Citrus Sinensis ID: 043541

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
IPVRGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
ccccccccccccccccccccEEEccEEEEcccccccccccccEEEEEEEEccHHHHHHHHHccccccEEEccccccccEEEccccccccEEEEEccccccEEEEEccccEEEEcccccccccccccccccccEEEEccccccHHHHHHHcccccccccccccccccccEEEccccccccEEEcccccEEEEEEcccccccccccccccccHHHHccHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccccccEEEEEccccccEEEEEEccccc
ccccccccccccHHHEEHHHcccccEEEEcccEcccccHHHHHEEHHEEcccHHHHHHHHHccccHHEEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEccccEEEEEcccccccEEEEcccccccEEEcccccccHHHHHHHHccccHHHEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccEEEcccccccccHEEEEEHHHHHHHHHHHHcccEEccHHHccccccccccccEEEEEEccccccHcHHHHHHHHHHHcccccEEEEEEccccEEEEEEEEccccc
ipvrgtllpgicssrlvlskyipqtyckldshtrnvTLSSLRELGLFKCAANDEAIRDIVagcplieclkiidcrglksleflnlgklskfmvrnedrlarvsicgpnvrlvdisslhapcgiNVALCKNLKEFKLFKISITNEwlcnqfselpflEYVEIFRCMKIRKLLVRSCNTldefkldtpnlsvfdyegdmvsfssnalalsetSLFLTSLFLFAPLKNFLKAAIIPRElreilsppltyenhvclavdseyntfSFAKLVDSLLwisphaetlsikyndcdhefsfqtieslpy
ipvrgtllpgicssRLVLSKYIPQtyckldshtrnVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
IPVRGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNalalsetslfltslflfaplKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
*****TLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQT******
***RGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAI*********SPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLP*
IPVRGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
IPVRGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IPVRGTLLPGICSSRLVLSKYIPQTYCKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKLLVRSCNTLDEFKLDTPNLSVFDYEGDMVSFSSNALALSETSLFLTSLFLFAPLKNFLKAAIIPRELREILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIKYNDCDHEFSFQTIESLPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query301 2.2.26 [Sep-21-2011]
Q84W80481 F-box/LRR-repeat protein yes no 0.445 0.278 0.242 1e-06
Q9LZ15456 Putative F-box/LRR-repeat no no 0.295 0.195 0.3 0.0001
Q9LSJ3465 Putative F-box/LRR-repeat no no 0.292 0.189 0.292 0.0002
Q1PE04258 F-box/LRR-repeat protein no no 0.285 0.333 0.255 0.0005
Q501G5307 F-box protein At5g03100 O no no 0.315 0.309 0.306 0.0008
>sp|Q84W80|FBL42_ARATH F-box/LRR-repeat protein At3g03360 OS=Arabidopsis thaliana GN=At3g03360 PE=2 SV=2 Back     alignment and function desciption
 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 67/136 (49%), Gaps = 2/136 (1%)

Query: 35  NVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLGKLSKFMVR 94
           +V+ +SL+ L L+ C  +DE+I  I++GCP++E L +  C+ LK L+     +L    + 
Sbjct: 183 SVSWTSLKNLSLYHCNISDESIAIILSGCPILESLLLFFCKKLKVLDLSKSPRLITLEIT 242

Query: 95  NEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWLCNQFSELP 154
              R+    +  P++R + + +   PC +      +  E  +   +I +  L   F +  
Sbjct: 243 RRCRMEPTQLVAPHIRCLRLINSEKPCALVDVSSLSQAELDITAYAIVDNKLEADFHQTM 302

Query: 155 FLEYVEIFRCMKIRKL 170
            ++ +E  +C  + KL
Sbjct: 303 VVKMLE--KCQNVEKL 316

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LZ15|FBL78_ARATH Putative F-box/LRR-repeat protein At5g02700 OS=Arabidopsis thaliana GN=At5g02700 PE=4 SV=1 Back     alignment and function description
>sp|Q9LSJ3|FBL48_ARATH Putative F-box/LRR-repeat protein At3g28410 OS=Arabidopsis thaliana GN=At3g28410 PE=4 SV=2 Back     alignment and function description
>sp|Q1PE04|FBL25_ARATH F-box/LRR-repeat protein 25 OS=Arabidopsis thaliana GN=FBL25 PE=2 SV=1 Back     alignment and function description
>sp|Q501G5|FB250_ARATH F-box protein At5g03100 OS=Arabidopsis thaliana GN=At5g03100 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
449476923 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.853 0.547 0.299 9e-29
449458247 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.853 0.547 0.303 1e-28
147833276 521 hypothetical protein VITISV_011919 [Viti 0.810 0.468 0.298 1e-18
255549680 514 hypothetical protein RCOM_1485780 [Ricin 0.724 0.424 0.308 2e-16
297743071 552 unnamed protein product [Vitis vinifera] 0.810 0.442 0.305 5e-16
225442254 520 PREDICTED: putative F-box protein At3g44 0.813 0.471 0.299 5e-16
357495939 519 FBD-associated F-box protein [Medicago t 0.591 0.342 0.278 2e-10
357454743 761 Agglutinin alpha chain [Medicago truncat 0.687 0.272 0.247 1e-09
356557323 833 PREDICTED: uncharacterized protein LOC10 0.574 0.207 0.274 7e-09
357503353 557 F-box/LRR-repeat protein [Medicago trunc 0.578 0.312 0.272 1e-08
>gi|449476923|ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  133 bits (335), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 86/287 (29%), Positives = 139/287 (48%), Gaps = 30/287 (10%)

Query: 27  CKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLG 86
           CKL        L S++ + L    A DE ++ +V+ CP I+ +K+  C GL++L      
Sbjct: 143 CKLCPSLDGYKLLSMKSVSLLGVFAEDETVKRLVSNCPFIQHIKLDSCLGLRNLWLCETN 202

Query: 87  KLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWL 146
           +L    V+N   L        N++  +      PC IN++ CKNLK  KL  ++IT++W 
Sbjct: 203 ELITMEVQNNSGLYEFGTKAMNLQAFEFRGQFQPCCINISSCKNLKTLKLSMVAITDDWF 262

Query: 147 CNQFSELPFLEYVEIFRCM----------KIRKLLVRSCNTLDEFKLDTPNLSVFDYEGD 196
              FSE P LE + +  C            ++K ++  C ++    +DTP LS  ++ GD
Sbjct: 263 NRCFSEFPLLEILALSYCHMLESLRISSSHLKKFILCGCESVTRVDIDTPCLSGLEFSGD 322

Query: 197 MVSFSSNALALSETSLFLTS--------------LFLFAPLKNFL------KAAIIPREL 236
           ++SFS NA ALS+  + L+               L  F  LK+        K+ +IP+EL
Sbjct: 323 VISFSLNAPALSQADIELSPRIFDNPWVVKQIEFLAHFNHLKSLTLQSQTGKSVVIPQEL 382

Query: 237 REILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIK 283
           RE    PL    H+ L +     + S   LV +LLWI+P  +T++++
Sbjct: 383 RETFGSPLYGVKHLKLRIIKPLFSPSLKDLVKALLWIAPQPQTIAVE 429

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449458247|ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147833276|emb|CAN68530.1| hypothetical protein VITISV_011919 [Vitis vinifera] gi|297743067|emb|CBI35934.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549680|ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis] gi|223544796|gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis] Back     alignment and taxonomy information
>gi|297743071|emb|CBI35938.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442254|ref|XP_002275641.1| PREDICTED: putative F-box protein At3g44060 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357495939|ref|XP_003618258.1| FBD-associated F-box protein [Medicago truncatula] gi|355493273|gb|AES74476.1| FBD-associated F-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357454743|ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula] gi|355486700|gb|AES67903.1| Agglutinin alpha chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|356557323|ref|XP_003546966.1| PREDICTED: uncharacterized protein LOC100794867 [Glycine max] Back     alignment and taxonomy information
>gi|357503353|ref|XP_003621965.1| F-box/LRR-repeat protein [Medicago truncatula] gi|357503387|ref|XP_003621982.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496980|gb|AES78183.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496997|gb|AES78200.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
TAIR|locus:2099644481 AT3G03360 [Arabidopsis thalian 0.508 0.318 0.245 1.3e-07
TAIR|locus:2143463307 AT5G03100 "AT5G03100" [Arabido 0.475 0.465 0.261 0.00027
TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 147 (56.8 bits), Expect = 1.3e-07, P = 1.3e-07
 Identities = 40/163 (24%), Positives = 77/163 (47%)

Query:    16 LVLSKYIPQTY----CKLDSHTRN----VTLSSLRELGLFKCAANDEAIRDIVAGCPLIE 67
             L ++  + Q Y    CK D  + N    V+ +SL+ L L+ C  +DE+I  I++GCP++E
Sbjct:   156 LYINSSLKQLYLDFGCKKDFISLNPKCSVSWTSLKNLSLYHCNISDESIAIILSGCPILE 215

Query:    68 CLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVAL 127
              L +  C+ LK L+     +L    +    R+    +  P++R + + +   PC +    
Sbjct:   216 SLLLFFCKKLKVLDLSKSPRLITLEITRRCRMEPTQLVAPHIRCLRLINSEKPCALVDVS 275

Query:   128 CKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKL 170
               +  E  +   +I +  L   F +   ++ +E  +C  + KL
Sbjct:   276 SLSQAELDITAYAIVDNKLEADFHQTMVVKMLE--KCQNVEKL 316
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2143463 AT5G03100 "AT5G03100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034154001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (456 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 301
KOG4341483 consensus F-box protein containing LRR [General fu 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.53
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.99
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.83
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.76
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.61
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.18
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.63
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.97
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.24
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.21
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.63
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.06
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 92.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.7
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.01
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 91.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 91.59
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.22
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 90.79
PRK15386426 type III secretion protein GogB; Provisional 89.94
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 89.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.13
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.03
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 88.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.45
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 87.97
KOG1259490 consensus Nischarin, modulator of integrin alpha5 86.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.9
PRK15386 426 type III secretion protein GogB; Provisional 86.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 85.08
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 83.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 80.65
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=98.60  E-value=1.8e-09  Score=103.27  Aligned_cols=35  Identities=40%  Similarity=0.824  Sum_probs=19.6

Q ss_pred             CcEEEeccccc-ChHHHHHHHhcCCcccEEeeecCC
Q 043541           41 LRELGLFKCAA-NDEAIRDIVAGCPLIECLKIIDCR   75 (301)
Q Consensus        41 Lk~L~L~~c~i-~d~~L~~Lis~Cp~LE~L~L~~C~   75 (301)
                      ||.|+|+||.- .|+.+..++++||+||+|.+.+|.
T Consensus       140 lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~  175 (483)
T KOG4341|consen  140 LKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCK  175 (483)
T ss_pred             cccccccccccCCcchhhHHhhhCCchhhhhhhcce
Confidence            55555555543 345555555555555555555555

>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.4 bits (122), Expect = 2e-07
 Identities = 51/322 (15%), Positives = 93/322 (28%), Gaps = 73/322 (22%)

Query: 16  LVLSKYI-------PQTYCKLDSHTRNVTLSSLRELGLF----KCAANDEAIRDIVAGCP 64
           L+ +++          T   +     ++TL+      L      C   D   R+++   P
Sbjct: 269 LLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLP-REVLTTNP 327

Query: 65  LIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARV-SICGPNVRLVDISSLHAPCGI 123
               L II        + L      K +  N D+L  +       +   +   +     +
Sbjct: 328 RR--LSII---AESIRDGLATWDNWKHV--NCDKLTTIIESSLNVLEPAEYRKMFDRLSV 380

Query: 124 ---NV-----ALC---KNLKEF-------KLFKISITNEWLCNQFSELPFLEYVEIFRCM 165
              +       L     ++ +        KL K S+  +        +P +      +  
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLE 440

Query: 166 KIRKL---LVRSCNTLDEFKLDTPNLSVFD-YEGDMVSFS------SNALALSETSLFLT 215
               L   +V   N    F  D       D Y      +S       N       +LF  
Sbjct: 441 NEYALHRSIVDHYNIPKTFDSDDLIPPYLDQY-----FYSHIGHHLKNIEHPERMTLF-R 494

Query: 216 SLFL-FAPLKNFLKAAII--------PRELREILSPPLTYENHVCLAVDSEYNTFSFAKL 266
            +FL F     FL+  I            +   L     Y+ ++C       N   + +L
Sbjct: 495 MVFLDF----RFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICD------NDPKYERL 544

Query: 267 VDSLLWISPHAETLSIKYNDCD 288
           V+++L   P  E   I     D
Sbjct: 545 VNAILDFLPKIEENLICSKYTD 566
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.03
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.8
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.71
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.71
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.56
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.55
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.5
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.49
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.4
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.31
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.3
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.23
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.1
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.03
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.03
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.02
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.01
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.01
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.95
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.9
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.82
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.76
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.72
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.68
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.62
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.55
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.52
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.48
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.46
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.39
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.38
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.1
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.01
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.89
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.87
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.36
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.13
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.1
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.03
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 94.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.24
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 93.95
1w8a_A192 SLIT protein; signaling protein, secreted protein, 93.83
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 93.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.75
4fdw_A401 Leucine rich hypothetical protein; putative cell s 91.05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 90.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 89.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 88.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 88.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 87.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 84.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.27
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.03  E-value=2.5e-10  Score=104.67  Aligned_cols=140  Identities=11%  Similarity=0.152  Sum_probs=107.9

Q ss_pred             eecccCccccCC-CCCCCCCCCcEEEecccccChHHHHHHHhcCCcccEEeeecCCCceE---EEcCCCCCccEEEEEee
Q 043541           21 YIPQTYCKLDSH-TRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKS---LEFLNLGKLSKFMVRNE   96 (301)
Q Consensus        21 ~~~~~~C~l~~~-~~~~~~~sLk~L~L~~c~i~d~~L~~Lis~Cp~LE~L~L~~C~~l~~---L~i~~~~~Lk~L~i~~C   96 (301)
                      +++++++.+... ....++++|+.|+|.++.+.+.++...+.+|+.|++|+|++|. +..   -.+.++++|++|++++|
T Consensus        74 ~L~l~~n~l~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~~-l~~~~~~~l~~~~~L~~L~L~~~  152 (336)
T 2ast_B           74 AFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR-LSDPIVNTLAKNSNLVRLNLSGC  152 (336)
T ss_dssp             EEECTTCEECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCB-CCHHHHHHHTTCTTCSEEECTTC
T ss_pred             EEEcCCccccccchhhccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCcc-cCHHHHHHHhcCCCCCEEECCCC
Confidence            444555554431 1235689999999999998888899999999999999999985 321   13456899999999999


Q ss_pred             CCCcee-----EeecCceeEEEEcCC-CCC---Ccccccccc-ccceEeeccc--ccchHHHHHHhccCCCccEEEe
Q 043541           97 DRLARV-----SICGPNVRLVDISSL-HAP---CGINVALCK-NLKEFKLFKI--SITNEWLCNQFSELPFLEYVEI  161 (301)
Q Consensus        97 ~~l~~i-----~i~ap~L~~f~~~g~-~~~---~~i~~~~c~-~Lk~L~L~~~--~It~~~l~~L~~~cp~LE~L~L  161 (301)
                      ..+++.     .-..++|++++..++ ...   ....+..++ +|++|++.++  .+++..+...+.++++|+.|++
T Consensus       153 ~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l  229 (336)
T 2ast_B          153 SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL  229 (336)
T ss_dssp             BSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEEC
T ss_pred             CCCCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeC
Confidence            766542     225799999999887 311   223467888 9999999999  6898889888899999999998
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.46
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.42
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.31
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.29
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.88
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.48
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.3
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.23
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.06
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.06
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.04
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.01
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.34
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.27
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.19
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 96.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.06
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 93.19
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 92.76
d2ifga3156 High affinity nerve growth factor receptor, N-term 92.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 92.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 92.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.06
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 90.74
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.26  E-value=1.8e-12  Score=115.95  Aligned_cols=124  Identities=9%  Similarity=0.158  Sum_probs=98.2

Q ss_pred             CCCCCCcEEEecccccChHHHHHHHhcCCcccEEeeecCCC----ceEEEcCCCCCccEEEEEeeCCCceeEe-----ec
Q 043541           36 VTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRG----LKSLEFLNLGKLSKFMVRNEDRLARVSI-----CG  106 (301)
Q Consensus        36 ~~~~sLk~L~L~~c~i~d~~L~~Lis~Cp~LE~L~L~~C~~----l~~L~i~~~~~Lk~L~i~~C~~l~~i~i-----~a  106 (301)
                      ....+|+.|+|++|.+.++++..++++|++|++|+|++|.-    +.  .+..+++|++|++++|.++++..+     .+
T Consensus        43 ~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~--~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~  120 (284)
T d2astb2          43 FSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVN--TLAKNSNLVRLNLSGCSGFSEFALQTLLSSC  120 (284)
T ss_dssp             CCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHH--HHTTCTTCSEEECTTCBSCCHHHHHHHHHHC
T ss_pred             ccCCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHH--HHhcCCCCcCccccccccccccccchhhHHH
Confidence            45678999999999998899999999999999999999851    22  244578999999999987765332     47


Q ss_pred             CceeEEEEcCCCCC----Cc-cccccccccceEeeccc--ccchHHHHHHhccCCCccEEEe
Q 043541          107 PNVRLVDISSLHAP----CG-INVALCKNLKEFKLFKI--SITNEWLCNQFSELPFLEYVEI  161 (301)
Q Consensus       107 p~L~~f~~~g~~~~----~~-i~~~~c~~Lk~L~L~~~--~It~~~l~~L~~~cp~LE~L~L  161 (301)
                      |+|+.++..++...    .. .....+++|+.|++.++  .++++.+..++.+||+|+.|++
T Consensus       121 ~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L  182 (284)
T d2astb2         121 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL  182 (284)
T ss_dssp             TTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEEC
T ss_pred             Hhccccccccccccccccchhhhcccccccchhhhccccccccccccccccccccccccccc
Confidence            99999998876421    11 12245689999999876  3899999999999999999998
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure