Citrus Sinensis ID: 043469


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
ccEEccccEEEcccEEEEEEEccccccccEEEEEEccEEEEEEEEEEEccEEccccccccccEEEEEEccccEEEEEEcccccccccEEEEEcccEEEEEcccc
ccccccEEEEEccccEEEEEEcccccHccEEEEEEccEEEEEEEEEEEEEccccccccccccEEEEEEEcccEEEEEEccccccHHHEEEEEcccEEEEEEccc
iewsprmnvselgsnyvmtveipgvhvndirvevddrkLTVMAKHSTecwkvagcsngsisayhrreyggepyqivwtlptnvdkdtISAEFLNGLLQIIIPKL
iewsprmnvselgsnYVMTVeipgvhvndirVEVDDRKLTVMAkhstecwkvagcsnGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
***********LGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIII***
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMA*******************YHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
Q54VP4 416 Heat shock protein DDB_G0 yes no 0.865 0.216 0.342 4e-11
Q4UKR8154 Small heat shock protein yes no 0.884 0.597 0.343 1e-10
Q4UJB1163 Small heat shock protein no no 0.903 0.576 0.326 2e-08
O14368143 Heat shock protein 16 OS= yes no 0.942 0.685 0.320 2e-07
P09887181 Small heat shock protein, no no 0.75 0.430 0.325 6e-06
P09886232 Small heat shock protein, N/A no 0.730 0.327 0.325 1e-05
P30222241 Small heat shock protein, N/A no 0.730 0.315 0.337 2e-05
Q93TV7130 Probable 15 kDa heat shoc yes no 0.875 0.7 0.274 3e-05
Q72QA1130 Probable 15 kDa heat shoc yes no 0.875 0.7 0.274 3e-05
Q7XUW5215 23.2 kDa heat shock prote yes no 0.894 0.432 0.320 6e-05
>sp|Q54VP4|Y0215_DICDI Heat shock protein DDB_G0280215 OS=Dictyostelium discoideum GN=DDB_G0280215 PE=3 SV=1 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 15/105 (14%)

Query: 3   WSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAK---HSTECWKVAGCSNGS 59
           W PRM+V E    Y + +E+P  + ++I V+V+ R L++  +   H+T+ WK        
Sbjct: 42  WKPRMDVCENKDYYKIILELPSFNKDEIEVQVNGRFLSIKGQKIEHTTDEWK-------- 93

Query: 60  ISAYHRRE-YGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPK 103
              YHRRE Y G  +     LP  +D  +I A+F +G+L ++IPK
Sbjct: 94  ---YHRRERYSGGEFHRAVALPEGIDGSSIQAKFQSGVLLLLIPK 135





Dictyostelium discoideum (taxid: 44689)
>sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 Back     alignment and function description
>sp|Q4UJB1|HSPC4_RICFE Small heat shock protein C4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspc4-1 PE=3 SV=1 Back     alignment and function description
>sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=2 SV=1 Back     alignment and function description
>sp|P09887|HS22C_SOYBN Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1 Back     alignment and function description
>sp|P09886|HS21C_PEA Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1 Back     alignment and function description
>sp|P30222|HS22C_PETHY Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1 Back     alignment and function description
>sp|Q93TV7|HSP15_LEPIN Probable 15 kDa heat shock protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hsp15 PE=3 SV=1 Back     alignment and function description
>sp|Q72QA1|HSP15_LEPIC Probable 15 kDa heat shock protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hsp15 PE=3 SV=1 Back     alignment and function description
>sp|Q7XUW5|HS232_ORYSJ 23.2 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP23.2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
225446714 259 PREDICTED: uncharacterized protein LOC10 1.0 0.401 0.634 2e-33
357494367 259 Small heat shock protein C4 [Medicago tr 1.0 0.401 0.625 4e-33
255569845 249 small heat-shock protein, putative [Rici 0.951 0.397 0.644 2e-32
356501493 261 PREDICTED: uncharacterized protein LOC10 1.0 0.398 0.605 2e-31
388521849 259 unknown [Medicago truncatula] 1.0 0.401 0.605 2e-31
356553403 261 PREDICTED: uncharacterized protein LOC10 1.0 0.398 0.615 3e-31
217073158 259 unknown [Medicago truncatula] gi|3884944 1.0 0.401 0.605 3e-31
315932704 254 HSP27.8 [Citrullus lanatus] 0.971 0.397 0.594 7e-28
312282189 292 unnamed protein product [Thellungiella h 0.980 0.349 0.519 3e-27
224128724 266 predicted protein [Populus trichocarpa] 1.0 0.390 0.566 4e-27
>gi|225446714|ref|XP_002282438.1| PREDICTED: uncharacterized protein LOC100267696 [Vitis vinifera] gi|302143482|emb|CBI22043.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (77%)

Query: 1   IEWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSI 60
           IEWSPRM+V+E G NYV+TVE+PGV  NDIRVE++ + L VM K ST+ WKVA CSN SI
Sbjct: 156 IEWSPRMDVAESGCNYVVTVELPGVGTNDIRVEINSQNLIVMGKRSTQWWKVASCSNDSI 215

Query: 61  SAYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL 104
            AYH+RE    PYQ+ WTLP N +KD +SA+F++G LQI IPKL
Sbjct: 216 PAYHKREILQGPYQVAWTLPFNANKDRVSAQFVDGFLQITIPKL 259




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357494367|ref|XP_003617472.1| Small heat shock protein C4 [Medicago truncatula] gi|355518807|gb|AET00431.1| Small heat shock protein C4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255569845|ref|XP_002525886.1| small heat-shock protein, putative [Ricinus communis] gi|223534800|gb|EEF36490.1| small heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356501493|ref|XP_003519559.1| PREDICTED: uncharacterized protein LOC100785395 [Glycine max] Back     alignment and taxonomy information
>gi|388521849|gb|AFK48986.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356553403|ref|XP_003545046.1| PREDICTED: uncharacterized protein LOC100788166 [Glycine max] Back     alignment and taxonomy information
>gi|217073158|gb|ACJ84938.1| unknown [Medicago truncatula] gi|388494472|gb|AFK35302.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|315932704|gb|ADU55782.1| HSP27.8 [Citrullus lanatus] Back     alignment and taxonomy information
>gi|312282189|dbj|BAJ33960.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|224128724|ref|XP_002320406.1| predicted protein [Populus trichocarpa] gi|222861179|gb|EEE98721.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
TAIR|locus:2009205285 ACD32.1 "AT1G06460" [Arabidops 0.980 0.357 0.490 1.2e-24
UNIPROTKB|Q604K7144 MCA2532 "Heat shock protein, H 0.894 0.645 0.336 3.2e-10
TIGR_CMR|CBU_1169151 CBU_1169 "heat shock protein, 0.913 0.629 0.343 3.2e-10
DICTYBASE|DDB_G0280215 416 DDB_G0280215 "putative alpha-c 0.855 0.213 0.367 4.7e-10
POMBASE|SPBC3E7.02c143 hsp16 "heat shock protein Hsp1 0.942 0.685 0.330 9.7e-09
TIGR_CMR|DET_0954162 DET_0954 "Hsp20/alpha crystall 0.903 0.580 0.333 2.6e-08
ASPGD|ASPL0000018312180 AN3555 [Emericella nidulans (t 0.317 0.183 0.411 9.3e-08
ASPGD|ASPL0000032935205 AN5781 [Emericella nidulans (t 0.403 0.204 0.357 9.7e-08
TIGR_CMR|GSU_0538147 GSU_0538 "heat shock protein, 0.875 0.619 0.307 1.1e-07
UNIPROTKB|G4N963210 MGG_03329 "Small heat shock pr 0.423 0.209 0.288 1.9e-07
TAIR|locus:2009205 ACD32.1 "AT1G06460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 50/102 (49%), Positives = 74/102 (72%)

Query:     3 WSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISA 62
             WSPR NV+E   +YV+ +E+PG  +NDIRVEVD+  LTV  + ++ C KV   +  SI  
Sbjct:   184 WSPRSNVAESTHSYVVAIELPGASINDIRVEVDNTNLTVTGRRTSICQKVDAGTKASILG 243

Query:    63 YHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPKL 104
             YH++E    P+++ W LP+NV+KD +SAEF++G+L+I+IPKL
Sbjct:   244 YHKQEILQGPFKVSWPLPSNVNKDNVSAEFMDGILRIVIPKL 285




GO:0009408 "response to heat" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0009853 "photorespiration" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
UNIPROTKB|Q604K7 MCA2532 "Heat shock protein, Hsp20 family" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1169 CBU_1169 "heat shock protein, Hsp20 family" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280215 DDB_G0280215 "putative alpha-crystallin-type heat shock protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC3E7.02c hsp16 "heat shock protein Hsp16" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0954 DET_0954 "Hsp20/alpha crystallin family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018312 AN3555 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032935 AN5781 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0538 GSU_0538 "heat shock protein, Hsp20 family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4N963 MGG_03329 "Small heat shock protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 2e-21
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 2e-19
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 4e-18
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 2e-13
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 6e-12
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 3e-10
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 6e-07
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
 Score = 80.7 bits (200), Expect = 2e-21
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 8   NVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRRE 67
           +V E    YV+  ++PG    DI+VEV+D  LT+  +   E              Y RRE
Sbjct: 1   DVYETDDAYVVEADLPGFKKEDIKVEVEDGVLTISGEREEE--------EEEEENYLRRE 52

Query: 68  YGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPK 103
                +   + LP +VD D I A   NG+L I +PK
Sbjct: 53  RSYGSFSRSFRLPEDVDPDKIKASLENGVLTITLPK 88


sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Length = 88

>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.96
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.96
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.96
PRK11597142 heat shock chaperone IbpB; Provisional 99.96
PRK10743137 heat shock protein IbpA; Provisional 99.95
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.95
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.94
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.93
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.93
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.93
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.92
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.91
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.91
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.91
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.91
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.89
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.89
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.89
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.81
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.78
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.72
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.62
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.52
cd0646384 p23_like Proteins containing this p23_like domain 99.32
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 99.23
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.1
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.03
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 98.75
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 98.61
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 98.57
cd0646892 p23_CacyBP p23_like domain found in proteins simil 98.43
cd0648887 p23_melusin_like p23_like domain similar to the C- 98.4
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 98.38
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 98.2
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 98.12
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 98.07
KOG1309 196 consensus Suppressor of G2 allele of skp1 [Signal 97.82
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.77
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 97.38
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 97.24
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 97.2
KOG2265179 consensus Nuclear distribution protein NUDC [Signa 93.07
KOG3158180 consensus HSP90 co-chaperone p23 [Posttranslationa 92.3
PF13349166 DUF4097: Domain of unknown function (DUF4097) 89.9
PF1299295 DUF3876: Domain of unknown function, B. Theta Gene 88.36
cd0029880 ACD_sHsps_p23-like This domain family includes the 87.5
KOG1667320 consensus Zn2+-binding protein Melusin/RAR1, conta 87.4
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 87.19
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 86.49
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 85.85
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 85.7
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 85.5
PF14913194 DPCD: DPCD protein family 85.48
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 85.41
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 84.96
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 84.82
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 84.18
PF0497264 BON: BON domain; InterPro: IPR007055 The BON domai 83.87
cd0646384 p23_like Proteins containing this p23_like domain 83.56
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 83.05
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 81.88
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 81.63
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 81.63
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 81.09
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 80.18
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
Probab=99.96  E-value=5.5e-29  Score=150.68  Aligned_cols=91  Identities=31%  Similarity=0.522  Sum_probs=84.1

Q ss_pred             eeeEEEcCCEEEEEEEcCCCCCCCeEEEEeC-CEEEEEEEEeecccccccccCCCcccEEEeeeccccEEEEEECCCCcc
Q 043469            6 RMNVSELGSNYVMTVEIPGVHVNDIRVEVDD-RKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNVD   84 (104)
Q Consensus         6 ~~~i~e~~~~~~i~v~lPG~~~~di~V~v~~-~~L~I~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~lP~~vd   84 (104)
                      +++|.|++++|+|.++|||++++||+|++.+ +.|+|+|++....       ..+...++++++..|.|.|+|.||.+++
T Consensus         1 ~~dv~E~~~~~~i~~~lPGv~~edi~i~v~~~~~L~I~g~~~~~~-------~~~~~~~~~~e~~~g~f~r~i~LP~~v~   73 (92)
T cd06472           1 RVDWKETPEAHVFKADVPGVKKEDVKVEVEDGRVLRISGERKKEE-------EKKGDDWHRVERSSGRFVRRFRLPENAD   73 (92)
T ss_pred             CccEEEcCCeEEEEEECCCCChHhEEEEEeCCCEEEEEEEecccc-------cccCCCEEEEEEeccEEEEEEECCCCCC
Confidence            4799999999999999999999999999986 5899999987654       3456789999999999999999999999


Q ss_pred             cCceeEEEeCcEEEEEEeC
Q 043469           85 KDTISAEFLNGLLQIIIPK  103 (104)
Q Consensus        85 ~~~i~A~~~~GiL~I~~pK  103 (104)
                      .+.|+|+|+||+|+|++||
T Consensus        74 ~~~i~A~~~nGvL~I~lPK   92 (92)
T cd06472          74 ADEVKAFLENGVLTVTVPK   92 (92)
T ss_pred             HHHCEEEEECCEEEEEecC
Confidence            9999999999999999998



sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st

>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>KOG2265 consensus Nuclear distribution protein NUDC [Signal transduction mechanisms] Back     alignment and domain information
>KOG3158 consensus HSP90 co-chaperone p23 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13349 DUF4097: Domain of unknown function (DUF4097) Back     alignment and domain information
>PF12992 DUF3876: Domain of unknown function, B Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG1667 consensus Zn2+-binding protein Melusin/RAR1, contains CHORD domain [General function prediction only] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>PF14913 DPCD: DPCD protein family Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>PF04972 BON: BON domain; InterPro: IPR007055 The BON domain is typically ~60 residues long and has an alpha/beta predicted fold Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3gla_A100 Crystal Structure Of The Hspa From Xanthomonas Axon 4e-08
3gt6_A103 Crystal Structure Of The Hspa From Xanthomonas Axon 5e-08
>pdb|3GLA|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 100 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/102 (29%), Positives = 55/102 (53%), Gaps = 7/102 (6%) Query: 2 EWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSIS 61 +W PR+++ E +++V+ ++PG+ + I V++D L++ + +E + S Sbjct: 2 QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSE----SSTETERFS 57 Query: 62 AYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPK 103 RR YG + + LP + D D I+A NG+L+I IPK Sbjct: 58 RIERR-YGS--FHRRFALPDSADADGITAAGRNGVLEIRIPK 96
>pdb|3GT6|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 9e-24
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 3e-21
1gme_A151 Heat shock protein 16.9B; small heat shock protein 2e-19
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 5e-18
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 5e-12
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 2e-11
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 3e-11
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 3e-11
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 6e-11
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 9e-09
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 1e-07
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
 Score = 86.0 bits (214), Expect = 9e-24
 Identities = 30/104 (28%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 2   EWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSIS 61
           +W PR+++ E  +++V+  ++PG+  + I V++D   L++  +  +E       S+    
Sbjct: 2   QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSE-------SSTETE 54

Query: 62  AYHRRE--YGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPK 103
            + R E  YG   +   + LP + D D I+A   NG+L+I IPK
Sbjct: 55  RFSRIERRYGS--FHRRFALPDSADADGITAAGRNGVLEIRIPK 96


>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 100.0
4fei_A102 Heat shock protein-related protein; stress respons 99.97
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.96
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.96
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.95
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.94
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.93
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.93
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.92
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.9
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 99.9
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.88
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.36
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.36
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.91
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 98.86
3igf_A374 ALL4481 protein; two-domained protein consisting o 98.78
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 98.55
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 98.45
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 98.37
2o30_A131 Nuclear movement protein; MCSG, structural genomic 98.35
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 98.29
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 98.25
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 98.22
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 98.21
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 98.05
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 98.01
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 88.37
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 87.42
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 85.35
4fei_A102 Heat shock protein-related protein; stress respons 84.92
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 83.79
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 83.65
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 80.84
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=100.00  E-value=2.8e-32  Score=166.28  Aligned_cols=96  Identities=28%  Similarity=0.542  Sum_probs=91.4

Q ss_pred             cccceeeEEEcCCEEEEEEEcCCCCCCCeEEEEeCCEEEEEEEEeecccccccccCCCcccEEEeeeccccEEEEEECCC
Q 043469            2 EWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPT   81 (104)
Q Consensus         2 ~~~P~~~i~e~~~~~~i~v~lPG~~~~di~V~v~~~~L~I~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~lP~   81 (104)
                      +|.|+++|.+++++|+|.++|||+++++|+|++.++.|+|+|++....       ......++++|+..|.|+|+|.||.
T Consensus         2 ~~~P~~di~e~~~~~~v~~~lPG~~~edi~v~~~~~~L~I~g~~~~~~-------~~~~~~~~~~er~~g~f~r~~~LP~   74 (100)
T 3gla_A            2 QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSES-------STETERFSRIERRYGSFHRRFALPD   74 (100)
T ss_dssp             CSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEETTEEEEEEEECCGG-------GSSGGGEEEECCCCEEEEEEEECCT
T ss_pred             CccCcEEEEECCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEEcCcC-------ccCCccEEEEeecceEEEEEEECCC
Confidence            699999999999999999999999999999999999999999998775       4566889999999999999999999


Q ss_pred             CcccCceeEEEeCcEEEEEEeCC
Q 043469           82 NVDKDTISAEFLNGLLQIIIPKL  104 (104)
Q Consensus        82 ~vd~~~i~A~~~~GiL~I~~pK~  104 (104)
                      ++|.+.|+|+|+||+|+|++||.
T Consensus        75 ~vd~~~i~A~~~~GvL~I~~pK~   97 (100)
T 3gla_A           75 SADADGITAAGRNGVLEIRIPKR   97 (100)
T ss_dssp             TBCTTSCEEEEETTEEEEEEEBC
T ss_pred             CcChHHeEEEEeCCEEEEEEecC
Confidence            99999999999999999999995



>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 3e-16
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 1e-15
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score = 66.2 bits (161), Expect = 3e-16
 Identities = 23/102 (22%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 2   EWSPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSIS 61
           +    +++ E   +  +   +PGV+  DI +      L + AK S      +        
Sbjct: 8   KGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESER------ 61

Query: 62  AYHRREYGGEPYQIVWTLPTNVDKDTISAEFLNGLLQIIIPK 103
             +      E       LP  V ++  SA+F NG+L +I+PK
Sbjct: 62  IIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPK 103


>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.95
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.95
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.85
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 98.2
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 97.91
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 97.88
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 97.87
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 89.85
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=99.95  E-value=8.4e-28  Score=148.23  Aligned_cols=95  Identities=25%  Similarity=0.281  Sum_probs=83.9

Q ss_pred             cceeeEEEcCCEEEEEEEcCCCCCCCeEEEEeCCEEEEEEEEeecccccccccCCCcccEEEeeeccccEEEEEECCCCc
Q 043469            4 SPRMNVSELGSNYVMTVEIPGVHVNDIRVEVDDRKLTVMAKHSTECWKVAGCSNGSISAYHRREYGGEPYQIVWTLPTNV   83 (104)
Q Consensus         4 ~P~~~i~e~~~~~~i~v~lPG~~~~di~V~v~~~~L~I~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~lP~~v   83 (104)
                      .||++|.+++++|+|.++|||+++++|+|++.++.|+|+|++.....      ......++..++..|.|+|+|.||.++
T Consensus        10 ~~pvdi~e~~~~~~i~~~lPG~~~edi~v~v~~~~l~I~~~~~~~~~------~~~~~~~~~~~~~~~~f~r~~~lP~~v   83 (115)
T d1shsa_          10 FMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMI------TESERIIYSEIPEEEEIYRTIKLPATV   83 (115)
T ss_dssp             CCCEEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEEEECCCCCC------CTTCEEEEECSCCCCEEEEEEECSSCB
T ss_pred             cCceEEEEcCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEeccccc------cccccEEEEeeecccceEEEEecCCce
Confidence            35699999999999999999999999999999999999999877652      233344555567889999999999999


Q ss_pred             ccCceeEEEeCcEEEEEEeCC
Q 043469           84 DKDTISAEFLNGLLQIIIPKL  104 (104)
Q Consensus        84 d~~~i~A~~~~GiL~I~~pK~  104 (104)
                      |.++++|.|+||+|+|++||+
T Consensus        84 d~~~i~A~~~nGvL~I~lpK~  104 (115)
T d1shsa_          84 KEENASAKFENGVLSVILPKA  104 (115)
T ss_dssp             CGGGCEEEEETTEEEEEEEBC
T ss_pred             eecceEEEEECCEEEEEEEeC
Confidence            999999999999999999985



>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure