.930 0.937 0.421 0.0
Q9SXL41207 Histidine kinase 1 OS=Ara no no 0.632 0.592 0.282 3e-74
P0C0F6726 Sensory/regulatory protei yes no 0.213 0.331 0.31 2e-25
P0C0F7726 Sensory/regulatory protei yes no 0.213 0.331 0.31 2e-25
Q9C5U01080 Histidine kinase 4 OS=Ara no no 0.281 0.294 0.279 2e-25
Q9C5U11036 Histidine kinase 3 OS=Ara no no 0.296 0.323 0.285 1e-24
O140022310 Peroxide stress-activated yes no 0.219 0.107 0.302 3e-24
Q54YZ92062 Hybrid signal transductio yes no 0.212 0.116 0.318 1e-23
Q869S51671 Hybrid signal transductio no no 0.244 0.165 0.283 2e-23
Q8D5Z6857 Autoinducer 2 sensor kina no no 0.187 0.247 0.305 2e-23
>sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 Back     alignment and function desciption
 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1155 (42%), Positives = 688/1155 (59%), Gaps = 103/1155 (8%)

Query: 3    ALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISS-SATNLA 61
            A  V++     I  W   T+++ ++VA  +  L +++ S+IE+I    +  ++ S   LA
Sbjct: 21   AFLVVVFECIWISNWRTTTENLVKEVASFTEDLRTSLVSEIENIGKFTYAKTNLSTIGLA 80

Query: 62   RVISSSLNNGTELSFSEIETKI-----------------SYIGLDGLFISYYVDGNQTLA 104
            RVI S + N  +  F+EI+T+I                 SYI  DGL  SY  + N ++A
Sbjct: 81   RVIDSYITN-NDTGFTEIQTQIAPLLFVAYSTILQVSQVSYISRDGLMFSYIAESNTSVA 139

Query: 105  LYSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNST 164
            +++NSS +        ++G YTWY Q VD+ TG+L G +  ++   V+ + WF  A ++ 
Sbjct: 140  VFANSSSNS-------SRGDYTWYTQTVDQLTGRLNGNSTKSQSLDVTHTDWFQAAQSNN 192

Query: 165  DGLGSLGTGWS-KARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATN 223
                 +GT    +  + L  +   +   +G VSLGFPVK +T +   +NL+G  L + T 
Sbjct: 193  YTTAFVGTSLGGEDNETLIQSVVSLYSKKGLVSLGFPVKTLTEVLNSLNLHGEELYMWTK 252

Query: 224  DGKVLV-QGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYK 282
            DG VLV +G  N    I N SI F   +N+     Q  P    +C+S    + I ++ Y+
Sbjct: 253  DGTVLVREGSLNDSFFISNGSICFGRESNS--LWSQCIPE---NCSSSGYEVEIKRLRYQ 307

Query: 283  AYCSQFEVAGVKSVYALAMPRKGLVSLV-HRTSKRALILLIVMTVGVLISMLTFVFKSAR 341
            A+CS  EV+GV   Y L  P KG  + + H+  K    L++VM        + FV+   +
Sbjct: 308  AFCSVIEVSGVPLRYTLMFPNKGGATRIKHQAEKAKYQLIVVMIFLGFGWPVWFVWFMMQ 367

Query: 342  AARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGP 401
            A R+EMH+ A+LI QMEATQQAERKSMNKS AFANASHDIR ALAG+ GLI++C     P
Sbjct: 368  ATRREMHMRATLINQMEATQQAERKSMNKSQAFANASHDIRGALAGMKGLIDICRDGVKP 427

Query: 402  GSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVA 461
            GS+++T L Q+NVCA DL+ LLNS+LD SK+E+GKMQL+EEDF++ +LLEDV+D +HPVA
Sbjct: 428  GSDVDTTLNQVNVCAKDLVALLNSVLDMSKIESGKMQLVEEDFNLSKLLEDVIDFYHPVA 487

Query: 462  MRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSA 521
            M+KGV+VVLDP DGSV KFS V+GD  +LKQIL+NL+SNAVKFT +GHI+VRA  ++P +
Sbjct: 488  MKKGVDVVLDPHDGSVFKFSNVRGDSGRLKQILNNLVSNAVKFTVDGHIAVRAWAQRPGS 547

Query: 522  IGNPSLSSSRHGFLQSISCLFYKNKKARG--DLEAVNAAQRDENAMEFTFEVDDTGKGIP 579
              +  L+S   G  + +  +F KNK+     + E  N+ + + N MEF FEVDDTGKGIP
Sbjct: 548  NSSVVLASYPKGVSKFVKSMFCKNKEESSTYETEISNSIRNNANTMEFVFEVDDTGKGIP 607

Query: 580  KEKRKTVFENYVQVKE---GEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNV 636
             E RK+VFENYVQV+E   G  GTGLGLGIVQSLVRLMGG+I I DK  GE+GTCF+FNV
Sbjct: 608  MEMRKSVFENYVQVRETAQGHQGTGLGLGIVQSLVRLMGGEIRITDKAMGEKGTCFQFNV 667

Query: 637  FLAIREA-SANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAP-SPSLSIRTNSPRL-NI 693
             L   E+   +D   + E E AGGD  +      ++ LT+      S++IR  SPR  N 
Sbjct: 668  LLTTLESPPVSDMKVRQEIE-AGGDYVS----TPNLGLTINTSLGGSMNIRNLSPRFNNC 722

Query: 694  LSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIH 753
            LS   + EGS VVLL+ NEERRR+ +K+++NLGI V+ V +WE L   L+RL   FG   
Sbjct: 723  LSSSPKQEGSRVVLLLKNEERRRVTEKYIKNLGIKVTVVEKWEHLSYALERL---FG--F 777

Query: 754  SPHSSLGKSDLSSRSDSESASFKEVPLSAMEGTEHKLQGYKRRGA--PSFILLVIDATAG 811
            SP SS+G+++ S    S     +E+P   M+G + + Q  KRR     + +LLVIDA  G
Sbjct: 778  SPQSSMGRAECSLSCPSS----RELPFIGMDGIDSRSQLPKRRSISFSAVVLLVIDAKTG 833

Query: 812  PFLELFNIVAEFRRDLQ--CNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSR 869
            PF EL +IV +FRR L    +CKVVWL++ ++R            +  D    +P HGSR
Sbjct: 834  PFFELCDIVKQFRRGLPHGISCKVVWLNESSTR----------VSERGDISCSRPLHGSR 883

Query: 870  LYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEH 929
            L +V+K+LPEFGG   K   +   +    S  +H +   +S     +H++QEEG SS  +
Sbjct: 884  LMEVLKMLPEFGGTVLK---EPPTELQRESLLRHSFVAERS----PKHKVQEEGPSSMFN 936

Query: 930  SR--RDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGSSRYKQTEIEEEDG 987
             +  + IM +     +T   S    R+ I          GN              +E++ 
Sbjct: 937  KKLGKRIMASTDSESETRVKSVRTGRKPI----------GNPE------------DEQET 974

Query: 988  ERSQAQKPLRGKKILVADDSMMLRRVAEINLRHLGAT-VEACENGEAALQLVRSGLNDQR 1046
             +    + LRGK++LV DD+ + R+VA   L+ +G + VE C++G+ AL+LV  GL  + 
Sbjct: 975  SKPSDDEFLRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGKEALRLVTEGLTQRE 1034

Query: 1047 DLGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISG-EEADKT 1105
            + G+   LP+DYI MDC+MP M+GYEATR+IR+ EK   V  PIIA++ H  G EEA +T
Sbjct: 1035 EQGSVDKLPFDYIFMDCQMPEMDGYEATREIRKVEKSYGVRTPIIAVSGHDPGSEEARET 1094

Query: 1106 IEAGMDVHLGKPLNR 1120
            I+AGMD  L K LN+
Sbjct: 1095 IQAGMDAFLDKSLNQ 1109




Essential protein. Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. Required for the development of megagametophyte in female gametophyte (embryo sac) independently of cytokinin. Contributes to vascular bundle formation and secondary growth in a cytokinin-independent manner, probably by promoting the maintenance of mitotic activity and/or identity of procambial cells. Seems to influence and promote the cytokinin signaling pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 3EC: .EC: 3
>sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 Back     alignment and function description
>sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) GN=rpfC PE=1 SV=2 Back     alignment and function description
>sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 Back     alignment and function description
>sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 Back     alignment and function description
>sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 Back     alignment and function description
>sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 Back     alignment and function description
>sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 Back     alignment and function description
>sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1131
2241309961130 predicted protein [Populus trichocarpa] 0.944 0.945 0.532 0.0
2241024771136 predicted protein [Populus trichocarpa] 0.937 0.933 0.519 0.0
2241041831119 predicted protein [Populus trichocarpa] 0.933 0.943 0.512 0.0
2555484691138 histidine kinase 1 plant, putative [Rici 0.933 0.927 0.512 0.0
2254375471110 PREDICTED: histidine kinase CKI1-like [V 0.922 0.939 0.518 0.0
3565039261056 PREDICTED: histidine kinase CKI1-like [G 0.906 0.970 0.481 0.0
4494541351038 PREDICTED: histidine kinase CKI1-like [C 0.882 0.961 0.478 0.0
1478617781143 hypothetical protein VITISV_032223 [Viti 0.804 0.796 0.532 0.0
4494909171001 PREDICTED: LOW QUALITY PROTEIN: histidin 0.829 0.937 0.481 0.0
152265941122 histidine kinase CKI1 [Arabidopsis thali 0.930 0.937 0.421 0.0
>gi|224130996|ref|XP_002320976.1| predicted protein [Populus trichocarpa] gi|222861749|gb|EEE99291.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1161 (53%), Positives = 790/1161 (68%), Gaps = 93/1161 (8%)

Query: 3    ALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSATNLAR 62
             + VLLLP  ++P+WY M KH+++ +  +++ + S + S+IE+IA  LHPI+SSA NLA+
Sbjct: 19   VIGVLLLPCVVVPWWYNMIKHMKKHMDFNAHVVQSGLLSEIENIAKYLHPINSSAINLAK 78

Query: 63   VISSSLNNGTELSFSEIETK-----------------ISYIGLDGLFISYYVDGNQTLAL 105
            V+SSS+N G++LS  ++E K                 ISYIGL GLF SYY +GNQT A+
Sbjct: 79   VMSSSIN-GSKLSSYDVENKVAPSLFQAFSIIPFISQISYIGLGGLFFSYYYEGNQTFAM 137

Query: 106  YSNSSFSPNPNGFPIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNSTD 165
            YSNS+ S   N        ++WY+QPVD DTG++YG+A+ + P   + ++W  +ALNS+ 
Sbjct: 138  YSNSTASNERN--------FSWYRQPVDSDTGRVYGDAVKSLPFIKTNASWIEQALNSSQ 189

Query: 166  GLGSLGTGWSKARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATNDG 225
            G  S  +GW+ A+D LFLNT  + G +GA+SLGF  K +T+    + LYGG L +AT  G
Sbjct: 190  GYASFESGWNDAQDPLFLNTVSLRG-QGALSLGFSAKALTSFLNNVELYGGSLYLATQSG 248

Query: 226  KVLVQGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLS-----IGKIH 280
            KVLV G+PNT+  I  +S+S  +   TK    Q++ V NVSC   NG L      +G+  
Sbjct: 249  KVLVGGLPNTQTVIKENSVSLYM---TKLNGDQIDHVGNVSCMPNNGKLEDSVLYLGEAK 305

Query: 281  YKAYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSA 340
            Y+ +CS+ E+ GV+SVYALA P  GL S V+R+ K +LIL I+M   + IS+++F+    
Sbjct: 306  YRVFCSRVEIVGVQSVYALAFPYNGLASSVNRSIKISLILFIIMIAAIFISIVSFILLVV 365

Query: 341  RAARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAG 400
            R+AR+EMHLC++LIKQMEATQQAERKSMNKSLAFA ASHDIRAALAGITGLIE+CY E  
Sbjct: 366  RSARREMHLCSTLIKQMEATQQAERKSMNKSLAFATASHDIRAALAGITGLIEICYAEVR 425

Query: 401  PGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPV 460
             GSEL+TNLRQM+ C  DL+GLLNSILDTSK+EAGKMQL EE+FD+ +LLED VDL+HPV
Sbjct: 426  AGSELDTNLRQMDGCTKDLVGLLNSILDTSKIEAGKMQLEEEEFDLAKLLEDAVDLYHPV 485

Query: 461  AMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPS 520
             M+KGV+VVLDP DGS+LK S+VKGDR KLKQ+L NLLSNAVKFT EGH+SVRA  +KPS
Sbjct: 486  GMKKGVDVVLDPYDGSILKHSRVKGDRGKLKQVLCNLLSNAVKFTFEGHVSVRAWTQKPS 545

Query: 521  AIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPK 580
             + N  ++S+++G  +  SCLF KNKK        NA +  +++MEF FEV+DTGKGIPK
Sbjct: 546  -LENKIMASNQNGLWRCFSCLFSKNKKE------FNAMKPKQSSMEFVFEVNDTGKGIPK 598

Query: 581  EKRKTVFENYVQVKE---GEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVF 637
            EK+K+VFEN+VQVKE   G+GGTGLGLGIVQSLVRLMGG+I IV+KENGE+GTCF+FNVF
Sbjct: 599  EKQKSVFENFVQVKETALGQGGTGLGLGIVQSLVRLMGGEIGIVNKENGEKGTCFKFNVF 658

Query: 638  LAIREASANDN-NTQGEKELAGGDSAAGDTQLQHMNLTVKAPSPSLSIRTNSPRLNILSP 696
            L I E S+ DN N + E E   GDS  G     +  LT++ PSP L IRT SPRL+IL  
Sbjct: 659  LDICEISSTDNKNAEVEIE---GDSMPGGEH-NYSELTIRTPSPGLVIRTPSPRLSILGS 714

Query: 697  GSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPH 756
              + EGSHVVLLI NEER R +QK++E LGI VS+V  WE LHSTLKR+K++     SPH
Sbjct: 715  SPKIEGSHVVLLIQNEERLRSSQKYIEGLGIKVSSVKEWEHLHSTLKRIKARQNV--SPH 772

Query: 757  SSLGKSDLSSRSDS-ESASFKEVPLSAMEGTEHKLQGY---KRRGAPSFILLVIDATAGP 812
            SS GKSDL SRSD   S S K+VPLS+M+G + K         RGAP F+LLVIDA AGP
Sbjct: 773  SSSGKSDLGSRSDHFNSRSMKDVPLSSMDGIDQKPSASGSSNLRGAPGFVLLVIDAGAGP 832

Query: 813  FLELFNIVAEFRRDLQCNC-KVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLY 871
            F EL  +VAEF+RDL  +C KVVWLDKPTSRSIN    E + +DP DD+LLKPFHGSRLY
Sbjct: 833  FQELCRVVAEFKRDLHSSCCKVVWLDKPTSRSINLRSFEQDLIDPRDDILLKPFHGSRLY 892

Query: 872  KVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRHEIQEEGSSSSEHSR 931
            +VI+LLPEFGG     H   SR             + +  +    + +++ GSSSS HS+
Sbjct: 893  QVIRLLPEFGG-----HELISR-------------SKRENAIQATNALKDPGSSSSTHSQ 934

Query: 932  RDIMPNASVL---LKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGS-SRYKQTEIEEEDG 987
            +  +   S      +  +S  EG  ++     + LL   + S   S SR+K         
Sbjct: 935  KTKLKVPSTCENSFQQVDSQAEGSSKNEKNRKNPLLDDPDHSHVRSKSRHKG-------- 986

Query: 988  ERSQAQKPLRGKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRD 1047
                  K L G K LVADD+ + RRV    L+  GATVE CENGE A QLVR GL++QR+
Sbjct: 987  ------KSLSGLKFLVADDNEISRRVTRHILKGHGATVEVCENGEEAFQLVRIGLHNQRE 1040

Query: 1048 LGAPHILPYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISGEEADKTIE 1107
                 +LPYDYILMDCEMP M+G EATR+IR+EEK   VHIPI+A +A  SG E  K  E
Sbjct: 1041 HSHSIVLPYDYILMDCEMPKMDGCEATRQIRKEEKFYGVHIPILAFSADNSGGEGKKMEE 1100

Query: 1108 AGMDVHLGKPLNRDHLMEAIK 1128
            AG D  + K +N + L E I+
Sbjct: 1101 AGTDGRVNKKINMEQLEETIR 1121




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224102477|ref|XP_002312692.1| predicted protein [Populus trichocarpa] gi|222852512|gb|EEE90059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104183|ref|XP_002333975.1| predicted protein [Populus trichocarpa] gi|222839404|gb|EEE77741.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548469|ref|XP_002515291.1| histidine kinase 1 plant, putative [Ricinus communis] gi|223545771|gb|EEF47275.1| histidine kinase 1 plant, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225437547|ref|XP_002270319.1| PREDICTED: histidine kinase CKI1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503926|ref|XP_003520750.1| PREDICTED: histidine kinase CKI1-like [Glycine max] Back     alignment and taxonomy information
>gi|449454135|ref|XP_004144811.1| PREDICTED: histidine kinase CKI1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147861778|emb|CAN78916.1| hypothetical protein VITISV_032223 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449490917|ref|XP_004158748.1| PREDICTED: LOW QUALITY PROTEIN: histidine kinase CKI1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15226594|ref|NP_182265.1| histidine kinase CKI1 [Arabidopsis thaliana] gi|75097398|sp|O22267.1|CKI1_ARATH RecName: Full=Histidine kinase CKI1; AltName: Full=Protein CYTOKININ-INDEPENDENT 1 gi|1679803|dbj|BAA13416.1| histidine kinase homolog [Arabidopsis thaliana] gi|2529684|gb|AAC62867.1| putative histidine kinase [Arabidopsis thaliana] gi|330255746|gb|AEC10840.1| histidine kinase CKI1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1131
TAIR|locus:20619711122 CKI1 "CYTOKININ-INDEPENDENT 1" 0.748 0.754 0.418 7.7e-196
TAIR|locus:28278361207 HK1 "histidine kinase 1" [Arab 0.449 0.420 0.289 1.2e-61
TIGR_CMR|GSU_0718589 GSU_0718 "sensory box histidin 0.162 0.312 0.345 6.9e-34
TAIR|locus:20597181080 WOL "WOODEN LEG" [Arabidopsis 0.183 0.192 0.313 9.5e-34
TIGR_CMR|CBU_1084683 CBU_1084 "sensory box sensor h 0.138 0.229 0.345 2.1e-32
TIGR_CMR|SO_08591765 SO_0859 "sensory box histidine 0.150 0.096 0.314 9.2e-32
TIGR_CMR|SPO_0132739 SPO_0132 "sensor histidine kin 0.133 0.204 0.348 3.5e-31
TIGR_CMR|GSU_1265445 GSU_1265 "sensor histidine kin 0.112 0.285 0.36 1.5e-30
TAIR|locus:21772611176 HK2 "histidine kinase 2" [Arab 0.282 0.272 0.282 1e-29
TIGR_CMR|CBU_0789831 CBU_0789 "sensory box histidin 0.137 0.186 0.339 1.6e-29
TAIR|locus:2061971 CKI1 "CYTOKININ-INDEPENDENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1599 (567.9 bits), Expect = 7.7e-196, Sum P(2) = 7.7e-196
 Identities = 384/917 (41%), Positives = 539/917 (58%)

Query:     3 ALSVLLLPASLIPYWYKMTKHIEEDVALSSNQLHSAMQSQIESIATLLHPISSSAT-NLA 61
             A  V++     I  W   T+++ ++VA  +  L +++ S+IE+I    +  ++ +T  LA
Sbjct:    21 AFLVVVFECIWISNWRTTTENLVKEVASFTEDLRTSLVSEIENIGKFTYAKTNLSTIGLA 80

Query:    62 RVISSSLNNGTELSFSEIETKI-----------------SYIGLDGLFISYYVDGNQTLA 104
             RVI S + N  +  F+EI+T+I                 SYI  DGL  SY  + N ++A
Sbjct:    81 RVIDSYITNN-DTGFTEIQTQIAPLLFVAYSTILQVSQVSYISRDGLMFSYIAESNTSVA 139

Query:   105 LYXXXXXXXXXXXXXIAKGKYTWYKQPVDRDTGKLYGEAIVTKPSSVSTSTWFLKALNST 164
             ++              ++G YTWY Q VD+ TG+L G +  ++   V+ + WF  A ++ 
Sbjct:   140 VFANSSSNS-------SRGDYTWYTQTVDQLTGRLNGNSTKSQSLDVTHTDWFQAAQSNN 192

Query:   165 DGLGSLGTGWS-KARDALFLNTAGINGTRGAVSLGFPVKPITNLFAGINLYGGRLSIATN 223
                  +GT    +  + L  +   +   +G VSLGFPVK +T +   +NL+G  L + T 
Sbjct:   193 YTTAFVGTSLGGEDNETLIQSVVSLYSKKGLVSLGFPVKTLTEVLNSLNLHGEELYMWTK 252

Query:   224 DGKVLV-QGIPNTRMTIVNDSISFQLITNTKTRAQQMNPVKNVSCTSGNGTLSIGKIHYK 282
             DG VLV +G  N    I N SI F   +N+     Q  P +N  C+S    + I ++ Y+
Sbjct:   253 DGTVLVREGSLNDSFFISNGSICFGRESNSLW--SQCIP-EN--CSSSGYEVEIKRLRYQ 307

Query:   283 AYCSQFEVAGVKSVYALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISM-LTFVFKSAR 341
             A+CS  EV+GV   Y L  P KG  + +   +++A   LIV+ + +     + FV+   +
Sbjct:   308 AFCSVIEVSGVPLRYTLMFPNKGGATRIKHQAEKAKYQLIVVMIFLGFGWPVWFVWFMMQ 367

Query:   342 AARKEMHLCASLIKQMEATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGP 401
             A R+EMH+ A+LI QMEATQQAERKSMNKS AFANASHDIR ALAG+ GLI++C     P
Sbjct:   368 ATRREMHMRATLINQMEATQQAERKSMNKSQAFANASHDIRGALAGMKGLIDICRDGVKP 427

Query:   402 GSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVDLFHPVA 461
             GS+++T L Q+NVCA DL+ LLNS+LD SK+E+GKMQL+EEDF++ +LLEDV+D +HPVA
Sbjct:   428 GSDVDTTLNQVNVCAKDLVALLNSVLDMSKIESGKMQLVEEDFNLSKLLEDVIDFYHPVA 487

Query:   462 MRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSA 521
             M+KGV+VVLDP DGSV KFS V+GD  +LKQIL+NL+SNAVKFT +GHI+VRA  ++P +
Sbjct:   488 MKKGVDVVLDPHDGSVFKFSNVRGDSGRLKQILNNLVSNAVKFTVDGHIAVRAWAQRPGS 547

Query:   522 IGNPSLSSSRHGFLQSISCLFYKNKKARG--DLEAVNAAQRDENAMEFTFEVDDTGKGIP 579
               +  L+S   G  + +  +F KNK+     + E  N+ + + N MEF FEVDDTGKGIP
Sbjct:   548 NSSVVLASYPKGVSKFVKSMFCKNKEESSTYETEISNSIRNNANTMEFVFEVDDTGKGIP 607

Query:   580 KEKRKTVFENYVQVKXXXXXXXXXXX---IVQSLVRLMGGDIEIVDKENGERGTCFRFNV 636
              E RK+VFENYVQV+              IVQSLVRLMGG+I I DK  GE+GTCF+FNV
Sbjct:   608 MEMRKSVFENYVQVRETAQGHQGTGLGLGIVQSLVRLMGGEIRITDKAMGEKGTCFQFNV 667

Query:   637 FLAIREAS-ANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKAP-SPSLSIRTNSPRLN-I 693
              L   E+   +D   + E E AGGD  +      ++ LT+      S++IR  SPR N  
Sbjct:   668 LLTTLESPPVSDMKVRQEIE-AGGDYVS----TPNLGLTINTSLGGSMNIRNLSPRFNNC 722

Query:   694 LSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIH 753
             LS   + EGS VVLL+ NEERRR+ +K+++NLGI V+ V +WE L   L+RL   FG   
Sbjct:   723 LSSSPKQEGSRVVLLLKNEERRRVTEKYIKNLGIKVTVVEKWEHLSYALERL---FG--- 776

Query:   754 XXXXXXXXXXXXXXXXXXXXXFKEVPLSAMEGTEHKLQGYKRRGAP--SFILLVIDATAG 811
                                   +E+P   M+G + + Q  KRR     + +LLVIDA  G
Sbjct:   777 ---FSPQSSMGRAECSLSCPSSRELPFIGMDGIDSRSQLPKRRSISFSAVVLLVIDAKTG 833

Query:   812 PFLELFNIVAEFRRDLQ--CNCKVVWLDKPTSRSINFDGLEDETMDPNDDVLLKPFHGSR 869
             PF EL +IV +FRR L    +CKVVWL++ ++R            +  D    +P HGSR
Sbjct:   834 PFFELCDIVKQFRRGLPHGISCKVVWLNESSTR----------VSERGDISCSRPLHGSR 883

Query:   870 LYKVIKLLPEFGGVQSK 886
             L +V+K+LPEFGG   K
Sbjct:   884 LMEVLKMLPEFGGTVLK 900


GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000156 "phosphorelay response regulator activity" evidence=IEA;TAS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004673 "protein histidine kinase activity" evidence=IEA;ISS;IDA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016020 "membrane" evidence=IEA;IDA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0018106 "peptidyl-histidine phosphorylation" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=TAS
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0080117 "secondary growth" evidence=IMP
GO:0009553 "embryo sac development" evidence=IMP
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2827836 HK1 "histidine kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0718 GSU_0718 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2059718 WOL "WOODEN LEG" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1084 CBU_1084 "sensory box sensor histidine kinase/response regulator" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0859 SO_0859 "sensory box histidine kinase/response regulator" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0132 SPO_0132 "sensor histidine kinase/response regulator" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1265 GSU_1265 "sensor histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2177261 HK2 "histidine kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0789 CBU_0789 "sensory box histidine kinase/response regulator" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22267CKI1_ARATH2, ., 7, ., 1, 3, ., 30.42160.93010.9376yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.130.921
3rd Layer2.7.13.30.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1131
COG0642336 COG0642, BaeS, Signal transduction histidine kinas 5e-42
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 9e-41
PRK15347921 PRK15347, PRK15347, two component system sensor ki 6e-34
PRK11107919 PRK11107, PRK11107, hybrid sensory histidine kinas 1e-29
PRK11091779 PRK11091, PRK11091, aerobic respiration control se 2e-28
cd00156113 cd00156, REC, Signal receiver domain; originally t 6e-28
PRK11466914 PRK11466, PRK11466, hybrid sensory histidine kinas 1e-25
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 9e-25
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor k 1e-23
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 5e-23
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 1e-22
pfam00072111 pfam00072, Response_reg, Response regulator receiv 4e-22
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 1e-20
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine 1e-19
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 6e-19
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinas 7e-19
PRK15347 921 PRK15347, PRK15347, two component system sensor ki 7e-17
COG4191603 COG4191, COG4191, Signal transduction histidine ki 1e-16
COG0745 229 COG0745, OmpR, Response regulators consisting of a 3e-16
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinas 5e-15
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kina 2e-14
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kina 2e-14
PRK11091 779 PRK11091, PRK11091, aerobic respiration control se 4e-14
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; 4e-14
COG5002459 COG5002, VicK, Signal transduction histidine kinas 2e-13
COG2197211 COG2197, CitB, Response regulator containing a Che 7e-13
PRK09468 239 PRK09468, ompR, osmolarity response regulator; Pro 2e-12
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; 1e-11
COG3437 360 COG3437, COG3437, Response regulator containing a 3e-11
smart0044855 smart00448, REC, cheY-homologous receiver domain 9e-11
COG2204 464 COG2204, AtoC, Response regulator containing CheY- 1e-10
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; 1e-10
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provision 5e-10
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 9e-10
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinas 9e-10
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional 1e-09
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provision 2e-09
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provision 2e-09
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 5e-09
PRK13837828 PRK13837, PRK13837, two-component VirA-like sensor 8e-09
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regula 1e-08
COG4753 475 COG4753, COG4753, Response regulator containing Ch 2e-08
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 2e-08
COG3706 435 COG3706, PleD, Response regulator containing a Che 3e-08
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 6e-08
COG3852363 COG3852, NtrB, Signal transduction histidine kinas 7e-08
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regul 8e-08
COG3290537 COG3290, CitA, Signal transduction histidine kinas 1e-07
PRK10955 232 PRK10955, PRK10955, DNA-binding transcriptional re 3e-07
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein 5e-07
PRK10816 223 PRK10816, PRK10816, DNA-binding transcriptional re 6e-07
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) 7e-07
PRK09483217 PRK09483, PRK09483, response regulator; Provisiona 7e-07
pfam0051266 pfam00512, HisKA, His Kinase A (phospho-acceptor) 1e-06
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methyleste 1e-06
COG5000712 COG5000, NtrY, Signal transduction histidine kinas 2e-06
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methyleste 3e-06
COG3279 244 COG3279, LytT, Response regulator of the LytR/AlgR 3e-06
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II) 6e-06
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 7e-06
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisi 8e-06
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisiona 1e-05
PRK11083 228 PRK11083, PRK11083, DNA-binding response regulator 1e-05
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provi 1e-05
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/p 2e-05
PRK09470461 PRK09470, cpxA, two-component sensor protein; Prov 2e-05
PLN03029222 PLN03029, PLN03029, type-a response regulator prot 2e-05
COG3947 361 COG3947, COG3947, Response regulator containing Ch 7e-05
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory pro 1e-04
COG2201 350 COG2201, CheB, Chemotaxis response regulator conta 2e-04
PRK09836 227 PRK09836, PRK09836, DNA-binding transcriptional ac 3e-04
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory pro 4e-04
PRK10618894 PRK10618, PRK10618, phosphotransfer intermediate p 5e-04
PRK10755356 PRK10755, PRK10755, sensor protein BasS/PmrB; Prov 5e-04
PRK10815485 PRK10815, PRK10815, sensor protein PhoQ; Provision 5e-04
PRK10549466 PRK10549, PRK10549, signal transduction histidine- 7e-04
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL 7e-04
PRK15053545 PRK15053, dpiB, sensor histidine kinase DpiB; Prov 0.002
PRK15479 221 PRK15479, PRK15479, transcriptional regulatory pro 0.002
PRK10643 222 PRK10643, PRK10643, DNA-binding transcriptional re 0.004
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system 0.004
TIGR01387 218 TIGR01387, cztR_silR_copR, heavy metal response re 0.004
>gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
 Score =  156 bits (396), Expect = 5e-42
 Identities = 99/349 (28%), Positives = 156/349 (44%), Gaps = 60/349 (17%)

Query: 298 ALAMPRKGLVSLVHRTSKRALILLIVMTVGVLISMLTFVFKSARAARKEMHLCASLIKQM 357
           A  +    L+ L+ R   R L+LL      +   +   V  S  +    +   A  + ++
Sbjct: 47  AALLVALLLLLLLLRRLLRPLLLLADAANALAAGLTRLVLASLGSELASL---AHALNEL 103

Query: 358 EATQQAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCAN 417
               +   +   +    AN SH++R  L  I GL+EL  +  G        L  +   A 
Sbjct: 104 LERLERLLRRAKREFL-ANISHELRTPLTAIRGLLEL--LLEGLLDPQRELLEIIEEEAE 160

Query: 418 DLLGLLNSILDTSKVEAG-KMQLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGS 476
            LL L+N +LD S++EAG K++L+ E  D+ ELLE+VV L  P+A  KG+E+ +D  +  
Sbjct: 161 RLLRLVNDLLDLSRLEAGTKLKLLLELVDLAELLEEVVRLLAPLAQEKGIELAVDLPELP 220

Query: 477 VLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQ 536
                 V GD  +L+Q+L NLLSNA+K+T  G I++                        
Sbjct: 221 Y-----VLGDPERLRQVLVNLLSNAIKYTPGGEITISV---------------------- 253

Query: 537 SISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEG 596
                                    ++  + T  V+DTG GIP+E+ + +FE + +  + 
Sbjct: 254 ------------------------RQDDEQVTISVEDTGPGIPEEELERIFEPFFRTDKS 289

Query: 597 EGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASA 645
             GTGLGL IV+ +V L GG I +  +    +GT F   + LA   A A
Sbjct: 290 RSGTGLGLAIVKRIVELHGGTISVESEPG--KGTTFTIRLPLAPAAADA 336


Length = 336

>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|226654 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional Back     alignment and domain information
>gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|236538 PRK09483, PRK09483, response regulator; Provisional Back     alignment and domain information
>gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain Back     alignment and domain information
>gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|227333 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|225818 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>gnl|CDD|236751 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>gnl|CDD|182754 PRK10815, PRK10815, sensor protein PhoQ; Provisional Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information
>gnl|CDD|185013 PRK15053, dpiB, sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1131
PRK10841924 hybrid sensory kinase in two-component regulatory 100.0
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK15347921 two component system sensor kinase SsrA; Provision 100.0
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 100.0
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK11091779 aerobic respiration control sensor protein ArcB; P 100.0
PRK099591197 hybrid sensory histidine kinase in two-component r 100.0
PRK13837828 two-component VirA-like sensor kinase; Provisional 100.0
PRK10618894 phosphotransfer intermediate protein in two-compon 100.0
KOG0519786 consensus Sensory transduction histidine kinase [S 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 100.0
PRK13557540 histidine kinase; Provisional 100.0
PRK09303380 adaptive-response sensory kinase; Validated 100.0
COG4191603 Signal transduction histidine kinase regulating C4 100.0
PRK10815485 sensor protein PhoQ; Provisional 100.0
PRK11006430 phoR phosphate regulon sensor protein; Provisional 99.98
PRK10604433 sensor protein RstB; Provisional 99.98
PRK09835482 sensor kinase CusS; Provisional 99.98
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 99.97
PRK10364457 sensor protein ZraS; Provisional 99.97
PRK10755356 sensor protein BasS/PmrB; Provisional 99.97
PRK10490895 sensor protein KdpD; Provisional 99.97
PRK10337449 sensor protein QseC; Provisional 99.97
PRK10549466 signal transduction histidine-protein kinase BaeS; 99.97
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 99.97
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 99.97
PRK09470461 cpxA two-component sensor protein; Provisional 99.96
PRK11100475 sensory histidine kinase CreC; Provisional 99.96
PRK09467435 envZ osmolarity sensor protein; Provisional 99.96
COG4251750 Bacteriophytochrome (light-regulated signal transd 99.95
COG3852363 NtrB Signal transduction histidine kinase, nitroge 99.95
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 99.95
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 99.95
PRK11360607 sensory histidine kinase AtoS; Provisional 99.94
COG0642336 BaeS Signal transduction histidine kinase [Signal 99.93
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 99.92
PRK13560807 hypothetical protein; Provisional 99.9
PRK11086542 sensory histidine kinase DcuS; Provisional 99.9
PRK11644495 sensory histidine kinase UhpB; Provisional 99.89
COG5000712 NtrY Signal transduction histidine kinase involved 99.87
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 99.87
COG4192673 Signal transduction histidine kinase regulating ph 99.84
COG0745 229 OmpR Response regulators consisting of a CheY-like 99.83
PRK13559361 hypothetical protein; Provisional 99.79
COG3290537 CitA Signal transduction histidine kinase regulati 99.75
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 99.75
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 99.73
COG4753 475 Response regulator containing CheY-like receiver d 99.7
PF00072112 Response_reg: Response regulator receiver domain; 99.69
COG2204 464 AtoC Response regulator containing CheY-like recei 99.68
COG3437 360 Response regulator containing a CheY-like receiver 99.67
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.66
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.64
COG2197211 CitB Response regulator containing a CheY-like rec 99.62
COG4566202 TtrR Response regulator [Signal transduction mecha 99.62
COG4565 224 CitB Response regulator of citrate/malate metaboli 99.6
PRK10547670 chemotaxis protein CheA; Provisional 99.58
COG3706 435 PleD Response regulator containing a CheY-like rec 99.56
PLN03029222 type-a response regulator protein; Provisional 99.54
PRK10046 225 dpiA two-component response regulator DpiA; Provis 99.54
PRK09581 457 pleD response regulator PleD; Reviewed 99.53
PRK11173 237 two-component response regulator; Provisional 99.49
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provis 99.49
PRK10529 225 DNA-binding transcriptional activator KdpE; Provis 99.48
PRK09836 227 DNA-binding transcriptional activator CusR; Provis 99.48
PRK09468 239 ompR osmolarity response regulator; Provisional 99.46
PRK10643 222 DNA-binding transcriptional regulator BasR; Provis 99.46
PRK10766 221 DNA-binding transcriptional regulator TorR; Provis 99.45
COG3947 361 Response regulator containing CheY-like receiver a 99.44
PRK10161 229 transcriptional regulator PhoB; Provisional 99.44
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory 99.44
PRK10336 219 DNA-binding transcriptional regulator QseB; Provis 99.44
TIGR03787 227 marine_sort_RR proteobacterial dedicated sortase s 99.44
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provis 99.43
PRK13856 241 two-component response regulator VirG; Provisional 99.43
PRK10701 240 DNA-binding transcriptional regulator RstA; Provis 99.43
PRK10430 239 DNA-binding transcriptional activator DcuR; Provis 99.43
PRK10840216 transcriptional regulator RcsB; Provisional 99.41
TIGR02875 262 spore_0_A sporulation transcription factor Spo0A. 99.41
PRK11517 223 transcriptional regulatory protein YedW; Provision 99.4
PRK04184535 DNA topoisomerase VI subunit B; Validated 99.4
COG4567182 Response regulator consisting of a CheY-like recei 99.4
PRK11083 228 DNA-binding response regulator CreB; Provisional 99.4
TIGR01387 218 cztR_silR_copR heavy metal response regulator. Mem 99.39
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.36
CHL00148 240 orf27 Ycf27; Reviewed 99.36
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 99.35
PRK14084 246 two-component response regulator; Provisional 99.35
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.34
PRK15115 444 response regulator GlrR; Provisional 99.34
PRK09483217 response regulator; Provisional 99.33
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.32
PRK09935210 transcriptional regulator FimZ; Provisional 99.32
PRK12555 337 chemotaxis-specific methylesterase; Provisional 99.31
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.31
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.3
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.29
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.29
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provis 99.28
PRK11697 238 putative two-component response-regulatory protein 99.28
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.27
PRK15479 221 transcriptional regulatory protein TctD; Provision 99.26
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.26
PRK00742 354 chemotaxis-specific methylesterase; Provisional 99.22
PRK09390202 fixJ response regulator FixJ; Provisional 99.22
PF0051268 HisKA: His Kinase A (phospho-acceptor) domain; Int 99.21
TIGR01052488 top6b DNA topoisomerase VI, B subunit. This model 99.2
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.2
PRK09581 457 pleD response regulator PleD; Reviewed 99.19
COG2201 350 CheB Chemotaxis response regulator containing a Ch 99.18
PRK13558 665 bacterio-opsin activator; Provisional 99.15
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 99.14
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 99.14
PRK15411207 rcsA colanic acid capsular biosynthesis activation 99.14
PRK10403215 transcriptional regulator NarP; Provisional 99.14
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.14
PRK13435145 response regulator; Provisional 99.13
PRK15369211 two component system sensor kinase SsrB; Provision 99.13
PRK10651216 transcriptional regulator NarL; Provisional 99.13
COG3707194 AmiR Response regulator with putative antiterminat 99.1
PRK14867659 DNA topoisomerase VI subunit B; Provisional 99.09
PRK03660146 anti-sigma F factor; Provisional 99.05
PRK09191261 two-component response regulator; Provisional 99.02
COG3851497 UhpB Signal transduction histidine kinase, glucose 99.0
PRK10693 303 response regulator of RpoS; Provisional 98.97
COG4564459 Signal transduction histidine kinase [Signal trans 98.96
cd00156113 REC Signal receiver domain; originally thought to 98.91
COG4585365 Signal transduction histidine kinase [Signal trans 98.89
COG3920221 Signal transduction histidine kinase [Signal trans 98.87
COG2972456 Predicted signal transduction protein with a C-ter 98.85
COG0643716 CheA Chemotaxis protein histidine kinase and relat 98.82
COG3850574 NarQ Signal transduction histidine kinase, nitrate 98.8
KOG0519786 consensus Sensory transduction histidine kinase [S 98.71
PRK15029 755 arginine decarboxylase; Provisional 98.7
PRK04069161 serine-protein kinase RsbW; Provisional 98.68
COG3279 244 LytT Response regulator of the LytR/AlgR family [T 98.62
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 98.42
COG3275557 LytS Putative regulator of cell autolysis [Signal 98.37
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimer 98.32
PF14501100 HATPase_c_5: GHKL domain 98.32
KOG0787414 consensus Dehydrogenase kinase [Signal transductio 98.28
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 98.21
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacce 98.08
COG3706 435 PleD Response regulator containing a CheY-like rec 98.02
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 97.81
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 97.43
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, 97.37
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 96.95
PRK10618894 phosphotransfer intermediate protein in two-compon 96.74
smart0044855 REC cheY-homologous receiver domain. CheY regulate 96.64
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 96.6
PRK00095617 mutL DNA mismatch repair protein; Reviewed 96.22
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 96.2
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 95.6
PRK02261137 methylaspartate mutase subunit S; Provisional 95.55
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 93.6
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 92.48
PF00072112 Response_reg: Response regulator receiver domain; 92.46
PRK15426570 putative diguanylate cyclase YedQ; Provisional 91.71
COG0745229 OmpR Response regulators consisting of a CheY-like 91.69
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 91.44
PRK05559631 DNA topoisomerase IV subunit B; Reviewed 90.87
TIGR01055625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 89.66
TIGR01059654 gyrB DNA gyrase, B subunit. This model describes t 89.45
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 88.27
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) 88.16
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 87.82
PRK05218613 heat shock protein 90; Provisional 87.75
COG5381184 Uncharacterized protein conserved in bacteria [Fun 86.64
TIGR03815 322 CpaE_hom_Actino helicase/secretion neighborhood Cp 86.56
COG4999140 Uncharacterized domain of BarA-like signal transdu 85.9
COG4566202 TtrR Response regulator [Signal transduction mecha 83.75
PRK14083601 HSP90 family protein; Provisional 83.34
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 83.04
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 82.24
PRK05644638 gyrB DNA gyrase subunit B; Validated 82.2
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 82.17
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 81.98
PRK00208250 thiG thiazole synthase; Reviewed 81.88
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 80.43
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-54  Score=557.17  Aligned_cols=474  Identities=26%  Similarity=0.399  Sum_probs=345.7

Q ss_pred             HHHHHHHHHHHHHHHchHhhHHHHHHHHHHHHHHHhhCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCccee
Q 042553          362 QAERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIE  441 (1131)
Q Consensus       362 ~ae~~~~~ks~flA~iSHELRTPLt~I~g~~ell~~~~~~~~~~~~~l~~i~~~~~~Ll~LIndlLdlskie~g~~~l~~  441 (1131)
                      +++++++.|+.|+++|||||||||++|.|+++++... ...++.+++++.|..++++|..+|++|||++|++++++.++.
T Consensus       439 ~~e~a~~~k~~fla~iSHELRTPL~~I~g~lelL~~~-~~~~~~~~~l~~i~~~~~~L~~lI~dlLd~srie~~~~~l~~  517 (924)
T PRK10841        439 AAEQASQSKSMFLATVSHELRTPLYGIIGNLDLLQTK-ELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP  517 (924)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHhCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCceeee
Confidence            3455667788999999999999999999999987543 344677889999999999999999999999999999999999


Q ss_pred             eeecHHHHHHHHHHHHHHHHHcCCcEEEEccCCCCccccceEEeCHHHHHHHHHHHHHHHhhccCCCeEEEEEeecCCCC
Q 042553          442 EDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGHISVRACVKKPSA  521 (1131)
Q Consensus       442 ~~~dL~~ll~~v~~~~~~~a~~k~i~l~~~~~~~~~~~~~~v~gD~~rL~QIL~NLL~NAiKfT~~G~I~v~~~~~~~~~  521 (1131)
                      ++|++.+++++++..+.+.+..|++.+.++.++...   ..+.+|+.+|+|||.|||+||+|||+.|.|.|.+...    
T Consensus       518 ~~~~l~~li~~v~~~~~~~~~~k~i~l~~~i~~~~~---~~v~~D~~~L~qvl~NLl~NAik~t~~G~I~I~v~~~----  590 (924)
T PRK10841        518 REFSPREVINHITANYLPLVVKKRLGLYCFIEPDVP---VALNGDPMRLQQVISNLLSNAIKFTDTGCIVLHVRVD----  590 (924)
T ss_pred             EEecHHHHHHHHHHHHHHHHHHcCcEEEEEeCCCCC---cEEEECHHHHHHHHHHHHHHHHhhCCCCcEEEEEEEe----
Confidence            999999999999999999999999999877654322   3589999999999999999999999999888876431    


Q ss_pred             CCCCCCCCCccCcccchhhhhhccccccchhhhhhhhhccCCCcEEEEEEEecCCCCCcchHhhhccCCeecCC----CC
Q 042553          522 IGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKE----GE  597 (1131)
Q Consensus       522 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFe~F~q~~~----~~  597 (1131)
                                                                ...+.|+|.|||+||+++.++++|+||||.+.    ..
T Consensus       591 ------------------------------------------~~~l~i~V~DtG~GI~~e~~~~lFepF~~~~~~~~~~~  628 (924)
T PRK10841        591 ------------------------------------------GDYLSFRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNF  628 (924)
T ss_pred             ------------------------------------------CCEEEEEEEEcCcCCCHHHHHHHhcccccCCCCCCCCC
Confidence                                                      12578999999999999999999999999764    23


Q ss_pred             CCcccchHHHHHHHHHhCCEEEEEeecCCCccEEEEEEEeccccccccCCCCCcccccccCCCCCCCccccccccccccC
Q 042553          598 GGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLAIREASANDNNTQGEKELAGGDSAAGDTQLQHMNLTVKA  677 (1131)
Q Consensus       598 ~GtGLGLsIvk~Lv~~~gG~I~v~s~~~gg~Gt~f~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  677 (1131)
                      +|+||||+|||+|+++|||+|+++|.+  |.||+|+|.+|+........                              .
T Consensus       629 ~GtGLGL~I~k~lv~~~gG~I~v~S~~--g~Gt~F~i~LP~~~~~~~~~------------------------------~  676 (924)
T PRK10841        629 QGTGLGLAICEKLINMMDGDISVDSEP--GMGSQFTIRIPLYGAQYPQK------------------------------K  676 (924)
T ss_pred             CCeehhHHHHHHHHHHCCCEEEEEEcC--CCcEEEEEEEECCccccccc------------------------------c
Confidence            699999999999999999999999875  46999999998752110000                              0


Q ss_pred             CCCCccccCCCCccccCCCCCCCCCCeEEEEEeCHHHHHHHHHHHHHcCCeeeecccHHHHHHHHHHhhhcCCCccccCC
Q 042553          678 PSPSLSIRTNSPRLNILSPGSRHEGSHVVLLIANEERRRIAQKFMENLGINVSAVSRWERLHSTLKRLKSKFGSIHSPHS  757 (1131)
Q Consensus       678 ~~~~~~~~~~~~~~~~~~~~~~~~~~~vll~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~  757 (1131)
                      +                  .....+.++.+..++......+..++..+|+.+........                .   
T Consensus       677 ~------------------~~~~~g~~i~l~~~~~~~~~~l~~~l~~~G~~v~~~~~~~~----------------~---  719 (924)
T PRK10841        677 G------------------VEGLQGKRCWLAVRNASLEQFLETLLQRSGIQVQRYEGQEP----------------T---  719 (924)
T ss_pred             c------------------CcccCCCEEEEEcCCHHHHHHHHHHHHHCCCeEEEcccccC----------------C---
Confidence            0                  01234667888889999999999999999998865431100                0   


Q ss_pred             CCCCCCCCcCCCCccCCcccccccccccchhhhccccccCCCceEEEEecCCCcchHHHHHHHHHHhhhcccceeEEEcc
Q 042553          758 SLGKSDLSSRSDSESASFKEVPLSAMEGTEHKLQGYKRRGAPSFILLVIDATAGPFLELFNIVAEFRRDLQCNCKVVWLD  837 (1131)
Q Consensus       758 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~vid~~~~~~~~~~~~~~~~~~~~~~~~~vv~l~  837 (1131)
                         ..                                       .+++.|............+ .+.            .
T Consensus       720 ---~~---------------------------------------d~~i~d~~~~~~~~~~~~~-~~~------------~  744 (924)
T PRK10841        720 ---PE---------------------------------------DVLITDDPVQKKWQGRAVI-TFC------------R  744 (924)
T ss_pred             ---cC---------------------------------------cEEEEcCccccccchhhhh-hhh------------h
Confidence               00                                       0000110000000000000 000            0


Q ss_pred             CCCccccccCCCccccCCCCCccccccccchhHHHHHhhcCccCCcccccccccccccCCCCCcCCCcccCCcCcccccc
Q 042553          838 KPTSRSINFDGLEDETMDPNDDVLLKPFHGSRLYKVIKLLPEFGGVQSKRHGKASRDAGSSSYSKHPYRTGKSRSKAGRH  917 (1131)
Q Consensus       838 ~~~~~~i~~~~l~~~~~~~~~~~l~kP~~~s~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  917 (1131)
                      .+...       ...  ......+.+|.....+...+..+......                                  
T Consensus       745 ~~~~~-------~~~--~~~~~~~~~~~~~~~l~~~l~~~~~~~~~----------------------------------  781 (924)
T PRK10841        745 RHIGI-------PLE--IAPGEWVHSTATPHELPALLARIYRIELE----------------------------------  781 (924)
T ss_pred             ccccC-------hhh--cccCceeeccCChHHHHHHHHHHhhcccc----------------------------------
Confidence            00000       000  00011122333333333332211000000                                  


Q ss_pred             cccccCCCCccccccccCCcchhhhhcCCCCCCCCCccCCCCcccccccCCCCCCCCcceeecccccccccccccCCCCC
Q 042553          918 EIQEEGSSSSEHSRRDIMPNASVLLKTGNSSGEGPRRDIMPNASVLLKTGNSSGEGSSRYKQTEIEEEDGERSQAQKPLR  997 (1131)
Q Consensus       918 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~  997 (1131)
                                       .+.             .+..  .+                             ..........
T Consensus       782 -----------------~~~-------------~~~~--~~-----------------------------~~~~~~~~~~  800 (924)
T PRK10841        782 -----------------SDD-------------SANA--LP-----------------------------STDKAVSDND  800 (924)
T ss_pred             -----------------ccc-------------cccc--cc-----------------------------ccccccccCC
Confidence                             000             0000  00                             0000011123


Q ss_pred             CCeEEEEeCCHHHHHHHHHHHHhCCCEEEEECCHHHHHHHHHhcCCCCCCCCCCCCCCccEEEEcCCCCCCCHHHHHHHH
Q 042553          998 GKKILVADDSMMLRRVAEINLRHLGATVEACENGEAALQLVRSGLNDQRDLGAPHILPYDYILMDCEMPIMNGYEATRKI 1077 (1131)
Q Consensus       998 ~~~ILvvdD~~~~~~~l~~~L~~~g~~v~~a~ng~eAl~~~~~~~~~~~~~~~~~~~~~DlILmDi~MP~mdG~e~~r~I 1077 (1131)
                      +.+||||||++.++..+..+|++.||.|..|.||++|++.+.+.             +||+||||++||+|||++++++|
T Consensus       801 ~~~ILvVdD~~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~~-------------~~DlVl~D~~mP~mdG~el~~~i  867 (924)
T PRK10841        801 DMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKN-------------HIDIVLTDVNMPNMDGYRLTQRL  867 (924)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHcCCEEEEECCHHHHHHHHHhC-------------CCCEEEEcCCCCCCCHHHHHHHH
Confidence            56899999999999999999999999999999999999999763             79999999999999999999999


Q ss_pred             hhhhccCCCCccEEEEcccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHh
Q 042553         1078 REEEKRNQVHIPIIALTAHISGEEADKTIEAGMDVHLGKPLNRDHLMEAIKYL 1130 (1131)
Q Consensus      1078 R~~~~~~~~~ipIIalTa~~~~~~~~~~l~aG~d~yL~KP~~~~~L~~~I~~l 1130 (1131)
                      |+..    +.+|||++|++...++..+|+++||++||.||++.++|..+|..+
T Consensus       868 r~~~----~~~pII~lTa~~~~~~~~~~~~aG~d~~L~KPv~~~~L~~~L~~~  916 (924)
T PRK10841        868 RQLG----LTLPVIGVTANALAEEKQRCLEAGMDSCLSKPVTLDVLKQTLTVY  916 (924)
T ss_pred             HhcC----CCCCEEEEECCCCHHHHHHHHHCCCCEEEeCCCCHHHHHHHHHHH
Confidence            9853    468999999999999999999999999999999999999988754



>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information
>KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK15426 putative diguanylate cyclase YedQ; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1131
3mm4_A206 Crystal Structure Of The Receiver Domain Of The His 1e-29
3dge_C122 Structure Of A Histidine Kinase-response Regulator 4e-11
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 3e-10
4euk_A153 Crystal Structure Length = 153 6e-10
2ayz_A133 Solution Structure Of The E.Coli Rcsc C-Terminus (R 1e-08
2ayx_A254 Solution Structure Of The E.Coli Rcsc C-Terminus (R 2e-08
3f6p_A120 Crystal Structure Of Unphosphorelated Receiver Doma 3e-08
2zwm_A130 Crystal Structure Of Yycf Receiver Domain From Baci 3e-08
3to5_A134 High Resolution Structure Of Chey3 From Vibrio Chol 8e-08
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 2e-07
3c97_A140 Crystal Structure Of The Response Regulator Receive 5e-07
4ew8_A268 Crystal Structure Of A C-Terminal Part Of Tyrosine 9e-07
3kht_A144 Crystal Structure Of Response Regulator From Hahell 1e-06
3a0u_A116 Crystal Structure Of Response Regulator Protein Trr 1e-06
3h1g_A129 Crystal Structure Of Chey Mutant T84a Of Helicobact 2e-06
3ffx_A128 Crystal Structure Of Chey Triple Mutant F14e, N59r, 6e-06
3gwg_A129 Crystal Structure Of Chey Of Helicobacter Pylori Le 7e-06
3nnn_A122 Bef3 Activated Drrd Receiver Domain Length = 122 9e-06
3a0r_B116 Crystal Structure Of Histidine Kinase Thka (Tm1359) 9e-06
3rvn_A132 Structure Of The Chey-Bef3 Complex With Substitutio 2e-05
3ffw_A128 Crystal Structure Of Chey Triple Mutant F14q, N59k, 2e-05
3rvj_A132 Structure Of The Chey-Bef3 Complex With Substitutio 3e-05
2r25_B133 Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef 3e-05
1oxb_B134 Complex Between Ypd1 And Sln1 Response Regulator Do 3e-05
3rvl_A132 Structure Of The Chey-Bef3 Complex With Substitutio 4e-05
1udr_A129 Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep 4e-05
3rvp_A132 Structure Of The Chey-Bef3 Complex With Substitutio 4e-05
1ab5_A125 Structure Of Chey Mutant F14n, V21t Length = 125 4e-05
1cye_A129 Three Dimensional Structure Of Chemotactic Che Y Pr 5e-05
1kgs_A 225 Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG 5e-05
3fft_A128 Crystal Structure Of Chey Double Mutant F14e, E89r 6e-05
1mvo_A136 Crystal Structure Of The Phop Receiver Domain From 6e-05
1d4z_A128 Crystal Structure Of Chey-95iv, A Hyperactive Chey 7e-05
2chy_A128 Three-Dimensional Structure Of Chey, The Response R 7e-05
3m6m_D143 Crystal Structure Of Rpff Complexed With Rec Domain 7e-05
3h1f_A129 Crystal Structure Of Chey Mutant D53a Of Helicobact 7e-05
1ab6_A125 Structure Of Chey Mutant F14n, V86t Length = 125 8e-05
1cey_A128 Assignments, Secondary Structure, Global Fold, And 8e-05
1mih_A129 A Role For Chey Glu 89 In Chez-Mediated Dephosphory 9e-05
3fgz_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 9e-05
1djm_A129 Solution Structure Of Bef3-Activated Chey From Esch 9e-05
3oo0_A129 Structure Of Apo Chey A113p Length = 129 9e-05
1eay_A128 Chey-Binding (P2) Domain Of Chea In Complex With Ch 9e-05
3myy_A128 Structure Of E. Coli Chey Mutant A113p Bound To Ber 9e-05
2che_A128 Structure Of The Mg2+-Bound Form Of Chey And Mechan 1e-04
2fka_A129 Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che 1e-04
1nxo_A120 Micarec Ph7.0 Length = 120 1e-04
1jbe_A128 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co 1e-04
3nhz_A125 Structure Of N-Terminal Domain Of Mtra Length = 125 1e-04
3f7n_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 2e-04
3olx_A129 Structural And Functional Effects Of Substitution A 2e-04
5chy_A128 Structure Of Chemotaxis Protein Chey Length = 128 2e-04
3olv_A129 Structural And Functional Effects Of Substitution A 2e-04
3olw_A129 Structural And Functional Effects Of Substitution A 3e-04
1ymu_A130 Signal Transduction Protein Chey Mutant With Met 17 3e-04
3oly_A129 Structural And Functional Effects Of Substitution A 3e-04
1vlz_A128 Uncoupled Phosphorylation And Activation In Bacteri 3e-04
1ymv_A129 Signal Transduction Protein Chey Mutant With Phe 14 4e-04
1e6m_A128 Two-Component Signal Transduction System D57a Mutan 4e-04
3t6k_A136 Crystal Structure Of A Hypothetical Response Regula 4e-04
1e6k_A130 Two-Component Signal Transduction System D12a Mutan 5e-04
1ehc_A128 Structure Of Signal Transduction Protein Chey Lengt 6e-04
1p2f_A 220 Crystal Structure Analysis Of Response Regulator Dr 6e-04
3nns_A117 Bef3 Activated Drrb Receiver Domain Length = 117 6e-04
3a0r_A349 Crystal Structure Of Histidine Kinase Thka (Tm1359) 7e-04
1dcf_A136 Crystal Structure Of The Receiver Domain Of The Eth 7e-04
1zdm_A129 Crystal Structure Of Activated Chey Bound To Xe Len 7e-04
1c4w_A128 1.9 A Structure Of A-Thiophosphonate Modified Chey 7e-04
3dge_A258 Structure Of A Histidine Kinase-response Regulator 7e-04
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 7e-04
1e6l_A127 Two-Component Signal Transduction System D13a Mutan 8e-04
1nxt_A120 Micarec Ph 4.0 Length = 120 8e-04
3eod_A130 Crystal Structure Of N-Terminal Domain Of E. Coli R 9e-04
>pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 Back     alignment and structure

Iteration: 1

Score = 129 bits (323), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 65/127 (51%), Positives = 90/127 (70%), Gaps = 2/127 (1%) Query: 996 LRGKKILVADDSMMLRRVAEINLRHLGAT-VEACENGEAALQLVRSGLNDQRDLGAPHIL 1054 LRGK++LV DD+ + R+VA L+ +G + VE C++G+ AL+LV GL + + G+ L Sbjct: 59 LRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGKEALRLVTEGLTQREEQGSVDKL 118 Query: 1055 PYDYILMDCEMPIMNGYEATRKIREEEKRNQVHIPIIALTAHISG-EEADKTIEAGMDVH 1113 P+DYI MDC+MP M+GYEATR+IR+ EK V PIIA++ H G EEA +TI+AGMD Sbjct: 119 PFDYIFMDCQMPEMDGYEATREIRKVEKSYGVRTPIIAVSGHDPGSEEARETIQAGMDAF 178 Query: 1114 LGKPLNR 1120 L K LN+ Sbjct: 179 LDKSLNQ 185
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|4EUK|A Chain A, Crystal Structure Length = 153 Back     alignment and structure
>pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 Back     alignment and structure
>pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 Back     alignment and structure
>pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 Back     alignment and structure
>pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 Back     alignment and structure
>pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 Back     alignment and structure
>pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 Back     alignment and structure
>pdb|4EW8|A Chain A, Crystal Structure Of A C-Terminal Part Of Tyrosine Kinase (Divl) From Caulobacter Crescentus Cb15 At 2.50 A Resolution Length = 268 Back     alignment and structure
>pdb|3KHT|A Chain A, Crystal Structure Of Response Regulator From Hahella Chejuensis Length = 144 Back     alignment and structure
>pdb|3A0U|A Chain A, Crystal Structure Of Response Regulator Protein Trra (Tm1360) From Thermotoga Maritima In Complex With Mg(2+)- Bef (Wild Type) Length = 116 Back     alignment and structure
>pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 Back     alignment and structure
>pdb|3A0R|B Chain B, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 116 Back     alignment and structure
>pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 Back     alignment and structure
>pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 Back     alignment and structure
>pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3- Length = 133 Back     alignment and structure
>pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain In Space Group P2(1)2(1)2(1) Length = 134 Back     alignment and structure
>pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 Back     alignment and structure
>pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 Back     alignment and structure
>pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 Back     alignment and structure
>pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 Back     alignment and structure
>pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 Back     alignment and structure
>pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM THERMOTOGA Maritima Length = 225 Back     alignment and structure
>pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 Back     alignment and structure
>pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 Back     alignment and structure
>pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 Back     alignment and structure
>pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 Back     alignment and structure
>pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 Back     alignment and structure
>pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 Back     alignment and structure
>pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 Back     alignment and structure
>pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 Back     alignment and structure
>pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 Back     alignment and structure
>pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 Back     alignment and structure
>pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 Back     alignment and structure
>pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 Back     alignment and structure
>pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 Back     alignment and structure
>pdb|3NHZ|A Chain A, Structure Of N-Terminal Domain Of Mtra Length = 125 Back     alignment and structure
>pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 Back     alignment and structure
>pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 Back     alignment and structure
>pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 Back     alignment and structure
>pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 Back     alignment and structure
>pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 Back     alignment and structure
>pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 Back     alignment and structure
>pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 Back     alignment and structure
>pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 Back     alignment and structure
>pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 Back     alignment and structure
>pdb|1P2F|A Chain A, Crystal Structure Analysis Of Response Regulator Drrb, A Thermotoga Maritima OmprPHOB HOMOLOG Length = 220 Back     alignment and structure
>pdb|3NNS|A Chain A, Bef3 Activated Drrb Receiver Domain Length = 117 Back     alignment and structure
>pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 Back     alignment and structure
>pdb|1DCF|A Chain A, Crystal Structure Of The Receiver Domain Of The Ethylene Receptor Of Arabidopsis Thaliana Length = 136 Back     alignment and structure
>pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 Back     alignment and structure
>pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 Back     alignment and structure
>pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 Back     alignment and structure
>pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure
>pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 Back     alignment and structure
>pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 Back     alignment and structure
>pdb|3EOD|A Chain A, Crystal Structure Of N-Terminal Domain Of E. Coli Rssb Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1131
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 1e-55
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 5e-52
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 1e-45
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 1e-43
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 3e-40
2ayx_A254 Sensor kinase protein RCSC; two independent struct 7e-40
1mb3_A124 Cell division response regulator DIVK; signal tran 2e-39
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 1e-38
3c97_A140 Signal transduction histidine kinase; structural g 1e-38
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 2e-38
3i42_A127 Response regulator receiver domain protein (CHEY- 1e-36
3luf_A259 Two-component system response regulator/ggdef doma 3e-35
3luf_A 259 Two-component system response regulator/ggdef doma 2e-18
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 1e-30
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 9e-30
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 1e-29
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 2e-28
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 2e-28
3grc_A140 Sensor protein, kinase; protein structure initiati 1e-26
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 1e-26
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 6e-26
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 1e-25
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 2e-25
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 2e-25
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 4e-24
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 3e-23
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 4e-23
3heb_A152 Response regulator receiver domain protein (CHEY); 7e-23
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 3e-22
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 4e-22
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 5e-22
3hdg_A137 Uncharacterized protein; two-component sensor acti 5e-22
3h5i_A140 Response regulator/sensory box protein/ggdef domai 9e-22
1w25_A 459 Stalked-cell differentiation controlling protein; 2e-21
1w25_A 459 Stalked-cell differentiation controlling protein; 2e-13
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 2e-21
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 5e-21
3a10_A116 Response regulator; phosphoacceptor, signaling pro 3e-20
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 3e-20
1srr_A124 SPO0F, sporulation response regulatory protein; as 7e-20
2qxy_A142 Response regulator; regulation of transcription, N 2e-19
3lte_A132 Response regulator; structural genomics, PSI, prot 2e-19
3bre_A 358 Probable two-component response regulator; protein 4e-19
3cnb_A143 DNA-binding response regulator, MERR family; signa 4e-19
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 4e-19
3c3m_A138 Response regulator receiver protein; structural ge 5e-19
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 5e-19
3gt7_A154 Sensor protein; structural genomics, signal receiv 5e-19
3eq2_A 394 Probable two-component response regulator; adaptor 9e-19
3lua_A140 Response regulator receiver protein; two-component 1e-18
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 1e-18
3nhm_A133 Response regulator; protein structure initiative I 1e-18
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 2e-18
2zay_A147 Response regulator receiver protein; structural ge 2e-18
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 3e-18
3n53_A140 Response regulator receiver modulated diguanylate; 4e-18
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 4e-18
3cg0_A140 Response regulator receiver modulated diguanylate 5e-18
3cg4_A142 Response regulator receiver domain protein (CHEY-; 5e-18
3cfy_A137 Putative LUXO repressor protein; structural genomi 6e-18
3eqz_A135 Response regulator; structural genomics, unknown f 8e-18
1mvo_A136 PHOP response regulator; phosphate regulon, transc 1e-17
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 1e-17
1xhf_A123 DYE resistance, aerobic respiration control protei 2e-17
3crn_A132 Response regulator receiver domain protein, CHEY-; 4e-17
4dad_A146 Putative pilus assembly-related protein; response 6e-17
3hdv_A136 Response regulator; PSI-II, structural genomics, P 6e-17
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 7e-17
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 8e-17
2gwr_A 238 DNA-binding response regulator MTRA; two-component 1e-16
2oqr_A 230 Sensory transduction protein REGX3; response regul 1e-16
1zgz_A122 Torcad operon transcriptional regulatory protein; 2e-16
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 2e-16
2gkg_A127 Response regulator homolog; social motility, recei 2e-16
3snk_A135 Response regulator CHEY-like protein; P-loop conta 3e-16
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 3e-16
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 3e-16
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 3e-16
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 5e-16
1s8n_A205 Putative antiterminator; RV1626, structural genomi 1e-15
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 2e-15
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 2e-15
3r0j_A 250 Possible two component system response transcript 3e-15
3jte_A143 Response regulator receiver protein; structural ge 4e-15
3q9s_A249 DNA-binding response regulator; DNA binding protei 5e-15
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 6e-15
3n0r_A286 Response regulator; sigma factor, receiver, two-co 8e-15
2rjn_A154 Response regulator receiver:metal-dependent phosph 8e-15
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription 9e-15
3rqi_A184 Response regulator protein; structural genomics, s 1e-14
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 1e-14
1ys7_A 233 Transcriptional regulatory protein PRRA; response 5e-14
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 7e-14
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 8e-14
2rdm_A132 Response regulator receiver protein; structural ge 2e-13
1yio_A208 Response regulatory protein; transcription regulat 2e-13
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 4e-13
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 9e-13
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 2e-12
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 2e-12
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 2e-12
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 3e-12
3f6c_A134 Positive transcription regulator EVGA; structural 5e-12
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 6e-12
1dz3_A130 Stage 0 sporulation protein A; response regulator, 8e-12
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 1e-11
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 1e-11
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 1e-11
2qsj_A154 DNA-binding response regulator, LUXR family; struc 2e-11
2qr3_A140 Two-component system response regulator; structura 3e-11
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 6e-11
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 8e-11
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 9e-11
3cz5_A153 Two-component response regulator, LUXR family; str 9e-11
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 1e-10
2hqr_A 223 Putative transcriptional regulator; phosporylation 7e-10
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 1e-09
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 1e-09
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 2e-09
3eul_A152 Possible nitrate/nitrite response transcriptional 2e-09
2pln_A137 HP1043, response regulator; signaling protein; 1.8 6e-09
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 8e-09
2qv0_A143 Protein MRKE; structural genomics, transcription, 2e-08
3c3w_A 225 Two component transcriptional regulatory protein; 4e-07
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3kto_A136 Response regulator receiver protein; PSI-II,struct 1e-05
4fmt_A228 CHPT protein; A phosphotransfer protein, A two-com 3e-04
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 Back     alignment and structure
 Score =  193 bits (493), Expect = 1e-55
 Identities = 71/300 (23%), Positives = 122/300 (40%), Gaps = 62/300 (20%)

Query: 338 KSARAARKEMHLCASLIKQMEATQQAER-KSMNKSLAF-ANASHDIRAALAGITGLIELC 395
            S    R    L ++L  +  A  +AER K       F  N S+++R  L  I G  EL 
Sbjct: 11  SSGLVPRGSHMLQSALADRSAALAEAERLKR-----DFVGNVSYELRTPLTTIIGYSELL 65

Query: 396 YVEAGPGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIEEDFDVGELLEDVVD 455
               G       ++  +   A  L   ++ +LD ++++AG+M L  ED  V +LL +  +
Sbjct: 66  ERADGISERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQE 125

Query: 456 LFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSE-GHISVRA 514
                A   GV + ++  +        ++GD  +L Q L +L+ NA++ T   G +++  
Sbjct: 126 RALKDAQLGGVTLAVECEED----VGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLS- 180

Query: 515 CVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDT 574
                                                      A+R    +    +V DT
Sbjct: 181 -------------------------------------------ARRALGEVR--LDVSDT 195

Query: 575 GKGIPKEKRKTVFENYVQVKEGEGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRF 634
           G+G+P   +  +F+ +V      GG GLGL +V++LV L GG +  ++ E G  G+ F  
Sbjct: 196 GRGVPFHVQAHIFDRFVGRD--RGGPGLGLALVKALVELHGGWVA-LESEPG-NGSTFTC 251


>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Length = 145 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1131
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 100.0
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 100.0
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 100.0
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 100.0
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 100.0
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 100.0
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.98
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.98
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 99.97
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 99.97
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 99.97
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 99.93
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.92
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 99.9
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 99.9
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 99.9
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 99.88
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 99.88
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 99.87
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 99.87
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 99.84
2lpm_A123 Two-component response regulator; transcription re 99.83
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.82
3luf_A259 Two-component system response regulator/ggdef doma 99.81
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.8
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.8
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.79
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.79
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.78
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.78
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.77
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.77
3rqi_A184 Response regulator protein; structural genomics, s 99.77
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 99.76
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.75
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.75
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.74
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.74
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.74
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.73
1mb3_A124 Cell division response regulator DIVK; signal tran 99.73
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.73
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.73
3zxo_A129 Redox sensor histidine kinase response regulator; 99.73
3r0j_A 250 Possible two component system response transcript 99.72
1xhf_A123 DYE resistance, aerobic respiration control protei 99.72
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.72
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.72
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.72
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.72
3heb_A152 Response regulator receiver domain protein (CHEY); 99.72
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.72
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.72
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.72
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.72
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.71
3lua_A140 Response regulator receiver protein; two-component 99.71
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.71
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.71
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.71
3i42_A127 Response regulator receiver domain protein (CHEY- 99.71
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.71
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.71
3grc_A140 Sensor protein, kinase; protein structure initiati 99.71
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 99.7
3jte_A143 Response regulator receiver protein; structural ge 99.7
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.7
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.7
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.7
4dad_A146 Putative pilus assembly-related protein; response 99.7
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.69
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.69
3c3m_A138 Response regulator receiver protein; structural ge 99.69
3nhm_A133 Response regulator; protein structure initiative I 99.69
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.69
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.69
3f6c_A134 Positive transcription regulator EVGA; structural 99.69
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.69
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.68
3lte_A132 Response regulator; structural genomics, PSI, prot 99.68
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.68
3eul_A152 Possible nitrate/nitrite response transcriptional 99.68
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.68
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.68
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.67
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.67
1yio_A208 Response regulatory protein; transcription regulat 99.67
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.67
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 99.67
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.67
2zay_A147 Response regulator receiver protein; structural ge 99.67
2qxy_A142 Response regulator; regulation of transcription, N 99.66
2qr3_A140 Two-component system response regulator; structura 99.66
3cg0_A140 Response regulator receiver modulated diguanylate 99.66
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.66
3n53_A140 Response regulator receiver modulated diguanylate; 99.66
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 99.65
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.65
1w25_A 459 Stalked-cell differentiation controlling protein; 99.65
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.65
3cz5_A153 Two-component response regulator, LUXR family; str 99.65
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.65
3eq2_A 394 Probable two-component response regulator; adaptor 99.65
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.64
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.64
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.64
1ys7_A 233 Transcriptional regulatory protein PRRA; response 99.63
3eqz_A135 Response regulator; structural genomics, unknown f 99.63
2gkg_A127 Response regulator homolog; social motility, recei 99.63
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.61
3c97_A140 Signal transduction histidine kinase; structural g 99.61
2gwr_A 238 DNA-binding response regulator MTRA; two-component 99.61
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.61
3bre_A 358 Probable two-component response regulator; protein 99.6
2oqr_A 230 Sensory transduction protein REGX3; response regul 99.6
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.6
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.6
2rdm_A132 Response regulator receiver protein; structural ge 99.6
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.59
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.59
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription 99.59
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 99.58
3c3w_A 225 Two component transcriptional regulatory protein; 99.58
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.58
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.57
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.57
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.57
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.57
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.54
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.54
2hqr_A 223 Putative transcriptional regulator; phosporylation 99.53
3luf_A 259 Two-component system response regulator/ggdef doma 99.51
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.49
1w25_A 459 Stalked-cell differentiation controlling protein; 99.48
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.43
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.4
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.81
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 98.48
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 98.4
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 98.31
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 98.26
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 98.11
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 98.09
3zcc_A114 HAMP, osmolarity sensor protein ENVZ; signaling pr 98.01
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 97.94
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 97.82
3zrx_A115 AF1503 protein, osmolarity sensor protein ENVZ; si 97.24
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 97.16
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 96.75
2ayx_A 254 Sensor kinase protein RCSC; two independent struct 96.71
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 96.61
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 96.56
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 96.49
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.05
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 95.91
2lpm_A123 Two-component response regulator; transcription re 95.89
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 95.64
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 95.05
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 94.93
3r0j_A250 Possible two component system response transcript 94.81
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 94.1
3h5i_A140 Response regulator/sensory box protein/ggdef domai 93.95
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 93.52
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 93.42
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 93.25
3n0r_A286 Response regulator; sigma factor, receiver, two-co 92.99
3c8c_A240 Methyl-accepting chemotaxis protein; structural ge 92.89
4dah_A217 Sporulation kinase D; alpha-beta-alpha structure, 92.68
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 92.68
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 92.56
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 92.39
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 92.32
3cg4_A142 Response regulator receiver domain protein (CHEY-; 92.22
3i42_A127 Response regulator receiver domain protein (CHEY- 92.17
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 92.1
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 92.0
3hdv_A136 Response regulator; PSI-II, structural genomics, P 91.96
3a10_A116 Response regulator; phosphoacceptor, signaling pro 91.94
3cg0_A140 Response regulator receiver modulated diguanylate 91.74
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone 91.71
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 91.63
3lif_A254 Putative diguanylate cyclase (ggdef) with PAS/PAC; 91.54
3lte_A132 Response regulator; structural genomics, PSI, prot 91.52
3grc_A140 Sensor protein, kinase; protein structure initiati 91.48
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 91.45
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 91.18
2pln_A137 HP1043, response regulator; signaling protein; 1.8 90.99
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 90.99
1srr_A124 SPO0F, sporulation response regulatory protein; as 90.6
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 90.51
2rdm_A132 Response regulator receiver protein; structural ge 90.31
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 90.25
3rqi_A184 Response regulator protein; structural genomics, s 90.24
3hdg_A137 Uncharacterized protein; two-component sensor acti 90.2
3f6c_A134 Positive transcription regulator EVGA; structural 90.1
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 89.81
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 89.49
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 89.46
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 89.44
1mvo_A136 PHOP response regulator; phosphate regulon, transc 89.28
1mb3_A124 Cell division response regulator DIVK; signal tran 89.27
3nhm_A133 Response regulator; protein structure initiative I 89.2
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 89.16
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 89.16
1ys7_A233 Transcriptional regulatory protein PRRA; response 89.15
3lua_A140 Response regulator receiver protein; two-component 89.03
3jte_A143 Response regulator receiver protein; structural ge 89.01
3kto_A136 Response regulator receiver protein; PSI-II,struct 88.87
3crn_A132 Response regulator receiver domain protein, CHEY-; 88.67
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 88.44
3c97_A140 Signal transduction histidine kinase; structural g 88.19
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 88.15
3c3m_A138 Response regulator receiver protein; structural ge 88.09
3gt7_A154 Sensor protein; structural genomics, signal receiv 87.94
2gkg_A127 Response regulator homolog; social motility, recei 87.73
2zay_A147 Response regulator receiver protein; structural ge 87.7
2rjn_A154 Response regulator receiver:metal-dependent phosph 87.64
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 87.55
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 87.48
4duh_A220 DNA gyrase subunit B; structure-based drug design, 87.48
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 87.35
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 87.21
3eul_A152 Possible nitrate/nitrite response transcriptional 87.21
3cnb_A143 DNA-binding response regulator, MERR family; signa 87.18
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 87.12
2qxy_A142 Response regulator; regulation of transcription, N 86.9
3by9_A260 Sensor protein; histidine kinase sensor domain, ph 86.79
1zgz_A122 Torcad operon transcriptional regulatory protein; 86.67
1xhf_A123 DYE resistance, aerobic respiration control protei 86.56
3heb_A152 Response regulator receiver domain protein (CHEY); 86.55
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 86.47
3cfy_A137 Putative LUXO repressor protein; structural genomi 86.35
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 86.2
1s8n_A205 Putative antiterminator; RV1626, structural genomi 86.08
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 86.06
4dad_A146 Putative pilus assembly-related protein; response 85.95
1yio_A208 Response regulatory protein; transcription regulat 85.88
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 85.52
3snk_A135 Response regulator CHEY-like protein; P-loop conta 85.4
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 85.23
2qr3_A140 Two-component system response regulator; structura 84.71
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 84.31
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 84.19
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 84.12
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 84.11
3e4o_A305 C4-dicarboxylate transport sensor protein DCTB; PA 84.09
3q9s_A249 DNA-binding response regulator; DNA binding protei 83.82
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 83.76
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 83.61
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 83.33
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 82.84
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 82.47
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 82.46
3peh_A281 Endoplasmin homolog; structural genomics, structur 82.39
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 82.28
1dz3_A130 Stage 0 sporulation protein A; response regulator, 82.2
3cz5_A153 Two-component response regulator, LUXR family; str 81.82
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 81.7
3n53_A140 Response regulator receiver modulated diguanylate; 81.67
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 81.32
2gwr_A238 DNA-binding response regulator MTRA; two-component 81.14
2qsj_A154 DNA-binding response regulator, LUXR family; struc 80.91
2oqr_A230 Sensory transduction protein REGX3; response regul 80.62
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 80.41
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
Probab=100.00  E-value=8.7e-37  Score=336.75  Aligned_cols=225  Identities=30%  Similarity=0.418  Sum_probs=188.6

Q ss_pred             HHHHHHHHHHHHHchHhhHHHHHHHHHHHHHHHhhCC--CChHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCccee
Q 042553          364 ERKSMNKSLAFANASHDIRAALAGITGLIELCYVEAG--PGSELETNLRQMNVCANDLLGLLNSILDTSKVEAGKMQLIE  441 (1131)
Q Consensus       364 e~~~~~ks~flA~iSHELRTPLt~I~g~~ell~~~~~--~~~~~~~~l~~i~~~~~~Ll~LIndlLdlskie~g~~~l~~  441 (1131)
                      ++....|.+|++++||||||||++|.|+++++.....  ..++.+++++.|..++.+|..+++++|++++++.+...+..
T Consensus        14 ~~~~~~~~~~~~~isHelrtPL~~i~~~~~~l~~~~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~~~~~~~   93 (258)
T 2c2a_A           14 KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINR   93 (258)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTGGGCCTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCC
T ss_pred             HHHHHHHHHHHHHhhhhhcCCHHHHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCccCcc
Confidence            4445567789999999999999999999998765321  23456788999999999999999999999999999999999


Q ss_pred             eeecHHHHHHHHHHHHHHHHHcCCcEEEEccCCCCccccceEEeCHHHHHHHHHHHHHHHhhccCCC----eEEEEEeec
Q 042553          442 EDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEG----HISVRACVK  517 (1131)
Q Consensus       442 ~~~dL~~ll~~v~~~~~~~a~~k~i~l~~~~~~~~~~~~~~v~gD~~rL~QIL~NLL~NAiKfT~~G----~I~v~~~~~  517 (1131)
                      +++++.+++++++..+...+..+++.+.++.....   ...+.+|+.+|.|||.|||+||+||++.|    .|.+.+...
T Consensus        94 ~~~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~---~~~~~~d~~~l~~il~NLl~NAik~~~~~~~~~~i~i~~~~~  170 (258)
T 2c2a_A           94 EKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPC---PVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEK  170 (258)
T ss_dssp             EEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCS---CCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEEE
T ss_pred             ceecHHHHHHHHHHHHHHHHHHcCcEEEeecCCCC---CceEEeCHHHHHHHHHHHHHHHHhcCcCCCCceeEEEEEecC
Confidence            99999999999999999999999999987654222   13578999999999999999999999754    355554321


Q ss_pred             CCCCCCCCCCCCCccCcccchhhhhhccccccchhhhhhhhhccCCCcEEEEEEEecCCCCCcchHhhhccCCeecCCC-
Q 042553          518 KPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEG-  596 (1131)
Q Consensus       518 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFe~F~q~~~~-  596 (1131)
                                                                    ...+.|+|.|+|+||+++.+++||+|||+.+.. 
T Consensus       171 ----------------------------------------------~~~~~i~V~D~G~Gi~~~~~~~if~~f~~~~~~~  204 (258)
T 2c2a_A          171 ----------------------------------------------DGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSL  204 (258)
T ss_dssp             ----------------------------------------------TTEEEEEEEECSSCCCGGGTTGGGSTTCCCC---
T ss_pred             ----------------------------------------------CCeEEEEEEecCCCCCHHHHHhhccccccCCCCC
Confidence                                                          125789999999999999999999999997653 


Q ss_pred             ---CCCcccchHHHHHHHHHhCCEEEEEeecCCCccEEEEEEEecc
Q 042553          597 ---EGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFLA  639 (1131)
Q Consensus       597 ---~~GtGLGLsIvk~Lv~~~gG~I~v~s~~~gg~Gt~f~~~l~l~  639 (1131)
                         .+|+||||+|||++|+.|||+|++.|.+  +.||+|+|.+|..
T Consensus       205 ~~~~~G~GLGL~i~~~iv~~~gG~i~v~s~~--~~Gt~f~i~lP~~  248 (258)
T 2c2a_A          205 TYEVPGTGLGLAITKEIVELHGGRIWVESEV--GKGSRFFVWIPKD  248 (258)
T ss_dssp             ------CCCTHHHHHHHHHHTTCEEEEEEET--TTEEEEEEEEECC
T ss_pred             CCCCCCcchHHHHHHHHHHHcCCEEEEEecC--CCCcEEEEEeeCC
Confidence               3599999999999999999999999876  3699999999864



>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3c8c_A Methyl-accepting chemotaxis protein; structural genomics, unknown function, uncharacterized protein; 1.50A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3lif_A Putative diguanylate cyclase (ggdef) with PAS/PAC; PDC fold, signaling protein; HET: CIT; 2.70A {Rhodopseudomonas palustris} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3by9_A Sensor protein; histidine kinase sensor domain, phosphoprotein, transferase, two-component regulatory system; 1.70A {Vibrio cholerae} Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3e4o_A C4-dicarboxylate transport sensor protein DCTB; PAS domain, N-TERM helical dimerization domain, transferase; 2.30A {Sinorhizobium meliloti} PDB: 3e4p_A 3e4q_A 2zbb_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1131
d2c2aa2161 d.122.1.3 (A:321-481) Sensor histidine kinase TM08 2e-31
d1ysra1148 d.122.1.3 (A:299-446) Sensor-type histidine kinase 2e-28
d1bxda_161 d.122.1.3 (A:) Histidine kinase domain of the osmo 2e-28
d1id0a_146 d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche 8e-28
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 2e-26
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 3e-24
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 3e-24
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 3e-24
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 4e-24
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 7e-24
d1jm6a2190 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin 2e-23
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 4e-23
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 5e-23
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 1e-22
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 2e-22
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-22
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 9e-22
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 2e-21
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 2e-20
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-19
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 2e-19
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 2e-19
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-19
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 2e-19
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 3e-19
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 5e-19
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 7e-19
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 2e-18
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 3e-18
d1r62a_156 d.122.1.3 (A:) Nitrogen regulation protein NtrB, C 9e-18
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 1e-17
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 1e-17
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 2e-17
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 3e-17
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 3e-17
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 6e-17
d1gkza2193 d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci 2e-16
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 3e-16
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 5e-16
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 2e-15
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 2e-14
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 9e-10
d2c2aa189 a.30.2.1 (A:232-320) Sensor histidine kinase TM085 3e-07
d1y8oa2125 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinas 6e-07
d1i58a_189 d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m 2e-06
d1ixma_179 d.123.1.1 (A:) Sporulation response regulatory pro 0.002
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]
 Score =  118 bits (297), Expect = 2e-31
 Identities = 44/201 (21%), Positives = 73/201 (36%), Gaps = 51/201 (25%)

Query: 438 QLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNL 497
           Q+  E  D+ +L+E  V+     A    V V+ + +    ++      D  +++Q+L NL
Sbjct: 1   QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVE---AYIDPTRIRQVLLNL 57

Query: 498 LSNAVKFTSEGHISVRACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNA 557
           L+N VK++ +        V                                         
Sbjct: 58  LNNGVKYSKKDAPDKYVKV----------------------------------------- 76

Query: 558 AQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQVKEG----EGGTGLGLGIVQSLVRL 613
              DE        V+D G GIP   +  +FE + +V         GTGLGL I + +V L
Sbjct: 77  -ILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVEL 135

Query: 614 MGGDIEIVDKENGERGTCFRF 634
            GG I +  +    +G+ F  
Sbjct: 136 HGGRIWVESEVG--KGSRFFV 154


>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1131
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 99.97
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 99.97
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 99.96
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 99.96
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 99.93
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 99.92
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 99.92
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.91
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.9
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.9
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.9
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.9
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.9
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.89
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.89
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.89
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.89
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.89
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.89
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.89
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.88
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.88
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.88
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.88
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.88
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.88
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.87
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.87
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.87
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.87
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.87
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.87
d1s8na_190 Probable two-component system transcriptional regu 99.87
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.86
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.85
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.85
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.85
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.85
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.82
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.78
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.74
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 99.73
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.55
d2c2aa189 Sensor histidine kinase TM0853 {Thermotoga maritim 99.51
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 99.32
d1i58a_189 Histidine kinase CheA {Thermotoga maritima [TaxId: 99.32
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 99.22
d1joya_67 EnvZ histidine kinase {Escherichia coli [TaxId: 56 99.13
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 96.93
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 96.87
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 96.82
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 96.64
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 96.62
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 96.42
d1mb3a_123 Cell division response regulator DivK {Caulobacter 96.41
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 96.36
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 96.32
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 96.15
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 96.11
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 96.05
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 96.02
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 95.98
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 95.93
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 95.9
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 95.84
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 95.67
d1k66a_149 Response regulator for cyanobacterial phytochrome 95.6
d1k68a_140 Response regulator for cyanobacterial phytochrome 95.5
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 95.48
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 95.47
d1yioa2128 Response regulatory protein StyR, N-terminal domai 95.41
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 95.4
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 95.32
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 95.31
d1i3ca_144 Response regulator for cyanobacterial phytochrome 95.3
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 95.12
d1s8na_190 Probable two-component system transcriptional regu 94.91
d1qkka_140 Transcriptional regulatory protein DctD, receiver 94.48
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 93.92
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 93.3
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 91.81
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 91.73
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 91.62
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 90.98
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 88.91
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 87.2
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 86.47
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 83.6
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]
Probab=99.97  E-value=4e-31  Score=268.39  Aligned_cols=150  Identities=29%  Similarity=0.450  Sum_probs=125.7

Q ss_pred             cceeeeecHHHHHHHHHHHHHHHHHcCCcEEEEccCCCCccccceEEeCHHHHHHHHHHHHHHHhhccCCCe----EEEE
Q 042553          438 QLIEEDFDVGELLEDVVDLFHPVAMRKGVEVVLDPSDGSVLKFSKVKGDRVKLKQILSNLLSNAVKFTSEGH----ISVR  513 (1131)
Q Consensus       438 ~l~~~~~dL~~ll~~v~~~~~~~a~~k~i~l~~~~~~~~~~~~~~v~gD~~rL~QIL~NLL~NAiKfT~~G~----I~v~  513 (1131)
                      +|+.++|||.++++++++.+++.+..|++++.++.+.+..   ..+.+|+.+|+|||.|||+||+|||++|.    |.+.
T Consensus         1 el~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~---~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~   77 (161)
T d2c2aa2           1 QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCP---VEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVI   77 (161)
T ss_dssp             CCCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSC---CEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEE
T ss_pred             CCccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCC---EEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEE
Confidence            3667999999999999999999999999999887654321   35889999999999999999999999764    4444


Q ss_pred             EeecCCCCCCCCCCCCCccCcccchhhhhhccccccchhhhhhhhhccCCCcEEEEEEEecCCCCCcchHhhhccCCeec
Q 042553          514 ACVKKPSAIGNPSLSSSRHGFLQSISCLFYKNKKARGDLEAVNAAQRDENAMEFTFEVDDTGKGIPKEKRKTVFENYVQV  593 (1131)
Q Consensus       514 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~V~DtG~GI~~e~~~~IFe~F~q~  593 (1131)
                      +...                                              ...+.|+|.|+|+|||++++++||+||||.
T Consensus        78 ~~~~----------------------------------------------~~~~~i~V~D~G~GI~~~~~~~iF~~F~~~  111 (161)
T d2c2aa2          78 LDEK----------------------------------------------DGGVLIIVEDNGIGIPDHAKDRIFEQFYRV  111 (161)
T ss_dssp             EEEE----------------------------------------------TTEEEEEEEECSSCCCGGGTTGGGSTTCCC
T ss_pred             EEec----------------------------------------------CCEEEEEEEEcCCCCCHHHHHHhhCCcEEc
Confidence            3211                                              126889999999999999999999999998


Q ss_pred             CCC----CCCcccchHHHHHHHHHhCCEEEEEeecCCCccEEEEEEEec
Q 042553          594 KEG----EGGTGLGLGIVQSLVRLMGGDIEIVDKENGERGTCFRFNVFL  638 (1131)
Q Consensus       594 ~~~----~~GtGLGLsIvk~Lv~~~gG~I~v~s~~~gg~Gt~f~~~l~l  638 (1131)
                      +..    .+|+||||+|||+||++|||+|+++|.+  ++||+|+|.+|.
T Consensus       112 ~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~--~~Gt~f~i~lP~  158 (161)
T d2c2aa2         112 DSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEV--GKGSRFFVWIPK  158 (161)
T ss_dssp             C---------CCCTHHHHHHHHHHTTCEEEEEEET--TTEEEEEEEEEC
T ss_pred             CCCCCCCCCcccHHHHHHHHHHHHCCCEEEEEecC--CCeeEEEEEEEc
Confidence            653    3699999999999999999999999886  469999999986



>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure