Citrus Sinensis ID: 042693

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
DHTHLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
cccccccccEEEEEccccEEEccccccEEEcccEEEEEEEEccccccccccHHHHHHHHHHcccccEEccc
ccccccccEEEEEEEccccEEcccccEEEEcccEEEEEEEEEccccccccccccEEEEEEEEcHHHHHHcc
dhthlksdQILIVQatpgaisfrHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
dhthlksdqILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALskvkqvleirsfdlilacl
DHTHLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
********QILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILAC*
****LKS*QILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
DHTHLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
****LKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DHTHLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLILACL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
Q56P11 1381 DNA-directed RNA polymera N/A no 0.901 0.046 0.545 1e-14
P11704 1361 DNA-directed RNA polymera N/A no 0.915 0.047 0.538 1e-14
Q49L08 1392 DNA-directed RNA polymera N/A no 0.901 0.045 0.545 2e-14
Q4VZP3 1394 DNA-directed RNA polymera N/A no 0.901 0.045 0.545 2e-14
Q09MI8 1403 DNA-directed RNA polymera no no 0.901 0.045 0.545 3e-14
Q1KXX0 1362 DNA-directed RNA polymera N/A no 0.901 0.046 0.532 3e-14
Q09G56 1387 DNA-directed RNA polymera N/A no 0.901 0.046 0.545 3e-14
B2LMI2 1381 DNA-directed RNA polymera N/A no 0.901 0.046 0.532 3e-14
B1A925 1387 DNA-directed RNA polymera N/A no 0.901 0.046 0.545 3e-14
A8SE78 1390 DNA-directed RNA polymera N/A no 0.901 0.046 0.532 3e-14
>sp|Q56P11|RPOC2_LACSA DNA-directed RNA polymerase subunit beta'' OS=Lactuca sativa GN=rpoC2 PE=3 SV=2 Back     alignment and function desciption
 Score = 78.6 bits (192), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/77 (54%), Positives = 50/77 (64%), Gaps = 13/77 (16%)

Query: 4    HLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTR 50
            HLKS Q+LIVQ             ATPGA    HYG  L++G+ LVTFIYEK RS D+T+
Sbjct: 1082 HLKSGQVLIVQVDSVVIRSAKPYLATPGATVHGHYGEILYEGDTLVTFIYEKSRSGDITQ 1141

Query: 51   ALSKVKQVLEIRSFDLI 67
             L KV+QVLE+RS D I
Sbjct: 1142 GLPKVEQVLEVRSIDSI 1158
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Lactuca sativa (taxid: 4236)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 6
>sp|P11704|RPOC2_SPIOL DNA-directed RNA polymerase subunit beta'' OS=Spinacia oleracea GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q49L08|RPOC2_EUCGG DNA-directed RNA polymerase subunit beta'' OS=Eucalyptus globulus subsp. globulus GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q4VZP3|RPOC2_CUCSA DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q09MI8|RPOC2_CITSI DNA-directed RNA polymerase subunit beta'' OS=Citrus sinensis GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q1KXX0|RPOC2_HELAN DNA-directed RNA polymerase subunit beta'' OS=Helianthus annuus GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|Q09G56|RPOC2_PLAOC DNA-directed RNA polymerase subunit beta'' OS=Platanus occidentalis GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|B2LMI2|RPOC2_GUIAB DNA-directed RNA polymerase subunit beta'' OS=Guizotia abyssinica GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|B1A925|RPOC2_CARPA DNA-directed RNA polymerase subunit beta'' OS=Carica papaya GN=rpoC2 PE=3 SV=1 Back     alignment and function description
>sp|A8SE78|RPOC2_CERDE DNA-directed RNA polymerase subunit beta'' OS=Ceratophyllum demersum GN=rpoC2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
157690190 1280 RNA polymerase beta'' subunit, partial ( 0.901 0.05 0.558 2e-13
336239391 1265 RNA polymerase beta subunit [Barbeya ole 0.901 0.050 0.558 4e-13
81176239 1381 RNA polymerase beta'' subunit [Lactuca s 0.901 0.046 0.545 5e-13
90403635 839 RNA polymerase beta chain [Spinacia oler 0.915 0.077 0.538 5e-13
61992023 1386 RNA polymerase beta II subunit [Lactuca 0.901 0.046 0.545 5e-13
343482040 495 RNA polymerase beta chain [Hydrangea sp. 0.901 0.129 0.545 5e-13
133448 1361 RecName: Full=DNA-directed RNA polymeras 0.915 0.047 0.538 5e-13
126022792 1357 RNA polymerase beta'' subunit [Spinacia 0.915 0.047 0.538 5e-13
146261537 808 RNA polymerase beta' subunit [Ribes amer 0.901 0.079 0.545 6e-13
146261515 860 RNA polymerase beta' subunit [Hamamelis 0.901 0.074 0.545 6e-13
>gi|157690190|gb|ABV65782.1| RNA polymerase beta'' subunit, partial (chloroplast) [Tapiscia sinensis] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/77 (55%), Positives = 50/77 (64%), Gaps = 13/77 (16%)

