Citrus Sinensis ID: 043490


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
cccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEEHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEcccccccccccccccccccc
cccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEEcccccEcccccc
FLHSTQIYATLFHACALHGNIKQAMQLHEHMinnfpnepqdlfvTNHLINMYAkfgylddarhlfdempkrnvVSWTALISGYAQHGNAEECFRLFCSLLqyffpnefSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLqregmapdwcTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSnmnvqpdsATFVSLLSACSHAGLVQEGNKVFHSMLEnhgvvpqldHYACMVDLLGRVGRILEAEKLIrempmepdsVIWSVLLGSCRKHGETRLAELAATKlkqlepgdslgfvqMSNIYCLSGSFNKARLIRKEmkgsrvrkypglswIEIENRVhefasggkrhpqREAIFKKLEELIGQLkgmgyvpetslALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDllgkeivvrdsnrfhhfkdricscndyw
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIrempmepdSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARlirkemkgsrvrkypglsWIEIENRVhefasggkrhpQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKeivvrdsnrfhhfkdricscndyw
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
****TQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFAS*******REAIFKKLEELIGQLKGMGYVPETSLALHDIEE***EEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDY*
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCADEAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query589 2.2.26 [Sep-21-2011]
Q9C9H9745 Pentatricopeptide repeat- yes no 0.901 0.712 0.485 1e-146
Q9LIQ7633 Pentatricopeptide repeat- no no 0.957 0.890 0.396 1e-126
Q9SY02781 Pentatricopeptide repeat- no no 0.959 0.723 0.394 1e-121
Q9STF3657 Pentatricopeptide repeat- no no 0.962 0.863 0.374 1e-120
Q9SI53630 Pentatricopeptide repeat- no no 0.952 0.890 0.397 1e-120
Q9LIC3628 Putative pentatricopeptid no no 0.952 0.893 0.373 1e-119
Q9LSL8738 Pentatricopeptide repeat- no no 0.901 0.719 0.387 1e-117
Q9LZ19635 Pentatricopeptide repeat- no no 0.950 0.881 0.384 1e-115
Q9LNU6760 Pentatricopeptide repeat- no no 0.966 0.748 0.349 1e-115
Q56XI1705 Pentatricopeptide repeat- no no 0.921 0.770 0.386 1e-114
>sp|Q9C9H9|PP114_ARATH Pentatricopeptide repeat-containing protein At1g71420 OS=Arabidopsis thaliana GN=PCMP-H70 PE=2 SV=1 Back     alignment and function desciption
 Score =  520 bits (1339), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 277/571 (48%), Positives = 381/571 (66%), Gaps = 40/571 (7%)

Query: 42  LFVTNHLINMYAKF---GYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCS 98
           ++V N +I+MY +        +A  +F+ +  +N+V+W ++I+ +      ++   +F  
Sbjct: 192 IYVANAVISMYGRCHDGAAAYEAWTVFEAIKFKNLVTWNSMIAAFQCCNLGKKAIGVF-- 249

Query: 99  LLQYFFPNEFSLASVLISCDYLHGK-------------LVHALALKFSLDAHVYVANALI 145
           +  +     F  A++L  C  L+                +H+L +K  L     VA ALI
Sbjct: 250 MRMHSDGVGFDRATLLNICSSLYKSSDLVPNEVSKCCLQLHSLTVKSGLVTQTEVATALI 309

Query: 146 NMYSKSCAD--EAWKVFENMEF-RNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALF 202
            +YS+   D  + +K+F  M   R++++WN +I AF               + + E A+ 
Sbjct: 310 KVYSEMLEDYTDCYKLFMEMSHCRDIVAWNGIITAF--------------AVYDPERAIH 355

Query: 203 LFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYA 262
           LF QL++E ++PDW TFS VLKACAGLVT RHA ++H+ + K GF  DTV+ N+LIHAYA
Sbjct: 356 LFGQLRQEKLSPDWYTFSSVLKACAGLVTARHALSIHAQVIKGGFLADTVLNNSLIHAYA 415

Query: 263 RCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLS 322
           +CGS+ L  +VFD M   D+VSWNS+LKAY+LHGQ    L +F  M++ PDSATF++LLS
Sbjct: 416 KCGSLDLCMRVFDDMDSRDVVSWNSMLKAYSLHGQVDSILPVFQKMDINPDSATFIALLS 475

Query: 323 ACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDS 382
           ACSHAG V+EG ++F SM E    +PQL+HYAC++D+L R  R  EAE++I++MPM+PD+
Sbjct: 476 ACSHAGRVEEGLRIFRSMFEKPETLPQLNHYACVIDMLSRAERFAEAEEVIKQMPMDPDA 535

Query: 383 VIWSVLLGSCRKHGETRLAELAATKLKQL-EPGDSLGFVQMSNIYCLSGSFNKARLIRKE 441
           V+W  LLGSCRKHG TRL +LAA KLK+L EP +S+ ++QMSNIY   GSFN+A L  KE
Sbjct: 536 VVWIALLGSCRKHGNTRLGKLAADKLKELVEPTNSMSYIQMSNIYNAEGSFNEANLSIKE 595

Query: 442 MKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPET-SL 500
           M+  RVRK P LSW EI N+VHEFASGG+  P +EA++++L+ LI  LK MGYVPE  S 
Sbjct: 596 METWRVRKEPDLSWTEIGNKVHEFASGGRHRPDKEAVYRELKRLISWLKEMGYVPEMRSA 655

Query: 501 ALHDIEEEHKEEQLYHHSEKLALVFAIM--NQGSLCRERSVIRIMKNIRICVDCHNFMKL 558
           +    +EE +E+ L HHSEKLAL FA+M   + S C   ++I+IMKN RIC+DCHNFMKL
Sbjct: 656 SQDIEDEEQEEDNLLHHSEKLALAFAVMEGRKSSDC-GVNLIQIMKNTRICIDCHNFMKL 714

Query: 559 ASDLLGKEIVVRDSNRFHHFKDRICSCNDYW 589
           AS LLGKEI++RDSNRFHHFKD  CSCNDYW
Sbjct: 715 ASKLLGKEILMRDSNRFHHFKDSSCSCNDYW 745





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H87 PE=2 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protein At2g03880, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H44 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H85 PE=3 SV=1 Back     alignment and function description
>sp|Q9LSL8|PP446_ARATH Pentatricopeptide repeat-containing protein At5g65570 OS=Arabidopsis thaliana GN=PCMP-H47 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protein At5g04780 OS=Arabidopsis thaliana GN=PCMP-H16 PE=2 SV=2 Back     alignment and function description
>sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protein At1g20230 OS=Arabidopsis thaliana GN=PCMP-H21 PE=2 SV=2 Back     alignment and function description
>sp|Q56XI1|PPR25_ARATH Pentatricopeptide repeat-containing protein At1g09410 OS=Arabidopsis thaliana GN=PCMP-H18 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query589
224135801527 predicted protein [Populus trichocarpa] 0.882 0.986 0.738 0.0
359493563 741 PREDICTED: pentatricopeptide repeat-cont 0.957 0.761 0.552 0.0
356495756 782 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.959 0.722 0.552 1e-179
357481223 774 Pentatricopeptide repeat-containing prot 0.954 0.726 0.516 1e-168
449458777629 PREDICTED: pentatricopeptide repeat-cont 0.904 0.847 0.534 1e-166
297734800538 unnamed protein product [Vitis vinifera] 0.877 0.960 0.496 1e-154
297734798 694 unnamed protein product [Vitis vinifera] 0.840 0.713 0.503 1e-152
297841909 744 pentatricopeptide repeat-containing prot 0.898 0.711 0.498 1e-151
147809821558 hypothetical protein VITISV_025136 [Viti 0.859 0.906 0.483 1e-147
15217470 745 pentatricopeptide repeat-containing prot 0.901 0.712 0.485 1e-145
>gi|224135801|ref|XP_002327307.1| predicted protein [Populus trichocarpa] gi|222835677|gb|EEE74112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/546 (73%), Positives = 450/546 (82%), Gaps = 26/546 (4%)

Query: 51  MYAKFGYLDDARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSL 110
           MYAK G LD AR +FDEM +RNVVSWTALISGYAQHG + ECF LF  +L   +PNEF+ 
Sbjct: 1   MYAKCGDLDRARQVFDEMGRRNVVSWTALISGYAQHGRSYECFSLFSDMLVDCYPNEFAF 60

Query: 111 ASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSKSCAD-------EAWKVFENM 163
           ASV+ISCDY+ GK VHALALK  L A VYV NALI  YSKSC D       EA +VFE+M
Sbjct: 61  ASVIISCDYVCGKQVHALALKMGLIASVYVGNALITRYSKSCEDNFVGYGSEACRVFESM 120

Query: 164 EFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVL 223
           EFRN++SWNSMIAA                   EEEAL LFRQL REG+APDWCTFSIVL
Sbjct: 121 EFRNLVSWNSMIAA-------------------EEEALLLFRQLYREGLAPDWCTFSIVL 161

Query: 224 KACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLV 283
           KACAG VTERHA AV+S + K GFEDD V+AN LIHAYARCGSIS SKQVFDKM   D+V
Sbjct: 162 KACAGFVTERHALAVYSQVVKAGFEDDRVLANTLIHAYARCGSISFSKQVFDKMRSRDVV 221

Query: 284 SWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLEN 343
           SWNS++KAYALHGQAKEAL LFS MNV+PDSAT V+LLSACSHAGLV+EG  +F SM  N
Sbjct: 222 SWNSMIKAYALHGQAKEALHLFSEMNVRPDSATMVALLSACSHAGLVEEGINIFDSMSMN 281

Query: 344 HGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAEL 403
           HGV PQLDHYACMVD+LGR G +LEA +LI  MPM+PDSV+WS LL SCRK+GET+LA+L
Sbjct: 282 HGVSPQLDHYACMVDILGRAGLLLEAGELISRMPMKPDSVVWSALLSSCRKYGETQLAKL 341

Query: 404 AATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVH 463
           AA KLK+LEPG+SLG+VQ+SNIYC  GS+N+A LIR EM GSRVRK PGLSWIEIENRVH
Sbjct: 342 AADKLKELEPGNSLGYVQISNIYCSGGSYNEAGLIRDEMNGSRVRKEPGLSWIEIENRVH 401

Query: 464 EFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLAL 523
           EFASGG+RHPQREAI+ KL  LIGQLKG+GYVPETSLAL DIEEEHK+EQLYHHSEKLAL
Sbjct: 402 EFASGGRRHPQREAIYAKLYSLIGQLKGVGYVPETSLALQDIEEEHKQEQLYHHSEKLAL 461

Query: 524 VFAIMNQGSLCRERSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRIC 583
           VFA+M++GSLC    VIRI+KNIRICVDCHNFMKLASDLL KEIVVRDSNRFHHFK+R+C
Sbjct: 462 VFALMSEGSLCCGGGVIRIVKNIRICVDCHNFMKLASDLLQKEIVVRDSNRFHHFKNRMC 521

Query: 584 SCNDYW 589
           SCNDYW
Sbjct: 522 SCNDYW 527




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359493563|ref|XP_002269754.2| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356495756|ref|XP_003516739.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71420-like [Glycine max] Back     alignment and taxonomy information
>gi|357481223|ref|XP_003610897.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512232|gb|AES93855.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449458777|ref|XP_004147123.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Cucumis sativus] gi|449503335|ref|XP_004161951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734800|emb|CBI17034.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734798|emb|CBI17032.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297841909|ref|XP_002888836.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334677|gb|EFH65095.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147809821|emb|CAN66904.1| hypothetical protein VITISV_025136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15217470|ref|NP_177298.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75169716|sp|Q9C9H9.1|PP114_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g71420 gi|12323734|gb|AAG51830.1|AC016163_19 hypothetical protein; 56014-58251 [Arabidopsis thaliana] gi|332197078|gb|AEE35199.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query589
TAIR|locus:2825364745 AT1G71420 "AT1G71420" [Arabido 0.901 0.712 0.495 1.2e-138
TAIR|locus:2056794630 REME1 "required for efficiency 0.952 0.890 0.397 2.6e-111
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.954 0.719 0.396 1.1e-110
TAIR|locus:2102852657 CRR2 "AT3G46790" [Arabidopsis 0.962 0.863 0.376 6.1e-110
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.950 0.658 0.387 9e-109
TAIR|locus:2091546628 AT3G13770 [Arabidopsis thalian 0.955 0.896 0.377 2.4e-108
TAIR|locus:2155740738 AT5G65570 [Arabidopsis thalian 0.901 0.719 0.387 1.5e-106
TAIR|locus:2198546760 AT1G20230 "AT1G20230" [Arabido 0.733 0.568 0.416 1.9e-106
TAIR|locus:2012295705 AT1G09410 [Arabidopsis thalian 0.896 0.748 0.392 8.3e-106
TAIR|locus:2103483890 OTP84 "ORGANELLE TRANSCRIPT PR 0.974 0.644 0.364 1.1e-105
TAIR|locus:2825364 AT1G71420 "AT1G71420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1357 (482.7 bits), Expect = 1.2e-138, P = 1.2e-138
 Identities = 283/571 (49%), Positives = 384/571 (67%)

Query:    42 LFVTNHLINMYAKF--GYLD-DARHLFDEMPKRNVVSWTALISGYAQHGNAEECFRLFCS 98
             ++V N +I+MY +   G    +A  +F+ +  +N+V+W ++I+ +      ++   +F  
Sbjct:   192 IYVANAVISMYGRCHDGAAAYEAWTVFEAIKFKNLVTWNSMIAAFQCCNLGKKAIGVFMR 251

Query:    99 LLQYFFPNEFSLASVLISCDYLH--GKLV-----------HALALKFSLDAHVYVANALI 145
             +  +     F  A++L  C  L+    LV           H+L +K  L     VA ALI
Sbjct:   252 M--HSDGVGFDRATLLNICSSLYKSSDLVPNEVSKCCLQLHSLTVKSGLVTQTEVATALI 309

Query:   146 NMYSKSCAD--EAWKVFENMEF-RNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALF 202
              +YS+   D  + +K+F  M   R++++WN +I AF               + + E A+ 
Sbjct:   310 KVYSEMLEDYTDCYKLFMEMSHCRDIVAWNGIITAFA--------------VYDPERAIH 355

Query:   203 LFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYA 262
             LF QL++E ++PDW TFS VLKACAGLVT RHA ++H+ + K GF  DTV+ N+LIHAYA
Sbjct:   356 LFGQLRQEKLSPDWYTFSSVLKACAGLVTARHALSIHAQVIKGGFLADTVLNNSLIHAYA 415

Query:   263 RCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNMNVQPDSATFVSLLS 322
             +CGS+ L  +VFD M   D+VSWNS+LKAY+LHGQ    L +F  M++ PDSATF++LLS
Sbjct:   416 KCGSLDLCMRVFDDMDSRDVVSWNSMLKAYSLHGQVDSILPVFQKMDINPDSATFIALLS 475

Query:   323 ACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDS 382
             ACSHAG V+EG ++F SM E    +PQL+HYAC++D+L R  R  EAE++I++MPM+PD+
Sbjct:   476 ACSHAGRVEEGLRIFRSMFEKPETLPQLNHYACVIDMLSRAERFAEAEEVIKQMPMDPDA 535

Query:   383 VIWSVLLGSCRKHGETRLAELAATKLKQL-EPGDSLGFVQMSNIYCLSGSFNKARLIRKE 441
             V+W  LLGSCRKHG TRL +LAA KLK+L EP +S+ ++QMSNIY   GSFN+A L  KE
Sbjct:   536 VVWIALLGSCRKHGNTRLGKLAADKLKELVEPTNSMSYIQMSNIYNAEGSFNEANLSIKE 595

Query:   442 MKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIFKKLEELIGQLKGMGYVPETSLA 501
             M+  RVRK P LSW EI N+VHEFASGG+  P +EA++++L+ LI  LK MGYVPE   A
Sbjct:   596 METWRVRKEPDLSWTEIGNKVHEFASGGRHRPDKEAVYRELKRLISWLKEMGYVPEMRSA 655

Query:   502 LHDIEEEHKEEQ-LYHHSEKLALVFAIMN--QGSLCRERSVIRIMKNIRICVDCHNFMKL 558
               DIE+E +EE  L HHSEKLAL FA+M   + S C   ++I+IMKN RIC+DCHNFMKL
Sbjct:   656 SQDIEDEEQEEDNLLHHSEKLALAFAVMEGRKSSDCGV-NLIQIMKNTRICIDCHNFMKL 714

Query:   559 ASDLLGKEIVVRDSNRFHHFKDRICSCNDYW 589
             AS LLGKEI++RDSNRFHHFKD  CSCNDYW
Sbjct:   715 ASKLLGKEILMRDSNRFHHFKDSSCSCNDYW 745


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2056794 REME1 "required for efficiency of mitochondrial editing 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102852 CRR2 "AT3G46790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091546 AT3G13770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155740 AT5G65570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198546 AT1G20230 "AT1G20230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012295 AT1G09410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_41000228
hypothetical protein (527 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query589
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-141
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-129
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-49
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-37
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 3e-21
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-05
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1285434 pfam12854, PPR_1, PPR repeat 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.004
pfam0153531 pfam01535, PPR, PPR repeat 0.004
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  425 bits (1095), Expect = e-141
 Identities = 210/593 (35%), Positives = 335/593 (56%), Gaps = 32/593 (5%)

Query: 8   YATLFHACALHGNIKQAMQLHEHMINN-FPNEPQDLFVTNHLINMYAKFGYLDDARHLFD 66
           Y  L  AC    +I+    ++ H+ ++ F  EP D ++ N ++ M+ K G L DAR LFD
Sbjct: 126 YDALVEACIALKSIRCVKAVYWHVESSGF--EP-DQYMMNRVLLMHVKCGMLIDARRLFD 182

Query: 67  EMPKRNVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLI-----SCDYLH 121
           EMP+RN+ SW  +I G    GN  E F LF  + +     E     V++           
Sbjct: 183 EMPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARA 242

Query: 122 GKLVHALALKFSLDAHVYVANALINMYSKSCA--DEAWKVFENMEFRNVISWNSMIAAFR 179
           G+ +H   LK  +    +V+ ALI+MYSK C   ++A  VF+ M  +  ++WNSM+A + 
Sbjct: 243 GQQLHCCVLKTGVVGDTFVSCALIDMYSK-CGDIEDARCVFDGMPEKTTVAWNSMLAGY- 300

Query: 180 ACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVH 239
                       A     EEAL L+ +++  G++ D  TFSI+++  + L    HA   H
Sbjct: 301 ------------ALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAH 348

Query: 240 SLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAK 299
           + + + GF  D V   AL+  Y++ G +  ++ VFD+M   +L+SWN+++  Y  HG+  
Sbjct: 349 AGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGT 408

Query: 300 EALQLFSNM---NVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACM 356
           +A+++F  M    V P+  TF+++LSAC ++GL ++G ++F SM ENH + P+  HYACM
Sbjct: 409 KAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACM 468

Query: 357 VDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDS 416
           ++LLGR G + EA  +IR  P +P   +W+ LL +CR H    L  LAA KL  + P   
Sbjct: 469 IELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKL 528

Query: 417 LGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQRE 476
             +V + N+Y  SG   +A  + + +K   +  +P  +WIE++ + H F SG + HPQ  
Sbjct: 529 NNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSR 588

Query: 477 AIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRE 536
            I++KL+EL+ ++   GYV E +  L D++E+ ++    +HSEKLA+ F ++N      E
Sbjct: 589 EIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTS----E 644

Query: 537 RSVIRIMKNIRICVDCHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW 589
            + ++I ++ RIC DCH  +K  + +  +EIVVRD++RFHHFK   CSC DYW
Sbjct: 645 WTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 589
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.81
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.64
PRK14574 822 hmsH outer membrane protein; Provisional 99.64
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.63
KOG2003840 consensus TPR repeat-containing protein [General f 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
KOG1915677 consensus Cell cycle control protein (crooked neck 99.54
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.52
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.49
KOG1126638 consensus DNA-binding cell division cycle control 99.49
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.49
KOG2076895 consensus RNA polymerase III transcription factor 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.46
KOG0547606 consensus Translocase of outer mitochondrial membr 99.46
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG2076 895 consensus RNA polymerase III transcription factor 99.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.43
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.43
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.43
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.42
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.4
KOG1915677 consensus Cell cycle control protein (crooked neck 99.4
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.39
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.37
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.37
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.36
KOG2003840 consensus TPR repeat-containing protein [General f 99.34
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.3
PF1304150 PPR_2: PPR repeat family 99.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
PRK12370553 invasion protein regulator; Provisional 99.23
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.18
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.18
KOG0547606 consensus Translocase of outer mitochondrial membr 99.17
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.15
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.14
PRK12370553 invasion protein regulator; Provisional 99.12
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.1
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.1
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.09
PRK11189296 lipoprotein NlpI; Provisional 99.07
PF1304150 PPR_2: PPR repeat family 99.07
PRK11189296 lipoprotein NlpI; Provisional 99.05
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.03
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.02
KOG2376652 consensus Signal recognition particle, subunit Srp 99.01
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.98
KOG1129478 consensus TPR repeat-containing protein [General f 98.97
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.96
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.95
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.87
KOG1129478 consensus TPR repeat-containing protein [General f 98.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.8
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.79
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.78
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.77
KOG1125579 consensus TPR repeat-containing protein [General f 98.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.75
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.72
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.7
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.67
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.66
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.64
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.62
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.6
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.59
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.59
PRK04841903 transcriptional regulator MalT; Provisional 98.58
PF1285434 PPR_1: PPR repeat 98.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.55
PF1285434 PPR_1: PPR repeat 98.54
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.47
PRK04841903 transcriptional regulator MalT; Provisional 98.46
PLN02789320 farnesyltranstransferase 98.45
KOG2376652 consensus Signal recognition particle, subunit Srp 98.43
PRK10370198 formate-dependent nitrite reductase complex subuni 98.43
PRK15359144 type III secretion system chaperone protein SscB; 98.42
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
KOG1125579 consensus TPR repeat-containing protein [General f 98.38
KOG1128777 consensus Uncharacterized conserved protein, conta 98.37
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.34
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.33
PRK15359144 type III secretion system chaperone protein SscB; 98.32
KOG1128777 consensus Uncharacterized conserved protein, conta 98.32
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.31
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.31
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.29
PRK10370198 formate-dependent nitrite reductase complex subuni 98.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.24
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.23
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.19
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.19
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.19
PLN02789320 farnesyltranstransferase 98.18
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.17
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.16
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.15
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.11
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.08
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.06
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.05
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.99
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.95
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.95
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.94
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.9
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.9
KOG20411189 consensus WD40 repeat protein [General function pr 97.82
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.8
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.78
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.74
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.74
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.68
KOG20411189 consensus WD40 repeat protein [General function pr 97.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.67
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.66
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.61
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.6
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.59
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.58
KOG0553304 consensus TPR repeat-containing protein [General f 97.58
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.52
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.45
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.44
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.42
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.42
COG3898531 Uncharacterized membrane-bound protein [Function u 97.38
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.37
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.35
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.34
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.34
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.33
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.31
COG3898531 Uncharacterized membrane-bound protein [Function u 97.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.25
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.24
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.2
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.15
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.13
KOG0553304 consensus TPR repeat-containing protein [General f 97.12
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.12
COG4700251 Uncharacterized protein conserved in bacteria cont 97.11
PF1337173 TPR_9: Tetratricopeptide repeat 97.09
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.08
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.06
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.02
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.0
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.0
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.98
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.93
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.93
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.91
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.86
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.82
PRK15331165 chaperone protein SicA; Provisional 96.82
PF12688120 TPR_5: Tetratrico peptide repeat 96.8
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.68
PF1343134 TPR_17: Tetratricopeptide repeat 96.65
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.65
PF12688120 TPR_5: Tetratrico peptide repeat 96.63
PRK10803263 tol-pal system protein YbgF; Provisional 96.62
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.61
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.6
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.58
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.51
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.49
PF1337173 TPR_9: Tetratricopeptide repeat 96.48
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.48
COG4700251 Uncharacterized protein conserved in bacteria cont 96.48
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.46
PF1342844 TPR_14: Tetratricopeptide repeat 96.39
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 96.31
PRK10803263 tol-pal system protein YbgF; Provisional 96.3
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.14
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.11
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.11
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.0
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.82
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.79
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.66
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.59
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.56
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.51
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.41
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.2
KOG3941406 consensus Intermediate in Toll signal transduction 95.18
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.03
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.0
KOG1585308 consensus Protein required for fusion of vesicles 95.0
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.85
KOG4555175 consensus TPR repeat-containing protein [Function 94.82
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.58
KOG1941518 consensus Acetylcholine receptor-associated protei 94.57
PRK11906458 transcriptional regulator; Provisional 94.56
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.31
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.27
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.27
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.13
smart00299140 CLH Clathrin heavy chain repeat homology. 94.03
KOG3941406 consensus Intermediate in Toll signal transduction 94.02
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.92
PF13512142 TPR_18: Tetratricopeptide repeat 93.83
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.6
PF13512142 TPR_18: Tetratricopeptide repeat 93.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.36
KOG4555175 consensus TPR repeat-containing protein [Function 93.14
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.09
smart00299140 CLH Clathrin heavy chain repeat homology. 93.06
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.94
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.92
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.87
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.78
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.76
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.59
COG3629280 DnrI DNA-binding transcriptional activator of the 92.53
PRK11906458 transcriptional regulator; Provisional 92.46
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.42
PF1342844 TPR_14: Tetratricopeptide repeat 92.33
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.29
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.28
KOG1258577 consensus mRNA processing protein [RNA processing 92.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 91.85
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.8
PRK15331165 chaperone protein SicA; Provisional 91.27
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 91.04
COG3629280 DnrI DNA-binding transcriptional activator of the 90.75
KOG2610491 consensus Uncharacterized conserved protein [Funct 90.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.67
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.58
KOG1941518 consensus Acetylcholine receptor-associated protei 90.47
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.29
PF1343134 TPR_17: Tetratricopeptide repeat 90.25
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.04
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.02
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.66
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.61
PRK09687280 putative lyase; Provisional 89.43
PRK12798421 chemotaxis protein; Reviewed 89.33
KOG4234271 consensus TPR repeat-containing protein [General f 89.1
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.3
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 87.82
KOG1586288 consensus Protein required for fusion of vesicles 87.8
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.75
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.41
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.29
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.99
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.31
KOG1585308 consensus Protein required for fusion of vesicles 86.03
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 85.19
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 84.94
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.7
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 84.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.43
COG3947361 Response regulator containing CheY-like receiver a 84.27
PRK11619644 lytic murein transglycosylase; Provisional 84.11
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.83
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.38
COG1747 711 Uncharacterized N-terminal domain of the transcrip 82.25
KOG4648 536 consensus Uncharacterized conserved protein, conta 82.09
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.86
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 81.8
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.32
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 80.75
PRK09687280 putative lyase; Provisional 80.62
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 80.57
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.5
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.15
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.02
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-117  Score=966.18  Aligned_cols=570  Identities=36%  Similarity=0.645  Sum_probs=561.9

Q ss_pred             CCCChhHHHHHHHHHHccCCHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHhcCChHHHHHHHhcCCCCCcchHHHHH
Q 043490            1 FLHSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPKRNVVSWTALI   80 (589)
Q Consensus         1 ~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~f~~m~~~~~~~~~~li   80 (589)
                      +.||..+|+.++.+|++.++++.|.++|..|.+.  |..||..++|.|+.+|+++|++++|+++|++|++||.++||++|
T Consensus       119 ~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~--g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~~~~t~n~li  196 (697)
T PLN03081        119 FTLPASTYDALVEACIALKSIRCVKAVYWHVESS--GFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPERNLASWGTII  196 (697)
T ss_pred             CCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHh--CCCcchHHHHHHHHHHhcCCCHHHHHHHHhcCCCCCeeeHHHHH
Confidence            4689999999999999999999999999999998  55599999999999999999999999999999999999999999


Q ss_pred             HHHHhCCChhHHHHHHHHHHhc-cCCCceeHHHHHHHhc----hhhHHHHHHHHHHhcCCCchhHHHHHHHHHhc-CCHH
Q 043490           81 SGYAQHGNAEECFRLFCSLLQY-FFPNEFSLASVLISCD----YLHGKLVHALALKFSLDAHVYVANALINMYSK-SCAD  154 (589)
Q Consensus        81 ~~~~~~g~~~~A~~~~~~m~~~-~~p~~~t~~~~l~a~~----~~~~~~~~~~~~~~g~~~~~~~~~~li~~y~~-g~~~  154 (589)
                      .+|++.|++++|+++|++|.+. ..||..||..++.+|.    ...++++|..+.+.|+.+|..++|+|+++|++ |+++
T Consensus       197 ~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~  276 (697)
T PLN03081        197 GGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIE  276 (697)
T ss_pred             HHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHH
Confidence            9999999999999999999998 9999999999999998    88999999999999999999999999999999 9999


Q ss_pred             HHHHHHhhCCCCChhHHHHHHHHHHcCCcHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhCcCcHHH
Q 043490          155 EAWKVFENMEFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERH  234 (589)
Q Consensus       155 ~A~~lf~~m~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~  234 (589)
                      +|.++|++|+++|+++||+||.+|             .+.|+.++|+++|++|.+.|+.||..||++++.+|++.|+++.
T Consensus       277 ~A~~vf~~m~~~~~vt~n~li~~y-------------~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~  343 (697)
T PLN03081        277 DARCVFDGMPEKTTVAWNSMLAGY-------------ALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEH  343 (697)
T ss_pred             HHHHHHHhCCCCChhHHHHHHHHH-------------HhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHH
Confidence            999999999999999999999999             9999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCcHHHHHHHHHHHHhcCCHHHHHHHHhhcCCCChhHHHHHHHHHHHcCCHHHHHHHHHhC---CCC
Q 043490          235 ASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMTYHDLVSWNSILKAYALHGQAKEALQLFSNM---NVQ  311 (589)
Q Consensus       235 a~~i~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m---~~~  311 (589)
                      |.++|..|.+.|++||..++++|+++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|+++|++|   |+.
T Consensus       344 a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~  423 (697)
T PLN03081        344 AKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVA  423 (697)
T ss_pred             HHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999   999


Q ss_pred             CCHHHHHHHHHHHhccCcHHHHHHHHHHhHHhcCCccCcchHHHHHHHHhhcCCHHHHHHHHHhCCCCCCHHHHHHHHHH
Q 043490          312 PDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREMPMEPDSVIWSVLLGS  391 (589)
Q Consensus       312 p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~p~~~~~~~ll~~  391 (589)
                      ||..||+.++.+|++.|++++|.++|+.|.+++|+.|+..+|++|+++|+++|++++|.+++++|+..|+..+|++|+.+
T Consensus       424 Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a  503 (697)
T PLN03081        424 PNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTA  503 (697)
T ss_pred             CCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999888899999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCHHHHHHHHHHHhhcCCCChhHHHHHHHHhhhcCChHHHHHHHHHHhcCCCccCCceeeEEECCEEEEEeeCCCC
Q 043490          392 CRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKR  471 (589)
Q Consensus       392 ~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~s~~~~~~~~~~~~~~~~~  471 (589)
                      |+.+|+.+.|..+++++.+++|++..+|..|+++|++.|+|++|.++++.|+++|+++.|++||+++++.+|.|.+|+.+
T Consensus       504 ~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~  583 (697)
T PLN03081        504 CRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRL  583 (697)
T ss_pred             HHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccHHHHHHHHHHHHHHHHhCCcccCCCccccccchhHHhhhhhhhhHHHHHHHHhhhCCCCCCCCCeEEEEecccccCC
Q 043490          472 HPQREAIFKKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLALVFAIMNQGSLCRERSVIRIMKNIRICVD  551 (589)
Q Consensus       472 ~~~~~~~~~~l~~l~~~m~~~g~~pd~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~c~~  551 (589)
                      ||+.++|+..+.++..+|++.||.||+.+++|++++++|+..+..||||||+||||+++|    +|.||||+||||+|+|
T Consensus       584 h~~~~~i~~~l~~l~~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l~~~~----~~~~i~i~knlr~c~d  659 (697)
T PLN03081        584 HPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTS----EWTPLQITQSHRICKD  659 (697)
T ss_pred             CccHHHHHHHHHHHHHHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhCccCC----CCCeEEEecCCEECCC
Confidence            999999999999999999999999999999999999999999999999999999999999    9999999999999999


Q ss_pred             CchhhHhhhhhhCceEEEecCCccccccCCccCCCCCC
Q 043490          552 CHNFMKLASDLLGKEIVVRDSNRFHHFKDRICSCNDYW  589 (589)
Q Consensus       552 ~~~~~~~~~~~~~~~~~~~~~~~~h~~~~g~~s~~~~~  589 (589)
                      ||+|+|+||++.+|+|||||.+|||||+||+|||+|||
T Consensus       660 ch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        660 CHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             chhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            99999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query589
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 54.1 bits (128), Expect = 1e-07
 Identities = 36/344 (10%), Positives = 88/344 (25%), Gaps = 50/344 (14%)

Query: 193 KMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTV 252
           ++ +++ A  L    ++   +P     + +L+   G ++     A     ++        
Sbjct: 69  RLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQ 128

Query: 253 IANALIHAYARCGSISLSKQVFDKMTYH-------DLVSWNSILKAYALHGQAKEALQLF 305
              A          + L+  +               L  +N+++  +A  G  KE + + 
Sbjct: 129 RLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVL 188

Query: 306 SNM---NVQPDSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGR 362
             +    + PD  +                                    YA  +  +GR
Sbjct: 189 FMVKDAGLTPDLLS------------------------------------YAAALQCMGR 212

Query: 363 VGRILEA-EKLIREMPMEPDSVIWSVLLGSCRKHGETRLAELAATKLKQLE--PGDSLGF 419
             +     E+ + +M  E   +  ++         +      A  K+K     P      
Sbjct: 213 QDQDAGTIERCLEQMSQEGLKLQ-ALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPP 271

Query: 420 VQMSNIYCLSGSFNKARLIRKEMKGSRVRKYPGLSWIEIENRVHEFASGGKRHPQREAIF 479
           V  S +     + +      K     +  +      + +E          ++        
Sbjct: 272 VNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKPTLPSKEV 331

Query: 480 KKLEELIGQLKGMGYVPETSLALHDIEEEHKEEQLYHHSEKLAL 523
           K   + +  L+                   +E      S    L
Sbjct: 332 KHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYPFL 375


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query589
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.6
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.56
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
3u4t_A272 TPR repeat-containing protein; structural genomics 99.54
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.49
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.44
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.44
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.41
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.41
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.39
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.37
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.34
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.32
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.3
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.29
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.24
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.21
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.2
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.14
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.09
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.99
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.96
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.94
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.91
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.89
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.88
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.85
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.82
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.81
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.77
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.77
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.7
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.67
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.66
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.64
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.62
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.61
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.56
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.55
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.52
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.51
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.47
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.46
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.44
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.44
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.4
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.38
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.37
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.36
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.35
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.35
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.34
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.28
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.26
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.25
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.24
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.24
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.23
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.21
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.19
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.19
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.17
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.16
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.13
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.1
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.09
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.05
3k9i_A117 BH0479 protein; putative protein binding protein, 98.02
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.02
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.99
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.98
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.98
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.98
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.96
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.95
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.95
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.94
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.93
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.92
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.91
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.9
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.9
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.87
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.85
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.83
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.82
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.81
3k9i_A117 BH0479 protein; putative protein binding protein, 97.78
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.76
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.71
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.68
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.64
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.63
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.53
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.45
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.44
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.36
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.31
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.15
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.05
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.94
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.82
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.67
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.48
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.25
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.87
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.51
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.46
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.39
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.04
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 94.94
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.59
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.99
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 91.82
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.42
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 91.23
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.04
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 89.12
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.88
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.79
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 87.65
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 87.52
2p58_C116 Putative type III secretion protein YSCG; type III 87.1
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 86.92
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.33
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.19
2p58_C116 Putative type III secretion protein YSCG; type III 86.17
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.9
2uwj_G115 Type III export protein PSCG; virulence, chaperone 83.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.56
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 83.25
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 83.12
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.44
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.59
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.54
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 80.52
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 80.46
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.35
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.2e-38  Score=336.80  Aligned_cols=422  Identities=12%  Similarity=-0.015  Sum_probs=320.9

Q ss_pred             CChhHHHHHHHHHHccCCHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHhcCChHHHHHHHhcCC-CC----------
Q 043490            3 HSTQIYATLFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMP-KR----------   71 (589)
Q Consensus         3 p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~f~~m~-~~----------   71 (589)
                      |+..++..++.+|.+.|++++|..+|+.+... +   +++.+++.++.+|.++|++++|+++|+++. ..          
T Consensus       115 p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~---~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~  190 (597)
T 2xpi_A          115 GNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY-N---RSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLL  190 (597)
T ss_dssp             CCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG-G---TCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------
T ss_pred             CCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc-c---cchhHHHHHHHHHHHHhhHHHHHHHHhccCCcccccccccccc
Confidence            33444444444444444444444444443221 2   445555555555555555555555555322 11          


Q ss_pred             --------CcchHHHHHHHHHhCCChhHHHHHHHHHHhccCCCceeHHHHHHHhc----hhhHHHH----HHHHHHhcCC
Q 043490           72 --------NVVSWTALISGYAQHGNAEECFRLFCSLLQYFFPNEFSLASVLISCD----YLHGKLV----HALALKFSLD  135 (589)
Q Consensus        72 --------~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~p~~~t~~~~l~a~~----~~~~~~~----~~~~~~~g~~  135 (589)
                              +..+|+.++.+|.+.|++++|+++|++|.+. .|+..+....+..+.    .......    +..+...+..
T Consensus       191 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  269 (597)
T 2xpi_A          191 MQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMV-DAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAA  269 (597)
T ss_dssp             CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH-CTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHH
T ss_pred             ccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh-CchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHH
Confidence                    2445555555555555555555555555443 233222222222221    0000000    1112222233


Q ss_pred             CchhHHHHHHHHHhc-CCHHHHHHHHhhCCC--CChhHHHHHHHHHHcCCcHHHHHHHHHHcCCHHHHHHHHHHHHHcCC
Q 043490          136 AHVYVANALINMYSK-SCADEAWKVFENMEF--RNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGM  212 (589)
Q Consensus       136 ~~~~~~~~li~~y~~-g~~~~A~~lf~~m~~--~~~~~~~~li~~~~~~g~~~~a~~~~~~~g~~~~A~~~~~~m~~~g~  212 (589)
                      ....+++.++.+|.+ |++++|.++|+++.+  ++..+|+.++.+|             .+.|++++|+++|+++.+.+ 
T Consensus       270 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~-------------~~~g~~~~A~~~~~~~~~~~-  335 (597)
T 2xpi_A          270 FLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTL-------------FVRSRFIDVLAITTKILEID-  335 (597)
T ss_dssp             HHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHH-------------HHTTCHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHH-------------HHhcCHHHHHHHHHHHHHcC-
Confidence            334456666888999 999999999999987  7999999999999             99999999999999999865 


Q ss_pred             CCCHHHHHHHHHHHhCcCcHHHHHHHHHHHHHhCCCCcHHHHHHHHHHHHhcCCHHHHHHHHhhcC---CCChhHHHHHH
Q 043490          213 APDWCTFSIVLKACAGLVTERHASAVHSLIAKYGFEDDTVIANALIHAYARCGSISLSKQVFDKMT---YHDLVSWNSIL  289 (589)
Q Consensus       213 ~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li  289 (589)
                      +.+..++..++.++.+.|+.++|.++++.+.+.. +.+..+++.++.+|.+.|++++|.++|+++.   ..+..+|+.++
T Consensus       336 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~  414 (597)
T 2xpi_A          336 PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFA  414 (597)
T ss_dssp             TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHH
T ss_pred             cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence            3477889999999999999999999999999765 7789999999999999999999999999886   45688999999


Q ss_pred             HHHHHcCCHHHHHHHHHhC-CCCC-CHHHHHHHHHHHhccCcHHHHHHHHHHhHHhcCCccCcchHHHHHHHHhhcCCHH
Q 043490          290 KAYALHGQAKEALQLFSNM-NVQP-DSATFVSLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRIL  367 (589)
Q Consensus       290 ~~~~~~g~~~~A~~~~~~m-~~~p-~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~  367 (589)
                      .+|.+.|++++|+++|+++ ...| +..++..++.+|.+.|++++|.++|+.+.+..  +.+..+|+.++..|.+.|+++
T Consensus       415 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~  492 (597)
T 2xpi_A          415 HSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF--QYDPLLLNELGVVAFNKSDMQ  492 (597)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--CCChHHHHHHHHHHHHhCCHH
Confidence            9999999999999999999 5445 77899999999999999999999999997642  336788999999999999999


Q ss_pred             HHHHHHHhC-------CCCCC--HHHHHHHHHHHHHcCCHHHHHHHHHHHhhcCCCChhHHHHHHHHhhhcCChHHHHHH
Q 043490          368 EAEKLIREM-------PMEPD--SVIWSVLLGSCRKHGETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGSFNKARLI  438 (589)
Q Consensus       368 ~A~~~~~~m-------~~~p~--~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~  438 (589)
                      +|.++|+++       +..|+  ..+|..++.+|.+.|++++|...++++.+.+|+++.+|..++.+|.+.|++++|.+.
T Consensus       493 ~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~  572 (597)
T 2xpi_A          493 TAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITH  572 (597)
T ss_dssp             HHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             HHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHH
Confidence            999999988       45787  889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCC
Q 043490          439 RKEMKGSR  446 (589)
Q Consensus       439 ~~~m~~~~  446 (589)
                      ++++.+..
T Consensus       573 ~~~~l~~~  580 (597)
T 2xpi_A          573 LHESLAIS  580 (597)
T ss_dssp             HHHHHHHC
T ss_pred             HHHHHhcC
Confidence            99998743



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query589
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.01
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.97
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.91
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.82
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.8
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.47
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.36
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.29
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.26
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.17
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.95
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.91
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.89
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.88
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.87
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.82
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.73
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.67
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.62
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.49
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.22
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.16
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.14
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.04
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.78
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.73
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.67
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.43
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.84
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.14
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.35
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.69
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.22
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.64
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 89.79
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.81
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=4.3e-21  Score=191.10  Aligned_cols=370  Identities=14%  Similarity=0.101  Sum_probs=292.6

Q ss_pred             HHHHHHccCCHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHhcCChHHHHHHHhcCCC--C-CcchHHHHHHHHHhCC
Q 043490           11 LFHACALHGNIKQAMQLHEHMINNFPNEPQDLFVTNHLINMYAKFGYLDDARHLFDEMPK--R-NVVSWTALISGYAQHG   87 (589)
Q Consensus        11 ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~f~~m~~--~-~~~~~~~li~~~~~~g   87 (589)
                      +...+-+.|++++|.+.++.+++..|   .++.++..+...|.+.|++++|...|++..+  | +..+|..+...|.+.|
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p---~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEP---DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCT---TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCC---CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            44567788999999999999998877   7889999999999999999999999998753  4 5678999999999999


Q ss_pred             ChhHHHHHHHHHHhccCCCceeHHHHHHHhchhhHHHHHHHHHHhcCCCchhHHHHHHHHHhc-CCHHHHHHHHhh---C
Q 043490           88 NAEECFRLFCSLLQYFFPNEFSLASVLISCDYLHGKLVHALALKFSLDAHVYVANALINMYSK-SCADEAWKVFEN---M  163 (589)
Q Consensus        88 ~~~~A~~~~~~m~~~~~p~~~t~~~~l~a~~~~~~~~~~~~~~~~g~~~~~~~~~~li~~y~~-g~~~~A~~lf~~---m  163 (589)
                      ++++|+..+...... .|.                              +..........+.. +....+......   .
T Consensus        82 ~~~~A~~~~~~~~~~-~~~------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  130 (388)
T d1w3ba_          82 QLQEAIEHYRHALRL-KPD------------------------------FIDGYINLAAALVAAGDMEGAVQAYVSALQY  130 (388)
T ss_dssp             CHHHHHHHHHHHHHH-CTT------------------------------CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHH
T ss_pred             ccccccccccccccc-ccc------------------------------ccccccccccccccccccccccccccccccc
Confidence            999999999988765 111                              11111112222222 222222222221   1


Q ss_pred             CCCChhHHHHHHHHHHcCCcHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhCcCcHHHHHHHHHHHH
Q 043490          164 EFRNVISWNSMIAAFRACKLEAQAIELFAKMKNEEEALFLFRQLQREGMAPDWCTFSIVLKACAGLVTERHASAVHSLIA  243 (589)
Q Consensus       164 ~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~  243 (589)
                      .......+.......             ...+....+...+.+..... +-+...+..+...+...|+.+.|...+...+
T Consensus       131 ~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al  196 (388)
T d1w3ba_         131 NPDLYCVRSDLGNLL-------------KALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV  196 (388)
T ss_dssp             CTTCTHHHHHHHHHH-------------HTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHH
T ss_pred             ccccccccccccccc-------------cccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHH
Confidence            223333444444444             66777777777777776643 3355677777788889999999999999888


Q ss_pred             HhCCCCcHHHHHHHHHHHHhcCCHHHHHHHHhhcC---CCChhHHHHHHHHHHHcCCHHHHHHHHHhC-CCCCC-HHHHH
Q 043490          244 KYGFEDDTVIANALIHAYARCGSISLSKQVFDKMT---YHDLVSWNSILKAYALHGQAKEALQLFSNM-NVQPD-SATFV  318 (589)
Q Consensus       244 ~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m-~~~p~-~~t~~  318 (589)
                      +.. +.+..++..+...|...|++++|...|++..   ..+...|..+...+.+.|++++|++.|++. .+.|+ ..++.
T Consensus       197 ~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~  275 (388)
T d1w3ba_         197 TLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYC  275 (388)
T ss_dssp             HHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHH
T ss_pred             HhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHH
Confidence            875 5667888899999999999999999998876   456678888999999999999999999998 66675 56888


Q ss_pred             HHHHHHhccCcHHHHHHHHHHhHHhcCCccCcchHHHHHHHHhhcCCHHHHHHHHHhC-CCCCC-HHHHHHHHHHHHHcC
Q 043490          319 SLLSACSHAGLVQEGNKVFHSMLENHGVVPQLDHYACMVDLLGRVGRILEAEKLIREM-PMEPD-SVIWSVLLGSCRKHG  396 (589)
Q Consensus       319 ~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m-~~~p~-~~~~~~ll~~~~~~g  396 (589)
                      .+..++...|++++|.+.++.....  .+.+...+..+...|.+.|++++|++.|++. ...|+ ..+|..+...+...|
T Consensus       276 ~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g  353 (388)
T d1w3ba_         276 NLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQG  353 (388)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcC
Confidence            8999999999999999999988654  2446678888999999999999999999987 66776 788999999999999


Q ss_pred             CHHHHHHHHHHHhhcCCCChhHHHHHHHHhhhcCC
Q 043490          397 ETRLAELAATKLKQLEPGDSLGFVQMSNIYCLSGS  431 (589)
Q Consensus       397 ~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  431 (589)
                      ++++|+..++++++++|+++.+|..|+.+|.+.|+
T Consensus       354 ~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         354 KLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             CCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999999999999998875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure