Citrus Sinensis ID: 043541
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 301 | ||||||
| 449476923 | 469 | PREDICTED: putative F-box/FBD/LRR-repeat | 0.853 | 0.547 | 0.299 | 9e-29 | |
| 449458247 | 469 | PREDICTED: putative F-box/FBD/LRR-repeat | 0.853 | 0.547 | 0.303 | 1e-28 | |
| 147833276 | 521 | hypothetical protein VITISV_011919 [Viti | 0.810 | 0.468 | 0.298 | 1e-18 | |
| 255549680 | 514 | hypothetical protein RCOM_1485780 [Ricin | 0.724 | 0.424 | 0.308 | 2e-16 | |
| 297743071 | 552 | unnamed protein product [Vitis vinifera] | 0.810 | 0.442 | 0.305 | 5e-16 | |
| 225442254 | 520 | PREDICTED: putative F-box protein At3g44 | 0.813 | 0.471 | 0.299 | 5e-16 | |
| 357495939 | 519 | FBD-associated F-box protein [Medicago t | 0.591 | 0.342 | 0.278 | 2e-10 | |
| 357454743 | 761 | Agglutinin alpha chain [Medicago truncat | 0.687 | 0.272 | 0.247 | 1e-09 | |
| 356557323 | 833 | PREDICTED: uncharacterized protein LOC10 | 0.574 | 0.207 | 0.274 | 7e-09 | |
| 357503353 | 557 | F-box/LRR-repeat protein [Medicago trunc | 0.578 | 0.312 | 0.272 | 1e-08 |
| >gi|449476923|ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 133 bits (335), Expect = 9e-29, Method: Compositional matrix adjust.
Identities = 86/287 (29%), Positives = 139/287 (48%), Gaps = 30/287 (10%)
Query: 27 CKLDSHTRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKSLEFLNLG 86
CKL L S++ + L A DE ++ +V+ CP I+ +K+ C GL++L
Sbjct: 143 CKLCPSLDGYKLLSMKSVSLLGVFAEDETVKRLVSNCPFIQHIKLDSCLGLRNLWLCETN 202
Query: 87 KLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVALCKNLKEFKLFKISITNEWL 146
+L V+N L N++ + PC IN++ CKNLK KL ++IT++W
Sbjct: 203 ELITMEVQNNSGLYEFGTKAMNLQAFEFRGQFQPCCINISSCKNLKTLKLSMVAITDDWF 262
Query: 147 CNQFSELPFLEYVEIFRCM----------KIRKLLVRSCNTLDEFKLDTPNLSVFDYEGD 196
FSE P LE + + C ++K ++ C ++ +DTP LS ++ GD
Sbjct: 263 NRCFSEFPLLEILALSYCHMLESLRISSSHLKKFILCGCESVTRVDIDTPCLSGLEFSGD 322
Query: 197 MVSFSSNALALSETSLFLTS--------------LFLFAPLKNFL------KAAIIPREL 236
++SFS NA ALS+ + L+ L F LK+ K+ +IP+EL
Sbjct: 323 VISFSLNAPALSQADIELSPRIFDNPWVVKQIEFLAHFNHLKSLTLQSQTGKSVVIPQEL 382
Query: 237 REILSPPLTYENHVCLAVDSEYNTFSFAKLVDSLLWISPHAETLSIK 283
RE PL H+ L + + S LV +LLWI+P +T++++
Sbjct: 383 RETFGSPLYGVKHLKLRIIKPLFSPSLKDLVKALLWIAPQPQTIAVE 429
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449458247|ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147833276|emb|CAN68530.1| hypothetical protein VITISV_011919 [Vitis vinifera] gi|297743067|emb|CBI35934.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255549680|ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis] gi|223544796|gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297743071|emb|CBI35938.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225442254|ref|XP_002275641.1| PREDICTED: putative F-box protein At3g44060 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357495939|ref|XP_003618258.1| FBD-associated F-box protein [Medicago truncatula] gi|355493273|gb|AES74476.1| FBD-associated F-box protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357454743|ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula] gi|355486700|gb|AES67903.1| Agglutinin alpha chain [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356557323|ref|XP_003546966.1| PREDICTED: uncharacterized protein LOC100794867 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357503353|ref|XP_003621965.1| F-box/LRR-repeat protein [Medicago truncatula] gi|357503387|ref|XP_003621982.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496980|gb|AES78183.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496997|gb|AES78200.1| F-box/LRR-repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 301 | ||||||
| TAIR|locus:2099644 | 481 | AT3G03360 [Arabidopsis thalian | 0.508 | 0.318 | 0.245 | 1.3e-07 | |
| TAIR|locus:2143463 | 307 | AT5G03100 "AT5G03100" [Arabido | 0.475 | 0.465 | 0.261 | 0.00027 |
| TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 147 (56.8 bits), Expect = 1.3e-07, P = 1.3e-07
Identities = 40/163 (24%), Positives = 77/163 (47%)
Query: 16 LVLSKYIPQTY----CKLDSHTRN----VTLSSLRELGLFKCAANDEAIRDIVAGCPLIE 67
L ++ + Q Y CK D + N V+ +SL+ L L+ C +DE+I I++GCP++E
Sbjct: 156 LYINSSLKQLYLDFGCKKDFISLNPKCSVSWTSLKNLSLYHCNISDESIAIILSGCPILE 215
Query: 68 CLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARVSICGPNVRLVDISSLHAPCGINVAL 127
L + C+ LK L+ +L + R+ + P++R + + + PC +
Sbjct: 216 SLLLFFCKKLKVLDLSKSPRLITLEITRRCRMEPTQLVAPHIRCLRLINSEKPCALVDVS 275
Query: 128 CKNLKEFKLFKISITNEWLCNQFSELPFLEYVEIFRCMKIRKL 170
+ E + +I + L F + ++ +E +C + KL
Sbjct: 276 SLSQAELDITAYAIVDNKLEADFHQTMVVKMLE--KCQNVEKL 316
|
|
| TAIR|locus:2143463 AT5G03100 "AT5G03100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034154001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (456 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.6 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.53 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.06 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.05 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 98.05 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.99 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.83 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.76 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.61 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.5 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.2 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.18 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.17 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.03 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.63 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 96.42 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.97 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 95.79 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.32 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.24 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.21 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.16 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 94.63 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 94.06 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 92.78 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 92.7 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 92.36 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.01 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 91.87 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 91.59 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 91.22 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 91.17 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 90.79 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 89.94 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 89.42 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.19 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 89.13 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 89.03 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 88.79 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.45 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 87.97 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 86.97 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 86.9 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 86.24 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 85.08 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 83.73 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 80.65 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=98.60 E-value=1.8e-09 Score=103.27 Aligned_cols=35 Identities=40% Similarity=0.824 Sum_probs=19.6
Q ss_pred CcEEEeccccc-ChHHHHHHHhcCCcccEEeeecCC
Q 043541 41 LRELGLFKCAA-NDEAIRDIVAGCPLIECLKIIDCR 75 (301)
Q Consensus 41 Lk~L~L~~c~i-~d~~L~~Lis~Cp~LE~L~L~~C~ 75 (301)
||.|+|+||.- .|+.+..++++||+||+|.+.+|.
T Consensus 140 lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~ 175 (483)
T KOG4341|consen 140 LKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCK 175 (483)
T ss_pred cccccccccccCCcchhhHHhhhCCchhhhhhhcce
Confidence 55555555543 345555555555555555555555
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 301 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 51.4 bits (122), Expect = 2e-07
Identities = 51/322 (15%), Positives = 93/322 (28%), Gaps = 73/322 (22%)
Query: 16 LVLSKYI-------PQTYCKLDSHTRNVTLSSLRELGLF----KCAANDEAIRDIVAGCP 64
L+ +++ T + ++TL+ L C D R+++ P
Sbjct: 269 LLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLP-REVLTTNP 327
Query: 65 LIECLKIIDCRGLKSLEFLNLGKLSKFMVRNEDRLARV-SICGPNVRLVDISSLHAPCGI 123
L II + L K + N D+L + + + + +
Sbjct: 328 RR--LSII---AESIRDGLATWDNWKHV--NCDKLTTIIESSLNVLEPAEYRKMFDRLSV 380
Query: 124 ---NV-----ALC---KNLKEF-------KLFKISITNEWLCNQFSELPFLEYVEIFRCM 165
+ L ++ + KL K S+ + +P + +
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLE 440
Query: 166 KIRKL---LVRSCNTLDEFKLDTPNLSVFD-YEGDMVSFS------SNALALSETSLFLT 215
L +V N F D D Y +S N +LF
Sbjct: 441 NEYALHRSIVDHYNIPKTFDSDDLIPPYLDQY-----FYSHIGHHLKNIEHPERMTLF-R 494
Query: 216 SLFL-FAPLKNFLKAAII--------PRELREILSPPLTYENHVCLAVDSEYNTFSFAKL 266
+FL F FL+ I + L Y+ ++C N + +L
Sbjct: 495 MVFLDF----RFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICD------NDPKYERL 544
Query: 267 VDSLLWISPHAETLSIKYNDCD 288
V+++L P E I D
Sbjct: 545 VNAILDFLPKIEENLICSKYTD 566
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.03 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.87 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.8 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.8 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.75 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.75 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.71 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.71 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.62 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.58 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.56 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.55 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.49 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.48 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.45 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.44 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.4 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.39 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.38 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.38 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.35 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.32 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.31 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.31 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.3 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.29 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.28 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.26 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.26 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.26 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.25 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.23 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.23 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.22 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.19 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.18 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.17 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.15 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.13 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.12 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.12 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.12 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.1 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.03 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.03 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.02 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.02 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.01 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.01 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.97 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.95 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.95 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.95 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.95 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.94 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.9 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.9 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.9 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.9 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.87 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.86 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.86 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.85 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.85 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.83 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.83 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.82 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.82 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.81 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.79 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.79 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.77 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.77 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.76 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.76 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.74 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.72 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.7 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.68 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.68 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.67 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.65 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.65 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.63 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.62 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.59 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.55 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.55 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.55 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.52 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.52 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.51 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.49 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.48 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.46 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.45 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.43 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.42 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.4 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.4 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.39 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.39 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.38 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.37 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.32 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.32 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.28 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.25 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.24 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.18 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.1 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.97 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.91 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.89 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.87 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.85 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.84 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.65 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.37 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.36 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.13 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.1 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.06 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.59 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.37 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.14 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.03 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 94.99 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 94.24 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 93.95 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 93.83 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 93.68 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 91.75 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 91.05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 90.4 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 89.02 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 88.26 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 88.08 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 87.68 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 84.79 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 84.7 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 84.27 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.03 E-value=2.5e-10 Score=104.67 Aligned_cols=140 Identities=11% Similarity=0.152 Sum_probs=107.9
Q ss_pred eecccCccccCC-CCCCCCCCCcEEEecccccChHHHHHHHhcCCcccEEeeecCCCceE---EEcCCCCCccEEEEEee
Q 043541 21 YIPQTYCKLDSH-TRNVTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRGLKS---LEFLNLGKLSKFMVRNE 96 (301)
Q Consensus 21 ~~~~~~C~l~~~-~~~~~~~sLk~L~L~~c~i~d~~L~~Lis~Cp~LE~L~L~~C~~l~~---L~i~~~~~Lk~L~i~~C 96 (301)
+++++++.+... ....++++|+.|+|.++.+.+.++...+.+|+.|++|+|++|. +.. -.+.++++|++|++++|
T Consensus 74 ~L~l~~n~l~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~~-l~~~~~~~l~~~~~L~~L~L~~~ 152 (336)
T 2ast_B 74 AFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR-LSDPIVNTLAKNSNLVRLNLSGC 152 (336)
T ss_dssp EEECTTCEECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCB-CCHHHHHHHTTCTTCSEEECTTC
T ss_pred EEEcCCccccccchhhccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCcc-cCHHHHHHHhcCCCCCEEECCCC
Confidence 444555554431 1235689999999999998888899999999999999999985 321 13456899999999999
Q ss_pred CCCcee-----EeecCceeEEEEcCC-CCC---Ccccccccc-ccceEeeccc--ccchHHHHHHhccCCCccEEEe
Q 043541 97 DRLARV-----SICGPNVRLVDISSL-HAP---CGINVALCK-NLKEFKLFKI--SITNEWLCNQFSELPFLEYVEI 161 (301)
Q Consensus 97 ~~l~~i-----~i~ap~L~~f~~~g~-~~~---~~i~~~~c~-~Lk~L~L~~~--~It~~~l~~L~~~cp~LE~L~L 161 (301)
..+++. .-..++|++++..++ ... ....+..++ +|++|++.++ .+++..+...+.++++|+.|++
T Consensus 153 ~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l 229 (336)
T 2ast_B 153 SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL 229 (336)
T ss_dssp BSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEEC
T ss_pred CCCCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeC
Confidence 766542 225799999999887 311 223467888 9999999999 6898889888899999999998
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.26 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.22 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.46 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.41 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.38 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.31 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.29 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.98 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.88 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.72 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.48 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.35 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.33 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.3 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.24 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.23 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.21 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.06 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.06 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.04 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.01 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.77 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.77 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.59 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.48 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.34 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.27 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.19 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.19 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.32 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.52 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.06 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 93.19 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.76 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 92.4 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 92.13 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 92.12 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 92.06 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 90.74 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.26 E-value=1.8e-12 Score=115.95 Aligned_cols=124 Identities=9% Similarity=0.158 Sum_probs=98.2
Q ss_pred CCCCCCcEEEecccccChHHHHHHHhcCCcccEEeeecCCC----ceEEEcCCCCCccEEEEEeeCCCceeEe-----ec
Q 043541 36 VTLSSLRELGLFKCAANDEAIRDIVAGCPLIECLKIIDCRG----LKSLEFLNLGKLSKFMVRNEDRLARVSI-----CG 106 (301)
Q Consensus 36 ~~~~sLk~L~L~~c~i~d~~L~~Lis~Cp~LE~L~L~~C~~----l~~L~i~~~~~Lk~L~i~~C~~l~~i~i-----~a 106 (301)
....+|+.|+|++|.+.++++..++++|++|++|+|++|.- +. .+..+++|++|++++|.++++..+ .+
T Consensus 43 ~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~--~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~ 120 (284)
T d2astb2 43 FSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVN--TLAKNSNLVRLNLSGCSGFSEFALQTLLSSC 120 (284)
T ss_dssp CCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHH--HHTTCTTCSEEECTTCBSCCHHHHHHHHHHC
T ss_pred ccCCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHH--HHhcCCCCcCccccccccccccccchhhHHH
Confidence 45678999999999998899999999999999999999851 22 244578999999999987765332 47
Q ss_pred CceeEEEEcCCCCC----Cc-cccccccccceEeeccc--ccchHHHHHHhccCCCccEEEe
Q 043541 107 PNVRLVDISSLHAP----CG-INVALCKNLKEFKLFKI--SITNEWLCNQFSELPFLEYVEI 161 (301)
Q Consensus 107 p~L~~f~~~g~~~~----~~-i~~~~c~~Lk~L~L~~~--~It~~~l~~L~~~cp~LE~L~L 161 (301)
|+|+.++..++... .. .....+++|+.|++.++ .++++.+..++.+||+|+.|++
T Consensus 121 ~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L 182 (284)
T d2astb2 121 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL 182 (284)
T ss_dssp TTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEEC
T ss_pred Hhccccccccccccccccchhhhcccccccchhhhccccccccccccccccccccccccccc
Confidence 99999998876421 11 12245689999999876 3899999999999999999998
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|