Query: 4    HLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTR 50
            HLKS Q+LIVQ             ATPGA    HYG  L++GN LVTFIYEK RS D+T+
Sbjct: 1056 HLKSGQVLIVQVDSVVIRSAKPYLATPGATVHGHYGEILYEGNTLVTFIYEKSRSGDITQ 1115

Query: 51   ALSKVKQVLEIRSFDLI 67
             L KV+QVLE+RS D I
Sbjct: 1116 GLPKVEQVLEVRSIDSI 1132

Source: Tapiscia sinensis

Species: Tapiscia sinensis

Genus: Tapiscia

Family: Tapisciaceae

Order: Huerteales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|336239391|gb|AEI27553.1| RNA polymerase beta subunit [Barbeya oleoides] Back     alignment and taxonomy information
>gi|81176239|ref|YP_398318.1| RNA polymerase beta'' subunit [Lactuca sativa] gi|85700399|sp|Q56P11.2|RPOC2_LACSA RecName: Full=DNA-directed RNA polymerase subunit beta''; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta''; Short=RNA polymerase subunit beta'' gi|78675157|dbj|BAE47583.1| RNA polymerase beta'' subunit [Lactuca sativa] gi|88656972|gb|ABD47222.1| RNA polymerase beta' subunit [Lactuca sativa] Back     alignment and taxonomy information
>gi|90403635|gb|ABD93711.1| RNA polymerase beta chain [Spinacia oleracea] Back     alignment and taxonomy information
>gi|61992023|gb|AAX58144.1| RNA polymerase beta II subunit [Lactuca sativa] Back     alignment and taxonomy information
>gi|343482040|gb|AEM44882.1| RNA polymerase beta chain [Hydrangea sp. DES-2011] Back     alignment and taxonomy information
>gi|133448|sp|P11704.1|RPOC2_SPIOL RecName: Full=DNA-directed RNA polymerase subunit beta''; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta''; Short=RNA polymerase subunit beta'' gi|7636095|emb|CAB88715.1| RNA polymerase beta'' subunit [Spinacia oleracea] Back     alignment and taxonomy information
>gi|126022792|ref|NP_054922.2| RNA polymerase beta'' subunit [Spinacia oleracea] Back     alignment and taxonomy information
>gi|146261537|gb|ABQ15078.1| RNA polymerase beta' subunit [Ribes americanum] Back     alignment and taxonomy information
>gi|146261515|gb|ABQ15067.1| RNA polymerase beta' subunit [Hamamelis japonica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
UNIPROTKB|P0C507 1513 rpoC2 "DNA-directed RNA polyme 0.718 0.033 0.588 1.8e-09
UNIPROTKB|P0C508 1513 rpoC2 "DNA-directed RNA polyme 0.718 0.033 0.588 1.8e-09
UNIPROTKB|P0C509 1513 rpoC2 "DNA-directed RNA polyme 0.718 0.033 0.588 1.8e-09
UNIPROTKB|Q6ENI2 1513 rpoC2 "DNA-directed RNA polyme 0.718 0.033 0.588 1.8e-09
UNIPROTKB|P0C507 rpoC2 "DNA-directed RNA polymerase subunit beta''" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
 Score = 153 (58.9 bits), Expect = 1.8e-09, P = 1.8e-09
 Identities = 30/51 (58%), Positives = 37/51 (72%)

Query:    15 ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFD 65
             AT GA    HYG  L+KG++LVTFIYEK RS D+T+ L KV+Q+ E RS D
Sbjct:  1234 ATTGATVHGHYGEILYKGDRLVTFIYEKARSSDITQGLPKVEQIFEARSID 1284
GO:0009536 "plastid" evidence=IC
UNIPROTKB|P0C508 rpoC2 "DNA-directed RNA polymerase subunit beta''" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|P0C509 rpoC2 "DNA-directed RNA polymerase subunit beta''" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ENI2 rpoC2 "DNA-directed RNA polymerase subunit beta''" [Oryza nivara (taxid:4536)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01700029
hypothetical protein (97 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XVI.2833.1
annotation not avaliable (536 aa)
  •     0.506
gw1.XV.3343.1
annotation not avaliable (57 aa)
  •     0.506
gw1.XIX.785.1
annotation not avaliable (148 aa)
  •     0.506
gw1.XIV.3174.1
hypothetical protein (202 aa)
  •     0.506
gw1.XIII.2252.1
annotation not avaliable (153 aa)
  •     0.506
gw1.X.3026.1
hypothetical protein (245 aa)
  •     0.506
gw1.VII.1944.1
hypothetical protein; PsaA and psaB bind P700, the primary electron donor of photosystem I (PSI [...] (166 aa)
  •     0.506
gw1.IX.4685.1
annotation not avaliable (603 aa)
  •     0.506
gw1.IX.3372.1
hypothetical protein (58 aa)
  •     0.506
gw1.IV.4481.1
annotation not avaliable (90 aa)
  •     0.506

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
CHL00117 1364 CHL00117, rpoC2, RNA polymerase beta'' subunit; Re 6e-19
>gnl|CDD|214368 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information 
 Score = 78.1 bits (193), Expect = 6e-19
 Identities = 38/75 (50%), Positives = 46/75 (61%), Gaps = 13/75 (17%)

Query: 6    KSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRAL 52
            KS QI+IVQ             ATPGA    HYG  L++G+ LVT IYEK RS D+T+ L
Sbjct: 1076 KSGQIIIVQVDSLVIRSAKPYLATPGATVHGHYGEILYEGDTLVTLIYEKSRSGDITQGL 1135

Query: 53   SKVKQVLEIRSFDLI 67
             KV+Q+LE RS D I
Sbjct: 1136 PKVEQLLEARSIDSI 1150

Length = 1364

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
CHL00117 1364 rpoC2 RNA polymerase beta'' subunit; Reviewed 99.93
TIGR02388 1227 rpoC2_cyan DNA-directed RNA polymerase, beta'' sub 99.91
PRK02597 1331 rpoC2 DNA-directed RNA polymerase subunit beta'; P 99.9
PRK14844 2836 bifunctional DNA-directed RNA polymerase subunit b 99.59
PRK09603 2890 bifunctional DNA-directed RNA polymerase subunit b 99.58
TIGR02386 1140 rpoC_TIGR DNA-directed RNA polymerase, beta' subun 98.35
cd00630 158 RNAP_largest_subunit_C Largest subunit of RNA poly 98.28
PRK14906 1460 DNA-directed RNA polymerase subunit beta'/alpha do 98.28
PRK00566 1156 DNA-directed RNA polymerase subunit beta'; Provisi 98.13
cd02655 204 RNAP_beta'_C Largest subunit (beta') of Bacterial 97.52
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 96.26
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 94.86
PF00529 305 HlyD: HlyD family secretion protein the correspond 94.62
cd02736 300 RNAP_III_Rpc1_C Largest subunit (Rpc1) of Eukaryot 94.37
cd06528 363 RNAP_A'' A'' subunit of Archaeal RNA Polymerase (R 94.35
PF04998 277 RNA_pol_Rpb1_5: RNA polymerase Rpb1, domain 5; Int 94.26
TIGR02389 367 RNA_pol_rpoA2 DNA-directed RNA polymerase, subunit 94.25
PRK04309 383 DNA-directed RNA polymerase subunit A''; Validated 94.17
PRK14897 509 unknown domain/DNA-directed RNA polymerase subunit 93.41
cd02584 410 RNAP_II_Rpb1_C Largest subunit (Rpb1) of Eukaryoti 93.13
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 93.09
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 92.99
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 92.39
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.02
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 91.98
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 91.92
TIGR02645493 ARCH_P_rylase putative thymidine phosphorylase. Me 91.22
TIGR03327500 AMP_phos AMP phosphorylase. This enzyme family is 90.89
PRK10559 310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 90.89
TIGR02644405 Y_phosphoryl pyrimidine-nucleoside phosphorylase. 90.86
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 90.86
PRK04350490 thymidine phosphorylase; Provisional 90.81
PRK14898 858 DNA-directed RNA polymerase subunit A''; Provision 90.78
PRK15136 390 multidrug efflux system protein EmrA; Provisional 90.71
PRK09439169 PTS system glucose-specific transporter subunit; P 90.66
PRK05820440 deoA thymidine phosphorylase; Reviewed 90.42
TIGR02643437 T_phosphoryl thymidine phosphorylase. Thymidine ph 90.17
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 90.12
PRK03598 331 putative efflux pump membrane fusion protein; Prov 89.99
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 89.96
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 89.1
COG2190156 NagE Phosphotransferase system IIA components [Car 88.93
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 88.88
CHL00117 1364 rpoC2 RNA polymerase beta'' subunit; Reviewed 88.84
cd02735 309 RNAP_I_Rpa1_C Largest subunit (Rpa1) of Eukaryotic 87.94
PRK10476 346 multidrug resistance protein MdtN; Provisional 87.69
PF06898 385 YqfD: Putative stage IV sporulation protein YqfD; 87.37
PF01333118 Apocytochr_F_C: Apocytochrome F, C-terminal; Inter 87.07
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 87.05
PRK06078434 pyrimidine-nucleoside phosphorylase; Reviewed 86.5
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 86.04
TIGR02876 382 spore_yqfD sporulation protein YqfD. YqfD is part 85.72
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 85.45
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 85.06
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 84.19
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 83.63
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 83.27
PRK14977 1321 bifunctional DNA-directed RNA polymerase A'/A'' su 83.15
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 82.87
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 82.79
PRK11578 370 macrolide transporter subunit MacA; Provisional 82.6
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 82.43
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 82.41
PRK09824627 PTS system beta-glucoside-specific transporter sub 82.18
PRK0705180 hypothetical protein; Validated 82.16
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 81.72
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 81.55
PRK14844 2836 bifunctional DNA-directed RNA polymerase subunit b 81.16
PRK09859 385 multidrug efflux system protein MdtE; Provisional 80.38
COG0213435 DeoA Thymidine phosphorylase [Nucleotide transport 80.38
PRK10255648 PTS system N-acetyl glucosamine specific transport 80.35
PRK0674883 hypothetical protein; Validated 80.32
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 80.3
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information 
Probab=99.93  E-value=6e-27  Score=199.25  Aligned_cols=69  Identities=58%  Similarity=0.795  Sum_probs=66.2

Q ss_pred             CCCCCCCcEEEEE-------------eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCcccc
Q 042693            2 HTHLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLIL   68 (71)
Q Consensus         2 ~~~~~sGqii~i~-------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~~i~   68 (71)
                      .++ +||||+.++             +++||++|+++||+|++||+|+||.||++|||||||||||||||||||+.++++
T Consensus      1073 ~~~-~SGQIi~I~~~~lvIR~akPYLat~GAtvh~~~GeiI~~GDtLvtLiyER~kSGDI~QGLPKVEqLLEARsi~sis 1151 (1364)
T CHL00117       1073 GPH-KSGQIIIVQVDSLVIRSAKPYLATPGATVHGHYGEILYEGDTLVTLIYEKSRSGDITQGLPKVEQLLEARSIDSIS 1151 (1364)
T ss_pred             Ccc-ccceEEEEecCeEEEEecCceecCCCcEEEccCCCEecCCCeEEEEEeeccccCCcccCchhHHhhhhhccCceee
Confidence            455 999999998             899999999999999999999999999999999999999999999999999999


Q ss_pred             ccC
Q 042693           69 ACL   71 (71)
Q Consensus        69 ~~l   71 (71)
                      +||
T Consensus      1152 ~nl 1154 (1364)
T CHL00117       1152 MNL 1154 (1364)
T ss_pred             cch
Confidence            986

>TIGR02388 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit Back     alignment and domain information
>PRK02597 rpoC2 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>PRK09603 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit, predominant form Back     alignment and domain information
>cd00630 RNAP_largest_subunit_C Largest subunit of RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>PRK14906 DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional Back     alignment and domain information
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>cd02655 RNAP_beta'_C Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>cd02736 RNAP_III_Rpc1_C Largest subunit (Rpc1) of Eukaryotic RNA polymerase III (RNAP III), C-terminal domain Back     alignment and domain information
>cd06528 RNAP_A'' A'' subunit of Archaeal RNA Polymerase (RNAP) Back     alignment and domain information
>PF04998 RNA_pol_Rpb1_5: RNA polymerase Rpb1, domain 5; InterPro: IPR007081 RNA polymerases catalyse the DNA dependent polymerisation of RNA Back     alignment and domain information
>TIGR02389 RNA_pol_rpoA2 DNA-directed RNA polymerase, subunit A'' Back     alignment and domain information
>PRK04309 DNA-directed RNA polymerase subunit A''; Validated Back     alignment and domain information
>PRK14897 unknown domain/DNA-directed RNA polymerase subunit A'' fusion protein; Provisional Back     alignment and domain information
>cd02584 RNAP_II_Rpb1_C Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase Back     alignment and domain information
>TIGR03327 AMP_phos AMP phosphorylase Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>TIGR02644 Y_phosphoryl pyrimidine-nucleoside phosphorylase Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK04350 thymidine phosphorylase; Provisional Back     alignment and domain information
>PRK14898 DNA-directed RNA polymerase subunit A''; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>PRK05820 deoA thymidine phosphorylase; Reviewed Back     alignment and domain information
>TIGR02643 T_phosphoryl thymidine phosphorylase Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information
>cd02735 RNAP_I_Rpa1_C Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>PF01333 Apocytochr_F_C: Apocytochrome F, C-terminal; InterPro: IPR002325 The cytochrome b6f integral membrane protein complex transfers electrons between the two reaction centre complexes of oxygenic photosynthetic membranes, and participates in formation of the transmembrane electrochemical proton gradient by also transferring protons from the stromal to the internal lumen compartment [] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK14977 bifunctional DNA-directed RNA polymerase A'/A'' subunit; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>COG0213 DeoA Thymidine phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
3lu0_D 1407 DNA-directed RNA polymerase subunit beta'; E. coli 99.67
1hqm_D 1265 DNA-directed RNA polymerase; transferase, transcri 98.24
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polym 97.96
4ayb_C 395 DNA-directed RNA polymerase; transferase, multi-su 97.35
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 97.31
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 96.92
2xha_A 193 NUSG, transcription antitermination protein NUSG; 95.79
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 94.31
2xha_A193 NUSG, transcription antitermination protein NUSG; 93.75
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 91.77
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 91.3
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 90.5
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 89.67
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 89.55
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 89.51
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 88.98
1brw_A433 PYNP, protein (pyrimidine nucleoside phosphorylase 88.79
2dsj_A423 Pyrimidine-nucleoside (thymidine) phosphorylase; p 88.75
3lu0_D 1407 DNA-directed RNA polymerase subunit beta'; E. coli 88.2
3our_B183 EIIA, phosphotransferase system IIA component; exh 87.81
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 87.61
2tpt_A440 Thymidine phosphorylase; transferase, salvage path 87.25
2lmc_B84 DNA-directed RNA polymerase subunit beta; transfer 87.24
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 86.95
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 86.8
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 86.72
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 86.58
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 85.91
2gpr_A154 Glucose-permease IIA component; phosphotransferase 85.77
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 85.51
3h5q_A436 PYNP, pyrimidine-nucleoside phosphorylase; structu 84.94
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 84.52
1uou_A474 Thymidine phosphorylase; transferase, glycosyltran 83.57
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 83.44
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 83.36
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 83.03
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 82.88
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 82.27
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 81.76
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 81.06
>3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Back     alignment and structure
Probab=99.67  E-value=8.9e-18  Score=142.74  Aligned_cols=52  Identities=23%  Similarity=0.215  Sum_probs=50.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCcc
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~~   66 (71)
                      +|.||+|.|++|+.|++||+||++|++..||+|||||||||+||||||+++.
T Consensus      1101 lp~~a~~~v~~g~~v~~g~vlakip~~~~k~~DIt~GLprv~eLfEar~pk~ 1152 (1407)
T 3lu0_D         1101 LPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFEARRPKE 1152 (1407)
T ss_dssp             CCTTCCCCCCSSCEECTTCEEECCCCCCCCSSCCCCSHHHHHHHHTTCCCSS
T ss_pred             cCCCcEEEecCCCEeccCceEEecchhhccccchhcCcHHHHHHHhccCCCC
Confidence            9999999999999999999999999999999999999999999999999854
>1hqm_D DNA-directed RNA polymerase; transferase, transcription, 3D- structure; 3.30A {Thermus aquaticus} SCOP: i.8.1.1 PDB: 1i6v_D* 2gho_D Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Back     alignment and structure
>4ayb_C DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_C 4b1o_C 4b1p_Y 2waq_C 2wb1_C 3hkz_C 2pmz_C Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 Back     alignment and structure
>2dsj_A Pyrimidine-nucleoside (thymidine) phosphorylase; pyrimidine-nucleoside phosphorylase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2tpt_A Thymidine phosphorylase; transferase, salvage pathway; 2.60A {Escherichia coli} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 1azy_A 1tpt_A 1otp_A Back     alignment and structure
>2lmc_B DNA-directed RNA polymerase subunit beta; transferase, transcription; NMR {Escherichia coli k-12} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1smyd_ 1504 RNA-polymerase beta-prime {Thermus thermophilus [T 97.09
d1e2wa264 Cytochrome f, small domain {Chlamydomonas reinhard 96.57
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [ 96.4
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 95.04
d2tpta3105 Thymidine phosphorylase {Escherichia coli [TaxId: 94.36
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 93.93
d1hcza263 Cytochrome f, small domain {Turnip (Brassica rapa) 93.03
d1vf7a_ 237 Multidrug resistance protein MexA domain {Pseudomo 91.88
d1tu2b266 Cytochrome f, small domain {Anabaena sp., strain P 91.36
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 91.05
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 89.89
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 87.32
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 84.8
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 82.99
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 80.73
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 80.71
>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta and beta-prime subunits of DNA dependent RNA-polymerase
superfamily: beta and beta-prime subunits of DNA dependent RNA-polymerase
family: RNA-polymerase beta-prime
domain: RNA-polymerase beta-prime
species: Thermus thermophilus [TaxId: 274]

Probab=97.09  E-value=3.2e-05  Score=64.57  Aligned_cols=31  Identities=26%  Similarity=0.352  Sum_probs=25.0

Q ss_pred             EEEEeehh-ccCCccCchhhHhhhhhhcCCcc
Q 042693           36 VTFIYEKL-RSCDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        36 ~~l~~e~~-kt~DItqGLPkVeeLfEAR~~~~   66 (71)
                      =||.+.-. .++|||+|+||+.||||||++..
T Consensus      1238 nTFH~aGVag~~nIT~GvPRl~EIi~a~kpk~ 1269 (1504)
T d1smyd_        1238 RTFHTGGVAGAADITQGLPRVIELFEARRPKA 1269 (1504)
T ss_dssp             SCTTCSCSSTTCCCCCHHHHHHHHHTTCCCTT
T ss_pred             hhhhhcccCCCCcccCCCchHHHHHhccCCCC
Confidence            45556554 47899999999999999999853
>d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcza2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Anabaena sp., strain PCC 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure