Citrus Sinensis ID: 043582

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MEEESRNHNHRLHESVPSSSISTSHSQENAVRQQQQSSGVSYRVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV
ccccccccccccccccccccccccHHHHHHHHHccccccEEEEEEEEEEEccccccEEEEEEEEEEEEEcccccEEEEcccccccccccccEEEEEEEEEEcccccccEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEcccEEEEEEEEEccccccEEEEEEEccccccccccccccccccEEEEEEEcccEEEEEEcccccEEEEEcccccccEEEEEEEEEEEEEEEccccEEEcccccccEEEEEccccccEEEEEcccccccccccEEEEEEEcccEEEEEEEcHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEEccccccccHHHHHHHHHccccccccccccccEEEEEEc
ccHHHccccccccccccccccccccHHHHHccccccccccEEEEEEEEccccccccHHHHHHHHHEHEccccccEEEEcccccEEEEcccEEEEEEEEEEcccccccccEEEEccccccccccEEccEEEEEEEccccccEEEEEEccccEEEEEEEEEccccccEEEEEEEccccHHHHcccccccccEEEEEEEccccEEEEEEEEcccEEEEEEEccccEEEEEEEEEEEEEEEEccccccEcccccccEEEEEEcccccEEEEEccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccEEEEEcccccEEEEEcccEEEHHHHHHHHHHccccccccHHHEEEEEEEEEc
meeesrnhnhrlhesvpsssistshsqENAVRQQQqssgvsyrvnmsisdsstrnDIWSCLFTITMIFGVYgslelqlgphcsrpihtnplfVQSIKAQvldrqtssslmlygfhnsppldveftwtethiavvpddghKEWLYFLNKGSKleisynvkspssapLSLVIARggesledwidhpscpkttlswnilygsgkiqqkisKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRcslgsglcslsldplgttsailtspgptkgtssakWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNmcrttsgdgtgfqatdrgsqsppllshkddglsswgssydsvshdeqdledwlpvnslegtslnegeinsnprhlqviccdaprdcfflpcghcagcftcgtriaeeggtcpicrkkikkVRKIFTV
meeesrnhnhrlhesvpsssistsHSQENAVRqqqqssgvsyrVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAIltspgptkgtssaKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRiaeeggtcpicrkkikkvrkiftv
MEEESRNHNHRLHEsvpsssistshsQENAVRQQQQSSGVSYRVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYgsgkiqqkiskssDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRcslgsglcslslDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICrkkikkvrkiFTV
******************************************************NDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVK****APLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILT*********SAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTT*******************************************************************RHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIF**
*********************************************MSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVL**QTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMC**************************************************************************VICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV
*****************************************YRVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSH********************DLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIK********
*************************************SGVSYRVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTS***************************SWGSSYD********************************RHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEESRNHNHRLHESVPSSSISTSHSQENAVRQQQQSSGVSYRVNMSISDSSTRNDIWSCLFTITMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
Q4FE47462 Putative E3 ubiquitin-pro no no 0.115 0.110 0.450 2e-07
Q9FPH0376 Putative E3 ubiquitin-pro no no 0.120 0.140 0.452 2e-07
Q7XI08513 Probable E3 ubiquitin-pro yes no 0.115 0.099 0.450 3e-07
Q5M7X9341 Mitochondrial ubiquitin l no no 0.154 0.199 0.357 3e-05
Q8WZ73363 E3 ubiquitin-protein liga yes no 0.1 0.121 0.437 0.0001
Q6ZQM0377 E3 ubiquitin-protein liga yes no 0.1 0.116 0.437 0.0001
Q8CIN9362 E3 ubiquitin-protein liga yes no 0.1 0.121 0.437 0.0002
O15151490 Protein Mdm4 OS=Homo sapi no no 0.109 0.097 0.4 0.0004
Q5E9J6375 E3 ubiquitin-protein liga no no 0.1 0.117 0.437 0.0004
Q5NVC7372 E3 ubiquitin-protein liga yes no 0.1 0.118 0.437 0.0004
>sp|Q4FE47|XB35_ARATH Putative E3 ubiquitin-protein ligase XBAT35 OS=Arabidopsis thaliana GN=XBAT35 PE=2 SV=1 Back     alignment and function desciption
 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 390 VICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV 440
            IC DAP +   +PCGH AGC +C   I  +   CP+CR KI +V K++ V
Sbjct: 412 AICLDAPSEAVCVPCGHVAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV 462
No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9FPH0|XB34_ARATH Putative E3 ubiquitin-protein ligase XBAT34 OS=Arabidopsis thaliana GN=XBAT34 PE=2 SV=1 Back     alignment and function description
>sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 OS=Oryza sativa subsp. japonica GN=XBOS34 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7X9|MUL1A_DANRE Mitochondrial ubiquitin ligase activator of nfkb 1-A OS=Danio rerio GN=mul1a PE=2 SV=1 Back     alignment and function description
>sp|Q8WZ73|RFFL_HUMAN E3 ubiquitin-protein ligase rififylin OS=Homo sapiens GN=RFFL PE=1 SV=1 Back     alignment and function description
>sp|Q6ZQM0|RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus GN=Rffl PE=1 SV=1 Back     alignment and function description
>sp|Q8CIN9|RFFL_RAT E3 ubiquitin-protein ligase rififylin OS=Rattus norvegicus GN=Rffl PE=1 SV=1 Back     alignment and function description
>sp|O15151|MDM4_HUMAN Protein Mdm4 OS=Homo sapiens GN=MDM4 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9J6|RNF34_BOVIN E3 ubiquitin-protein ligase RNF34 OS=Bos taurus GN=RNF34 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVC7|RNF34_PONAB E3 ubiquitin-protein ligase RNF34 OS=Pongo abelii GN=RNF34 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
359478847485 PREDICTED: uncharacterized protein LOC10 0.925 0.839 0.632 1e-154
255569361502 ubiquitin-protein ligase, putative [Rici 0.931 0.816 0.559 1e-128
255574357460 ubiquitin-protein ligase, putative [Rici 0.9 0.860 0.527 1e-122
224059288395 predicted protein [Populus trichocarpa] 0.852 0.949 0.601 1e-120
225439436479 PREDICTED: uncharacterized protein LOC10 0.945 0.868 0.495 1e-106
147785893 922 hypothetical protein VITISV_015872 [Viti 0.861 0.411 0.515 1e-105
356523314440 PREDICTED: uncharacterized protein LOC10 0.902 0.902 0.478 1e-103
356566678441 PREDICTED: uncharacterized protein LOC10 0.931 0.929 0.470 1e-103
224139100356 predicted protein [Populus trichocarpa] 0.759 0.938 0.522 3e-97
297724257 709 Os05g0520700 [Oryza sativa Japonica Grou 0.838 0.520 0.452 2e-80
>gi|359478847|ref|XP_002279069.2| PREDICTED: uncharacterized protein LOC100258653 [Vitis vinifera] gi|297745897|emb|CBI15953.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/424 (63%), Positives = 323/424 (76%), Gaps = 17/424 (4%)

Query: 32  RQQQQSSGVSYRVNMSISDSST---RNDIWSCLF---------TITMIFGVYGSLELQLG 79
            QQ+Q S VSYRVN+SISD +T   R+D+WSCL          ++ +I G YGS  +QLG
Sbjct: 64  EQQRQPSSVSYRVNISISDVATGEIRDDVWSCLVVLVTFWFFASMALILGFYGSANVQLG 123

Query: 80  PHCSRPIHTNPLFVQSIKAQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGH 139
           PHCSR +  N  FVQ+IK Q +D +     MLYGF+  PPLDVE TW ETH A V  + H
Sbjct: 124 PHCSRLVKANSFFVQTIKVQEID-EPKPGPMLYGFYEPPPLDVENTWFETHDASVEANFH 182

Query: 140 KEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGS 199
           KEW++FLNKGSK++ISY+VK+P S+PLSLVIA+G ESL +WI+ PS P TTLSWNI+YGS
Sbjct: 183 KEWIFFLNKGSKVDISYSVKAPRSSPLSLVIAQGRESLVEWIEDPSYPNTTLSWNIIYGS 242

Query: 200 GKIQQKISKSSDYYIAVGNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDP 259
           GK+QQ+I KSS YY+AVGNLNS++V++QLN TM   +YN +KAYY+CSLG+ LCSL L  
Sbjct: 243 GKVQQEIFKSSYYYVAVGNLNSEEVKVQLNLTMKTFLYNTTKAYYKCSLGNRLCSLKLFL 302

Query: 260 LGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTS 319
           L   +A+LTSPGP +G+S+  W +K+SYGPRWITYF G GAMT+L+ LAFR CN  +T  
Sbjct: 303 LRANAAVLTSPGPRQGSSNDDWLIKMSYGPRWITYFVGSGAMTVLILLAFRACNTFQTII 362

Query: 320 GDGTGFQATDRGSQSP---PLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSL 376
           GDGTG+Q    G   P   PLL  KDD  SSWGSSYDS+SHDE+DLE+WL V+SLEG   
Sbjct: 363 GDGTGYQ-VGTGETEPERAPLLLPKDDDASSWGSSYDSISHDEEDLEEWLAVSSLEGNIS 421

Query: 377 NEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRK 436
            EGE N NPR L VICCDAPRDCFFLPCGHCA CFTCGTRI+EE G+CPICRKK+KKVRK
Sbjct: 422 KEGENNGNPRRLCVICCDAPRDCFFLPCGHCAACFTCGTRISEEAGSCPICRKKMKKVRK 481

Query: 437 IFTV 440
           IFTV
Sbjct: 482 IFTV 485

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255569361|ref|XP_002525648.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535084|gb|EEF36766.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255574357|ref|XP_002528092.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223532481|gb|EEF34271.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224059288|ref|XP_002299808.1| predicted protein [Populus trichocarpa] gi|222847066|gb|EEE84613.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225439436|ref|XP_002264526.1| PREDICTED: uncharacterized protein LOC100247198 [Vitis vinifera] gi|296083155|emb|CBI22791.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147785893|emb|CAN70836.1| hypothetical protein VITISV_015872 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356523314|ref|XP_003530285.1| PREDICTED: uncharacterized protein LOC100777141 [Glycine max] Back     alignment and taxonomy information
>gi|356566678|ref|XP_003551557.1| PREDICTED: uncharacterized protein LOC100791057 [Glycine max] Back     alignment and taxonomy information
>gi|224139100|ref|XP_002322980.1| predicted protein [Populus trichocarpa] gi|222867610|gb|EEF04741.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297724257|ref|NP_001174492.1| Os05g0520700 [Oryza sativa Japonica Group] gi|255676495|dbj|BAH93220.1| Os05g0520700 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
TAIR|locus:2179187444 APD2 "ABERRANT POLLEN DEVELOPM 0.825 0.817 0.382 4.3e-70
TAIR|locus:4515102961399 APD4 "ABERRANT POLLEN DEVELOPM 0.627 0.691 0.307 1.1e-48
TAIR|locus:2042922404 APD3 "ABERRANT POLLEN DEVELOPM 0.625 0.680 0.304 6e-48
TAIR|locus:4515103444178 AT4G24204 [Arabidopsis thalian 0.159 0.393 0.419 2.8e-13
ZFIN|ZDB-GENE-040426-2274346 zgc:77828 "zgc:77828" [Danio r 0.145 0.184 0.394 8.1e-06
UNIPROTKB|J3KSU7141 RFFL "E3 ubiquitin-protein lig 0.106 0.333 0.442 2.5e-05
ZFIN|ZDB-GENE-071004-29339 zgc:171740 "zgc:171740" [Danio 0.156 0.203 0.346 0.00048
TAIR|locus:2086263462 XBAT35 "XB3 ortholog 5 in Arab 0.220 0.209 0.318 0.00063
TAIR|locus:2179187 APD2 "ABERRANT POLLEN DEVELOPMENT 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 710 (255.0 bits), Expect = 4.3e-70, P = 4.3e-70
 Identities = 149/390 (38%), Positives = 215/390 (55%)

Query:    47 SISDSSTRNDIWSCLFTI---------TMIFGVYGSLELQLGPHCSRPIHTNPLFVQSIK 97
             ++ ++ST  D WSC+  +         T+I G+YG+  + LGP+ S  I    +FVQ++ 
Sbjct:    60 NVRNNSTSEDPWSCVVVVATFCIFVSMTLILGLYGTTNVWLGPNSSFLIKPTSVFVQNVI 119

Query:    98 AQVLDRQTSSSLMLYGFHNSPPLDVEFTWTETHIAVVPDDGHKEWLYFLNKGSKLEISYN 157
              + L  +  S L+LYG + +P LDV   W+E H   VP+D +K W+ +LNKGS++++SYN
Sbjct:   120 VEELGNK-GSGLILYGLNQAPQLDVLTKWSEVHYLAVPNDSYKYWIQYLNKGSRVKVSYN 178

Query:   158 VKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYXXXXXXXXXXXXXDYYIAVG 217
             V+S  S+ L LVIA+G + L +W+  P+ P TTLSW+I+               YY+AVG
Sbjct:   179 VESVGSS-LYLVIAQGVDGLSEWVQDPTRPDTTLSWHIISDSGYIEQDITKSSSYYVAVG 237

Query:   218 NLNSQQVEMQLNFTMNVLVYNASKAYYRXXXXXXXXXXXXDPLGTTSAILTSPGPTKGTS 277
             N+   +V+  ++  +  ++Y+ + AYY                GT +A+LTSPGP    S
Sbjct:   238 NVYLNEVKATIDIQVEGVLYDTTNAYYNCSFPNDKCTLSVPLFGTNAAVLTSPGPKLNNS 297

Query:   278 SAKWYVKLSYGPRWITYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPL 337
               ++  KLSY PRWI Y   +G +T L+ +     N  +  + D T     D      PL
Sbjct:   298 KNEFCAKLSYEPRWIAYIVCMGVVTALLLIVSSLFNKRQPVTEDET----VDENDDVAPL 353

Query:   338 LSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPR 397
             +  KDD  SSW SSY S+    ++LE         G     GE +S+ R+L  IC DAPR
Sbjct:   354 IPGKDDDNSSWCSSYSSILTSTEELE---------GA---HGEGHSSTRYLCAICYDAPR 401

Query:   398 DCFFLPCGHCAGCFTCGTRIAEEGGTCPIC 427
             DCFFL CGHC  CF CGTRIAE  G CP+C
Sbjct:   402 DCFFLSCGHCVACFQCGTRIAETSGFCPVC 431
GO:0008270 "zinc ion binding" evidence=IEA
GO:0007067 "mitosis" evidence=IMP
TAIR|locus:4515102961 APD4 "ABERRANT POLLEN DEVELOPMENT 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042922 APD3 "ABERRANT POLLEN DEVELOPMENT 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103444 AT4G24204 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2274 zgc:77828 "zgc:77828" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3KSU7 RFFL "E3 ubiquitin-protein ligase rififylin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-29 zgc:171740 "zgc:171740" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2086263 XBAT35 "XB3 ortholog 5 in Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024099001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (485 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-08
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-04
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-04
smart0018440 smart00184, RING, Ring finger 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 64.3 bits (157), Expect = 2e-13
 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 390 VICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKV 434
           VIC + PR+  FLPCGH   C  C  R+      CPICR+ I+ V
Sbjct: 6   VICLERPRNVVFLPCGHLCLCEECAKRL-RSKKKCPICRQPIESV 49

Length = 49
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.81
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.3
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.28
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.22
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 99.2
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.81
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.63
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.59
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.57
PHA02929238 N1R/p28-like protein; Provisional 98.51
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.49
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.39
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.16
PF1463444 zf-RING_5: zinc-RING finger domain 98.11
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.07
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.07
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.05
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.05
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.05
PHA02926242 zinc finger-like protein; Provisional 98.05
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.02
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.91
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.84
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.78
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.58
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.58
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.56
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.42
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.26
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.22
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.21
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.16
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.16
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.84
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.16
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.93
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 95.79
COG5152259 Uncharacterized conserved protein, contains RING a 95.7
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.35
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.34
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.98
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.7
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 94.6
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.68
KOG0825 1134 consensus PHD Zn-finger protein [General function 93.47
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.1
PF04641260 Rtf2: Rtf2 RING-finger 93.03
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.67
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 92.65
KOG1002 791 consensus Nucleotide excision repair protein RAD16 91.86
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 91.79
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 91.63
COG5175 480 MOT2 Transcriptional repressor [Transcription] 90.96
PF07800 162 DUF1644: Protein of unknown function (DUF1644); In 90.78
KOG3002 299 consensus Zn finger protein [General function pred 90.73
KOG3842429 consensus Adaptor protein Pellino [Signal transduc 90.68
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.57
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 90.06
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.96
KOG2660 331 consensus Locus-specific chromosome binding protei 88.37
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 87.79
PF10272358 Tmpp129: Putative transmembrane protein precursor; 86.6
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.25
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 86.2
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 84.73
COG52191525 Uncharacterized conserved protein, contains RING Z 84.08
KOG2113394 consensus Predicted RNA binding protein, contains 82.93
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 82.78
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 82.45
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.81  E-value=1.1e-21  Score=192.60  Aligned_cols=204  Identities=22%  Similarity=0.255  Sum_probs=140.2

Q ss_pred             CCcceeEEEeecCCeeEEEEEEecCCCCCeEEEEEeccccccccccCCCCCCcceeeeEeeCCceEEEEEeccCceEEEE
Q 043582          137 DGHKEWLYFLNKGSKLEISYNVKSPSSAPLSLVIARGGESLEDWIDHPSCPKTTLSWNILYGSGKIQQKISKSSDYYIAV  216 (440)
Q Consensus       137 ~s~k~w~y~LNkGS~i~isy~v~~~~~~~l~lvi~~G~~~~~~w~~~p~~p~~tlsw~~i~g~g~~~~~i~~~~~Yyiav  216 (440)
                      .|+|.|..++|+|+..+.+|+     ..++.++|++|..++++|.++|+-|.++++|+.+.|+  .+-+|.         
T Consensus       147 ~S~ks~~~~~~~~f~r~~~ss-----~vap~~~~~s~~~~~~~~~~~~~~~~~sq~qse~sq~--~eed~~---------  210 (350)
T KOG4275|consen  147 RSKKSTRRRSDGYFNRRYHSS-----PVAPGGPGLSLGLSTLSEHPEHGLHPHSQRQSENSQM--SEEDIK---------  210 (350)
T ss_pred             hhhhcchhhcccceeeeeccC-----CCCCCCccccccccccccCCCCCCCchhhhhhhhccc--cccccc---------
Confidence            789999999999999998888     6678899999999999999999999999999943332  111111         


Q ss_pred             eecCccceeEEEEEEEeEEEEecccceeecccCCCceEEEeccCCCcEEEEcCCCCCCCCCCceeEEEeccchhHHHHHH
Q 043582          217 GNLNSQQVEMQLNFTMNVLVYNASKAYYRCSLGSGLCSLSLDPLGTTSAILTSPGPTKGTSSAKWYVKLSYGPRWITYFA  296 (440)
Q Consensus       217 ~Nln~~~v~v~l~~~i~~~~y~t~~a~~~cs~~~~~c~~~~~~~~~~~~vltsp~~~~~~~~d~w~v~lSy~~r~lt~I~  296 (440)
                                                                          .|...    ++...-+++          
T Consensus       211 ----------------------------------------------------~~~~e----~~~~eded~----------  224 (350)
T KOG4275|consen  211 ----------------------------------------------------TPTIE----FSPTEDEDI----------  224 (350)
T ss_pred             ----------------------------------------------------Ccccc----cCchhhhhh----------
Confidence                                                                11111    111111222          


Q ss_pred             HHHHHHHHHHHHHHHHhcCcccCCCCCcccccccCCCCCCCCCCCCCCCCCcccCCCCCCCCccccccccCCCCccCCcc
Q 043582          297 GLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSYDSVSHDEQDLEDWLPVNSLEGTSL  376 (440)
Q Consensus       297 Gl~~l~vL~~~l~R~~~k~re~~~e~~~~~l~~~~~eR~pll~~k~dd~ss~g~s~ds~~~Deed~Ee~l~~~s~e~~~~  376 (440)
                           .+.+..+..++++.+..   .....+......+++|...++++..+|+++-+....++...+.+... ..++...
T Consensus       225 -----sd~~~~~~~~~~r~~ls---d~edl~d~Eg~~v~qLke~l~~d~vsy~gCcek~el~d~vtrl~k~~-~g~~~~~  295 (350)
T KOG4275|consen  225 -----SDFMPVAIQFCRRASLS---DLEDLLDEEGLTVRQLKEILDDDFVSYKGCCEKYELDDRVTRLYKGN-DGEQHSR  295 (350)
T ss_pred             -----hhhchhhhhhhhhcccC---ccccccccccchHHHhhhhhhccCCcccchhHHHHHHHHHHHHHhcc-ccccccc
Confidence                 22233333444544432   11222333356677888889999999988776655555444433321 1111111


Q ss_pred             cccccCCCCccccccccccCcceEEecCCCccccHhhHHHHhccCCccccccccccceeEeeEC
Q 043582          377 NEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFTV  440 (440)
Q Consensus       377 ~~~E~~~~~~~~C~ICld~~rd~v~lPCGH~~~C~~C~~~l~~~~~~CPICR~~I~~virIf~v  440 (440)
                      .     ...+.+|.||||.|+|++||+|||++.|..|..+|.    .|||||+.|.++++||+|
T Consensus       296 s-----~~~~~LC~ICmDaP~DCvfLeCGHmVtCt~CGkrm~----eCPICRqyi~rvvrif~~  350 (350)
T KOG4275|consen  296 S-----LATRRLCAICMDAPRDCVFLECGHMVTCTKCGKRMN----ECPICRQYIVRVVRIFRV  350 (350)
T ss_pred             c-----hhHHHHHHHHhcCCcceEEeecCcEEeehhhccccc----cCchHHHHHHHHHhhhcC
Confidence            1     122789999999999999999999999999999994    899999999999999986

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 9e-19
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-17
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 1e-16
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 6e-16
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-14
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-11
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 7e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 8e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-04
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
 Score = 79.1 bits (195), Expect = 9e-19
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 380 EINSNPRHLQVICCDAPRDCFFL--PCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKI 437
           E   N      +C   PRD   +    GH   CF C  R+ + G +CPIC+K+I+ V K+
Sbjct: 1   EDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKV 60

Query: 438 FT 439
           F 
Sbjct: 61  FI 62
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.49
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.44
2ea5_A68 Cell growth regulator with ring finger domain prot 99.42
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.18
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.17
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.13
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.97
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.95
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.95
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.94
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.88
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.86
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.86
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.84
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.84
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.84
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.84
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.83
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.82
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.8
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.8
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.79
2ect_A78 Ring finger protein 126; metal binding protein, st 98.78
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.77
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.77
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.74
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.72
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.72
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.71
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.71
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.68
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.66
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.63
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.61
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.59
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.59
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.59
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.59
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.58
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.57
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.57
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.54
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.52
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.49
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.47
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.47
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.47
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.44
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.43
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.43
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.42
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.38
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.34
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.25
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.17
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.08
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.91
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.89
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.84
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.66
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.59
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.53
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.49
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.32
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.56
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.86
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.69
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.59
3nw0_A238 Non-structural maintenance of chromosomes element 83.31
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 81.74
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
Probab=99.49  E-value=1.1e-14  Score=112.55  Aligned_cols=56  Identities=38%  Similarity=0.806  Sum_probs=50.9

Q ss_pred             CCccccccccccCcceEEe--cCCCccccHhhHHHHhccCCccccccccccceeEeeE
Q 043582          384 NPRHLQVICCDAPRDCFFL--PCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIFT  439 (440)
Q Consensus       384 ~~~~~C~ICld~~rd~v~l--PCGH~~~C~~C~~~l~~~~~~CPICR~~I~~virIf~  439 (440)
                      +....|+||++++++.+++  ||||.++|..|+.++.+....||+||++|..++++|.
T Consensus         5 ~~~~~C~IC~~~~~~~~~~~~pCgH~~~C~~C~~~~~~~~~~CPiCR~~i~~~i~i~~   62 (63)
T 2vje_B            5 NLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFI   62 (63)
T ss_dssp             GGGSBCTTTSSSBSCEEEEETTEEEEEECHHHHHHHHHTTCBCTTTCCBCCEEEEEEE
T ss_pred             CcCCCCcccCCcCCCeEEEecCCCCHhHHHHHHHHHHHhCCcCCCcCchhhceEEEec
Confidence            3445799999999999888  9999999999999998777899999999999999996
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 8e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.001
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 0.002
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.7 bits (126), Expect = 1e-09
 Identities = 16/49 (32%), Positives = 20/49 (40%)

Query: 390 VICCDAPRDCFFLPCGHCAGCFTCGTRIAEEGGTCPICRKKIKKVRKIF 438
            IC +  +D    PCGH        +    EG  CP CR +IK    I 
Sbjct: 27  KICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.84
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.7
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.69
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.67
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.64
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.53
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.49
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.47
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.36
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.32
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.32
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.31
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.29
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.22
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.96
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.96
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.99  E-value=7.7e-11  Score=93.33  Aligned_cols=50  Identities=42%  Similarity=0.815  Sum_probs=43.6

Q ss_pred             cccccccccCcceEEecCCCccccHhhHHHHhc-cCCccccccccccceeEe
Q 043582          387 HLQVICCDAPRDCFFLPCGHCAGCFTCGTRIAE-EGGTCPICRKKIKKVRKI  437 (440)
Q Consensus       387 ~~C~ICld~~rd~v~lPCGH~~~C~~C~~~l~~-~~~~CPICR~~I~~virI  437 (440)
                      ..|.||++...+.+++||||. ||..|...+.. ...+||+||+.|.+...+
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i   74 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPI   74 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCS
T ss_pred             CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCcee
Confidence            469999999999999999997 89999998875 456899999999876554
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure