Citrus Sinensis ID: 043873

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---

MGSRRLASFSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARSFEFVSAPLYRIPLKSPFQVRSISTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK

cccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHccccccccccccccccccccccEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHHHc

ccHHHHHHEEEEEcccccccHHHHHHHHcccccccccccccccccccEcEEccccccccccccHcccccccccHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHcccccccccEEccccccccEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHccHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccHHcccHHHHHHHHHHHcc

MGSRRLASFSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARsfefvsaplyriplkspfqvrsistpretvagfdemVAGTQRKhymlggkggvgktSCAASLAVKfanhghptivistdpahslsdsfaqdlsggtlvpvegvdsplfaleinpeKAREEFrtasqgsggsgdgMKDLMDSMGLGMLADQLgelklgelldtpppgldEAIAISKVMQFVESQQYNMFTrivfdtaptghtlrllslpdflDASIGKMMKLKKKLASTTSAFKSvfgkekkqqdVASDKVEQLRERMAKVRDlfrdpdatefVIVTIPTVMAISESSRLHASLrkecipvqrlivnqvlppsasdckfcaMKRKDQMRVLETIMSDPQLANLRLvqaplvdveirgvpalkfmgdmiwk

mgsrrlasFSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARSFEFVSAPlyriplkspfqvrsiSTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEkareefrtasqgsggsgdGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAfksvfgkekkqqdvasdkvEQLRERMAkvrdlfrdpdateFVIVTIPTVMAISESSRLHASLRKECIPVQRLIvnqvlppsasdckFCAMKRKDQMRVLETIMSDPQLANLRLVqaplvdveirgvpalkfmgdmiwk

**********LACI*********MAMLALFSKSQNYTSLCRIARSFEFVSAPLYRIPLKSPFQVRSISTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTD************LSGGTLVPVEGVDSPLFAL***********************************MLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKL**************************************VRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIW*

*************I**************************RIARSFEFVSAPL**********************GFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKL***********************VASDKVEQLRERMAKVRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK

********FSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARSFEFVSAPLYRIPLKSPFQVRSISTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKA**************GDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSV****************QLRERMAKVRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK

*GSRRLASFSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARSFEFVSAPLYRIPLKSPFQVRSISTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSRRLASFSLACISGASSRKTSMAMLALFSKSQNYTSLCRIARSFEFVSAPLYRIPLKSPFQVRSISTPRETVAGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSVFGKEKKQxxxxxxxxxxxxxxxxxxxxxFRDPDATEFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		413	2.2.26 [Sep-21-2011]
O27555		324	Putative arsenical pump-d	yes	no	0.694	0.885	0.357	3e-48
Q58542		349	Putative arsenical pump-d	yes	no	0.731	0.865	0.350	1e-42
P0CM24		325	ATPase GET3 OS=Cryptococc	yes	no	0.677	0.861	0.348	1e-42
P0CM25		325	ATPase GET3 OS=Cryptococc	N/A	no	0.677	0.861	0.348	1e-42
B0WEV5		348	ATPase ASNA1 homolog OS=C	N/A	no	0.673	0.798	0.357	8e-42
Q16MG9		341	ATPase ASNA1 homolog OS=A	N/A	no	0.692	0.838	0.351	3e-41
A8N0V8		326	ATPase GET3 OS=Coprinopsi	N/A	no	0.680	0.861	0.343	4e-41
A0E7A5		325	ATPase ASNA1 homolog 2 OS	N/A	no	0.690	0.876	0.321	2e-40
Q5TRE7		337	ATPase ASNA1 homolog OS=A	yes	no	0.673	0.824	0.347	3e-40
B4H8J5		336	ATPase ASNA1 homolog OS=D	N/A	no	0.673	0.827	0.340	7e-40

>sp\|O27555\|ARSA_METTH Putative arsenical pump-driving ATPase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1511 PE=1 SV=1	Back alignment and function desciption

 Score =  192 bits (489), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/313 (35%), Positives = 186/313 (59%), Gaps = 26/313 (8%)

Query: 102 CAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALEINPEKA 161
            +A+ A+  A  G  T+VISTDPAHSLSDS  +++ G T  P + +   L+A+EI+PE A
Sbjct: 30  ISAATALWMARSGKKTLVISTDPAHSLSDSLEREI-GHT--PTK-ITENLYAVEIDPEVA 85

Query: 162 REEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVM 221
            EE++   Q       GM       GL ML DQ+        + +  PG+DEA A  + +
Sbjct: 86  MEEYQAKLQEQAAMNPGM-------GLDMLQDQMD-------MASMSPGIDEAAAFDQFL 131

Query: 222 QFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSV-- 279
           +++ + +Y++   ++FDTAPTGHTLRLLS P+ +D+ +GKM+K+++++ S   AFK++  
Sbjct: 132 RYMTTDEYDI---VIFDTAPTGHTLRLLSFPEIMDSWVGKMIKIRRQIGSMAKAFKNILP 188

Query: 280 FGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATEFVIVTIPTVMAISESSRLHASLRK 339
           F  +++++D A   +E  ++++   R++  DP+ T F +V IP  M+I ES R   +L K
Sbjct: 189 FMGDEEEEDRALQDMEATKKQINAAREVMSDPERTSFKMVVIPEEMSIYESERAMKALEK 248

Query: 340 ECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLVDVEIR 399
             I    +IVNQVL P  SDC+FC  +RK Q   L+ I    + ++  + + PL+  E +
Sbjct: 249 YSIHADGVIVNQVL-PEESDCEFCNARRKLQQERLKQIRE--KFSDKVVAEVPLLKKEAK 305

Query: 400 GVPALKFMGDMIW 412
           G+  L+ + + ++
Sbjct: 306 GIETLEKIAEQLY 318

Anion-transporting ATPase. Catalyzes the extrusion of arsenite.
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (taxid: 187420)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 6

>sp\|Q58542\|ARSA_METJA Putative arsenical pump-driving ATPase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1142 PE=1 SV=1	Back alignment and function description

>sp\|P0CM24\|GET3_CRYNJ ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET3 PE=3 SV=1	Back alignment and function description

>sp\|P0CM25\|GET3_CRYNB ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET3 PE=3 SV=1	Back alignment and function description

>sp\|B0WEV5\|ASNA_CULQU ATPase ASNA1 homolog OS=Culex quinquefasciatus GN=CPIJ005690 PE=3 SV=1	Back alignment and function description

>sp\|Q16MG9\|ASNA_AEDAE ATPase ASNA1 homolog OS=Aedes aegypti GN=AAEL011136 PE=3 SV=1	Back alignment and function description

>sp\|A8N0V8\|GET3_COPC7 ATPase GET3 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET3 PE=3 SV=1	Back alignment and function description

>sp\|A0E7A5\|ASNA2_PARTE ATPase ASNA1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00023900001 PE=3 SV=1	Back alignment and function description

>sp\|Q5TRE7\|ASNA_ANOGA ATPase ASNA1 homolog OS=Anopheles gambiae GN=AGAP005782 PE=3 SV=3	Back alignment and function description

>sp\|B4H8J5\|ASNA_DROPE ATPase ASNA1 homolog OS=Drosophila persimilis GN=GL20106 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		413
225449002		413	PREDICTED: putative arsenical pump-drivi	0.953	0.953	0.736	1e-163
255577106		438	arsenical pump-driving atpase, putative	0.939	0.885	0.677	1e-162
296085994		589	unnamed protein product [Vitis vinifera]	0.953	0.668	0.731	1e-161
255580205		412	arsenical pump-driving atpase, putative	0.966	0.968	0.710	1e-161
224109802		407	predicted protein [Populus trichocarpa]	0.924	0.938	0.716	1e-159
356576235		403	PREDICTED: putative arsenical pump-drivi	0.961	0.985	0.718	1e-159
357443179		404	ATPase ASNA1-like protein [Medicago trun	0.970	0.992	0.709	1e-158
147852937		422	hypothetical protein VITISV_035961 [Viti	0.992	0.971	0.738	1e-158
356535619		404	PREDICTED: putative arsenical pump-drivi	0.854	0.873	0.773	1e-157
359478718		353	PREDICTED: putative arsenical pump-drivi	0.840	0.983	0.842	1e-155

>gi\|225449002\|ref\|XP_002271753.1\| PREDICTED: putative arsenical pump-driving ATPase-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  581 bits (1498), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 294/399 (73%), Positives = 344/399 (86%), Gaps = 5/399 (1%)

Query: 17  ASSRKTSMAMLALFSKSQNYTSLCRIARSFE--FVSAPLYRIPLKSPFQVRSISTPRETV 74
           A++   ++ + +   K     S C+   +F   F+   + R P +   QVRS++ P E V
Sbjct: 18  ATNTTAAVGLRSDLPKIHTPISRCKTNPTFRVSFLPVRVTRKPPRKSLQVRSVAAPSEAV 77

Query: 75  AGFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQ 134
           AGFDEMV+GT RK+YMLGGKGGVGKTSCAASLAVKFAN+GHPT+V+STDPAHSLSDSFAQ
Sbjct: 78  AGFDEMVSGTARKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQ 137

Query: 135 DLSGGTLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQ 194
           DL+GG LVPVEG DSPLFALEINPEKAREEFR ASQ +GG+G  +KD MD MGLGML +Q
Sbjct: 138 DLTGGMLVPVEGPDSPLFALEINPEKAREEFRNASQKNGGTG--VKDFMDGMGLGMLVEQ 195

Query: 195 LGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDF 254
           LGELKLGELLDTPPPGLDEAIAISKVMQF+ESQ+Y++FTRIVFDTAPTGHTLRLLSLPDF
Sbjct: 196 LGELKLGELLDTPPPGLDEAIAISKVMQFLESQEYSIFTRIVFDTAPTGHTLRLLSLPDF 255

Query: 255 LDASIGKMMKLKKKLASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDAT 314
           LDASIGK++KLK+KLAS TSA KSVFG+E+ +QD A+DK+E+LRERM KVR+LFRD D+T
Sbjct: 256 LDASIGKILKLKQKLASATSAIKSVFGQEETRQD-AADKLERLRERMVKVRELFRDTDST 314

Query: 315 EFVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVL 374
           EFVIVTIPTVMAISESSRLHASL++E +PV++LIVNQVLPPS SDCKFCAMKRKDQMR L
Sbjct: 315 EFVIVTIPTVMAISESSRLHASLKRENVPVKKLIVNQVLPPSTSDCKFCAMKRKDQMRAL 374

Query: 375 ETIMSDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK 413
           + I  DP+L+NL L+QAPLVDVEIRGVPAL+FMGD++WK
Sbjct: 375 DMIKDDPELSNLTLIQAPLVDVEIRGVPALQFMGDIVWK 413

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255577106\|ref\|XP_002529437.1\| arsenical pump-driving atpase, putative [Ricinus communis] gi\|223531114\|gb\|EEF32963.1\| arsenical pump-driving atpase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|296085994\|emb\|CBI31435.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255580205\|ref\|XP_002530933.1\| arsenical pump-driving atpase, putative [Ricinus communis] gi\|223529492\|gb\|EEF31448.1\| arsenical pump-driving atpase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224109802\|ref\|XP_002315316.1\| predicted protein [Populus trichocarpa] gi\|118487322\|gb\|ABK95489.1\| unknown [Populus trichocarpa] gi\|222864356\|gb\|EEF01487.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356576235\|ref\|XP_003556239.1\| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max]	Back alignment and taxonomy information

>gi\|357443179\|ref\|XP_003591867.1\| ATPase ASNA1-like protein [Medicago truncatula] gi\|355480915\|gb\|AES62118.1\| ATPase ASNA1-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147852937\|emb\|CAN83381.1\| hypothetical protein VITISV_035961 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356535619\|ref\|XP_003536342.1\| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max]	Back alignment and taxonomy information

>gi\|359478718\|ref\|XP_003632161.1\| PREDICTED: putative arsenical pump-driving ATPase-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		413
TAIR\|locus:2175816		391	AT5G60730 [Arabidopsis thalian	0.932	0.984	0.617	4.4e-123
DICTYBASE\|DDB_G0293528		329	arsA "arsenite-translocating A	0.481	0.604	0.341	4.7e-46
ZFIN\|ZDB-GENE-040625-120		341	asna1 "arsA arsenite transport	0.510	0.618	0.32	6.7e-43
UNIPROTKB\|A5PJI5		348	ASNA1 "ATPase ASNA1" [Bos taur	0.510	0.606	0.32	8.5e-43
UNIPROTKB\|O43681		348	ASNA1 "ATPase ASNA1" [Homo sap	0.510	0.606	0.32	8.5e-43
UNIPROTKB\|F2Z5J4		348	ASNA1 "Uncharacterized protein	0.510	0.606	0.32	8.5e-43
MGI\|MGI:1928379		348	Asna1 "arsA arsenite transport	0.510	0.606	0.32	8.5e-43
UNIPROTKB\|G3V9T7		348	Asna1 "ArsA arsenite transport	0.510	0.606	0.32	8.5e-43
POMBASE\|SPAC1142.06		329	get3 "GET complex ATPase subun	0.481	0.604	0.321	1.1e-42
WB\|WBGene00014025		342	asna-1 [Caenorhabditis elegans	0.743	0.897	0.334	1.6e-38

TAIR\|locus:2175816 AT5G60730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1210 (431.0 bits), Expect = 4.4e-123, P = 4.4e-123
 Identities = 244/395 (61%), Positives = 312/395 (78%)

Query:    23 SMAMLALFSKSQNYTSLCRIARSFEFVS--APLYRIPLKSP-FQVRSISTPRETVAGFDE 79
             ++ +L   S+S +  SL R+A +  F S  A ++   +    F+VRS++T  E  + F+E
Sbjct:     3 ALLLLNRVSRSTSSISLHRVAGTLGFNSFNAQIHGDRISGTLFRVRSLATLAEGASHFNE 62

Query:    80 MVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGG 139
             MV+  QRK+Y+LGGKGGVGKTSCAASLAVKFA+HGHPTIV+STDPAHSLSDSF+QDLSGG
Sbjct:    63 MVSVNQRKYYLLGGKGGVGKTSCAASLAVKFASHGHPTIVVSTDPAHSLSDSFSQDLSGG 122

Query:   140 TLVPVEGVDSPLFALEINPEKAREEFRTASQGSGGSGD-GMKDLMDSMGLGMLADQLGEL 198
              L PV+GVDSPL ALEI PE  ++E +  +      GD  +K++MDSMGLGM A +LG+L
Sbjct:   123 VLKPVQGVDSPLLALEITPEIMKDEIKRQT------GDKSVKNMMDSMGLGMFAGELGDL 176

Query:   199 KLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDAS 258
              L ++L+   PG+DE  AISKV+QF+E+ +Y+ FTRIVFDTAPTGHTLRLLSLPDF D+S
Sbjct:   177 NLEDMLNAASPGIDEIAAISKVLQFMEAPEYSRFTRIVFDTAPTGHTLRLLSLPDFYDSS 236

Query:   259 IGKMMKLKKKLASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATEFVI 318
             I K+ KLKKK+ +  SAFK VFGK++ QQ    ++++QL+ERM KVR++FRD D TEFVI
Sbjct:   237 ISKITKLKKKITAAASAFKLVFGKKEIQQKELPNELDQLKERMEKVRNVFRDVDTTEFVI 296

Query:   319 VTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIM 378
             VTIPTVMAI+ESSRLHASLRKE +PV RLIVNQ+LP S SDCKFC+++RK+Q RVL  I 
Sbjct:   297 VTIPTVMAINESSRLHASLRKENVPVHRLIVNQLLPQSESDCKFCSIRRKEQTRVLGLIQ 356

Query:   379 SDPQLANLRLVQAPLVDVEIRGVPALKFMGDMIWK 413
             +D +L+ L+L+Q+PL+D EIRGVPALKFMGD+IWK
Sbjct:   357 NDTELSGLKLIQSPLLDAEIRGVPALKFMGDLIWK 391

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0006820 "anion transport" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016020 "membrane" evidence=ISS

GO:0016887 "ATPase activity" evidence=IEA

GO:0071722 "detoxification of arsenic-containing substance" evidence=IEA

GO:0005739 "mitochondrion" evidence=IDA

DICTYBASE\|DDB_G0293528 arsA "arsenite-translocating ATPase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040625-120 asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|A5PJI5 ASNA1 "ATPase ASNA1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|O43681 ASNA1 "ATPase ASNA1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F2Z5J4 ASNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:1928379 Asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V9T7 Asna1 "ArsA arsenite transporter, ATP-binding, homolog 1 (Bacterial)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

POMBASE\|SPAC1142.06 get3 "GET complex ATPase subunit Get3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

WB\|WBGene00014025 asna-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_X2033	SubName- Full=Putative uncharacterized protein; (408 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		413
pfam02374		304	pfam02374, ArsA_ATPase, Anion-transporting ATPase	7e-81
COG0003		322	COG0003, ArsA, Predicted ATPase involved in chromo	4e-66
TIGR00345		284	TIGR00345, GET3_arsA_TRC40, transport-energizing A	3e-62
cd02035		217	cd02035, ArsA, ArsA ATPase functionas as an efflux	8e-62
TIGR04291		566	TIGR04291, arsen_driv_ArsA, arsenical pump-driving	9e-31
TIGR04291		566	TIGR04291, arsen_driv_ArsA, arsenical pump-driving	1e-20
cd02042		104	cd02042, ParA, ParA and ParB of Caulobacter cresce	1e-07
cd02034		116	cd02034, CooC, The accessory protein CooC, which c	5e-07
TIGR03371		246	TIGR03371, cellulose_yhjQ, cellulose synthase oper	5e-06
cd01983		99	cd01983, Fer4_NifH, The Fer4_NifH superfamily cont	1e-05
pfam01656		217	pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi	1e-05
COG1192		259	COG1192, Soj, ATPases involved in chromosome parti	1e-05
PHA02518		211	PHA02518, PHA02518, ParA-like protein; Provisional	5e-05
cd02038		139	cd02038, FleN-like, FleN is a member of the Fer4_N	2e-04
cd02036		179	cd02036, MinD, Bacterial cell division requires th	6e-04
COG3640		255	COG3640, CooC, CO dehydrogenase maturation factor	0.001
PRK13886		241	PRK13886, PRK13886, conjugal transfer protein TraL	0.002
cd02037		169	cd02037, MRP-like, MRP (Multiple Resistance and pH	0.003

>gnl\|CDD\|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase	Back alignment and domain information

 Score =  250 bits (641), Expect = 7e-81
 Identities = 113/325 (34%), Positives = 181/325 (55%), Gaps = 26/325 (8%)

Query: 90  MLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDS 149
             GGKGGVGKT+ + + AV+ +  G   +++STDPAHSLSDSF Q   G     ++GV++
Sbjct: 5   FFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDPAHSLSDSFNQKF-GHEPTKIKGVEN 63

Query: 150 PLFALEINPEKAREEFRTASQGSGGSGDGMKD-LMDSMGLGMLADQLGELKLGELLDTPP 208
            L A+EI+P+   EE+R   Q      D +   L   M  G+LA++L  L          
Sbjct: 64  -LSAMEIDPQMELEEYRGEVQ------DPINAVLGLDMLEGILAEELSSL---------- 106

Query: 209 PGLDEAIAISKVMQFVESQQYNMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKK 268
           PG+DE  +  +  ++++  +Y++   ++FDTAPTGHTLRLLSLP  L   + K++KLK +
Sbjct: 107 PGIDEIASFDEFKKYMDEGEYDV---VIFDTAPTGHTLRLLSLPTVLSWYLEKIVKLKNQ 163

Query: 269 LASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATEFVIVTIPTVMAIS 328
           +      FK + G        A + +E+ +E++ K R++  DP+ T F +V IP  M++ 
Sbjct: 164 IGPLAKPFKGM-GMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLY 222

Query: 329 ESSRLHASLRKECIPVQRLIVNQVLPPSASDCKFCAMKRKDQMRVLETIMSDPQLANLRL 388
           E+ R    L K  I V  +IVNQVLP +   C FC  +++ Q + L+ I      ++L +
Sbjct: 223 ETERAIQELAKYGIDVDAVIVNQVLPET-EQCPFCEARKEIQQKYLKEIEEL--FSDLPV 279

Query: 389 VQAPLVDVEIRGVPALKFMGDMIWK 413
            + PL+  E+ G+ AL+     ++ 
Sbjct: 280 AKLPLLPEEVVGLEALEKFSQTLYG 304

This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304

>gnl\|CDD\|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|232932 TIGR00345, GET3_arsA_TRC40, transport-energizing ATPase, TRC40/GET3/ArsA family	Back alignment and domain information

>gnl\|CDD\|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>gnl\|CDD\|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase	Back alignment and domain information

>gnl\|CDD\|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase	Back alignment and domain information

>gnl\|CDD\|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>gnl\|CDD\|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>gnl\|CDD\|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ	Back alignment and domain information

>gnl\|CDD\|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>gnl\|CDD\|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain	Back alignment and domain information

>gnl\|CDD\|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222854 PHA02518, PHA02518, ParA-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>gnl\|CDD\|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>gnl\|CDD\|226166 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|184370 PRK13886, PRK13886, conjugal transfer protein TraL; Provisional	Back alignment and domain information

>gnl\|CDD\|238994 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		413
KOG2825		323	consensus Putative arsenite-translocating ATPase [	100.0
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	100.0
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	100.0
cd00550		254	ArsA_ATPase Oxyanion-translocating ATPase (ArsA).	100.0
TIGR00345		284	arsA arsenite-activated ATPase (arsA). The N-termi	100.0
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	99.95
KOG3022		300	consensus Predicted ATPase, nucleotide-binding [Ce	99.93
COG0489		265	Mrp ATPases involved in chromosome partitioning [C	99.92
PRK11670		369	antiporter inner membrane protein; Provisional	99.91
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	99.9
TIGR03029		274	EpsG chain length determinant protein tyrosine kin	99.88
CHL00175		281	minD septum-site determining protein; Validated	99.87
TIGR01969		251	minD_arch cell division ATPase MinD, archaeal. Thi	99.87
COG0455		262	flhG Antiactivator of flagellar biosynthesis FleN,	99.87
TIGR01007		204	eps_fam capsular exopolysaccharide family. This mo	99.87
PRK13869		405	plasmid-partitioning protein RepA; Provisional	99.86
TIGR03371		246	cellulose_yhjQ cellulose synthase operon protein Y	99.86
TIGR01281		268	DPOR_bchL light-independent protochlorophyllide re	99.85
PRK13232		273	nifH nitrogenase reductase; Reviewed	99.85
cd02117		212	NifH_like This family contains the NifH (iron prot	99.85
COG2894		272	MinD Septum formation inhibitor-activating ATPase	99.85
PRK13236		296	nitrogenase reductase; Reviewed	99.85
TIGR03018		207	pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t	99.85
PRK13235		274	nifH nitrogenase reductase; Reviewed	99.85
TIGR01968		261	minD_bact septum site-determining protein MinD. Th	99.85
PHA02518		211	ParA-like protein; Provisional	99.85
PHA02519		387	plasmid partition protein SopA; Reviewed	99.84
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	99.84
PRK13705		388	plasmid-partitioning protein SopA; Provisional	99.84
PRK13233		275	nifH nitrogenase reductase; Reviewed	99.84
cd02040		270	NifH NifH gene encodes component II (iron protein)	99.84
cd02032		267	Bchl_like This family of proteins contains bchL an	99.84
PRK10037		250	cell division protein; Provisional	99.84
TIGR03453		387	partition_RepA plasmid partitioning protein RepA.	99.83
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	99.83
PRK13230		279	nitrogenase reductase-like protein; Reviewed	99.83
CHL00072		290	chlL photochlorophyllide reductase subunit L	99.83
PRK10818		270	cell division inhibitor MinD; Provisional	99.83
PRK11519		719	tyrosine kinase; Provisional	99.82
COG1192		259	Soj ATPases involved in chromosome partitioning [C	99.82
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	99.82
PRK13234		295	nifH nitrogenase reductase; Reviewed	99.81
TIGR01287		275	nifH nitrogenase iron protein. This model describe	99.81
PRK13849		231	putative crown gall tumor protein VirC1; Provision	99.81
cd03110		179	Fer4_NifH_child This protein family's function is	99.79
cd02036		179	MinD Bacterial cell division requires the formatio	99.79
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	99.79
PRK13231		264	nitrogenase reductase-like protein; Reviewed	99.78
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	99.77
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	99.75
cd02033		329	BchX Chlorophyllide reductase converts chlorophyll	99.74
PF06564		243	YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p	99.74
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	99.73
cd03111		106	CpaE_like This protein family consists of proteins	99.68
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	99.64
PF07015		231	VirC1: VirC1 protein; InterPro: IPR009744 This fam	99.61
PF09140		261	MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi	99.61
COG1149		284	MinD superfamily P-loop ATPase containing an inser	99.61
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	99.58
PF00142		273	Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot	99.48
PF13614		157	AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ	99.38
TIGR00064		272	ftsY signal recognition particle-docking protein F	99.31
COG4963		366	CpaE Flp pilus assembly protein, ATPase CpaE [Intr	99.3
PRK13886		241	conjugal transfer protein TraL; Provisional	99.27
COG1348		278	NifH Nitrogenase subunit NifH (ATPase) [Inorganic	99.22
cd03114		148	ArgK-like The function of this protein family is u	99.18
TIGR00347		166	bioD dethiobiotin synthase. Dethiobiotin synthase	99.18
cd03115		173	SRP The signal recognition particle (SRP) mediates	99.18
PRK10867		433	signal recognition particle protein; Provisional	99.16
TIGR00959		428	ffh signal recognition particle protein. This mode	99.09
cd02034		116	CooC The accessory protein CooC, which contains a	99.08
PRK10416		318	signal recognition particle-docking protein FtsY;	99.08
PF10609		81	ParA: ParA/MinD ATPase like; InterPro: IPR019591 T	99.06
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	99.04
PRK00771		437	signal recognition particle protein Srp54; Provisi	98.99
PRK13768		253	GTPase; Provisional	98.98
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	98.92
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	98.92
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	98.86
PRK00090		222	bioD dithiobiotin synthetase; Reviewed	98.8
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	98.75
PRK14974		336	cell division protein FtsY; Provisional	98.75
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	98.72
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.68
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	98.66
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	98.57
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	98.57
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	98.54
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	98.42
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	98.41
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	98.36
cd03109		134	DTBS Dethiobiotin synthetase (DTBS) is the penulti	98.32
PRK09435		332	membrane ATPase/protein kinase; Provisional	98.32
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	98.26
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	98.25
PRK05632		684	phosphate acetyltransferase; Reviewed	98.23
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	98.21
PF13500		199	AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R	98.16
COG0132		223	BioD Dethiobiotin synthetase [Coenzyme metabolism]	98.13
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	98.1
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	97.99
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	97.97
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.96
PRK12374		231	putative dithiobiotin synthetase; Provisional	97.95
KOG0780		483	consensus Signal recognition particle, subunit Srp	97.93
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	97.85
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.83
cd01394		218	radB RadB. The archaeal protein radB shares simila	97.72
PHA02542		473	41 41 helicase; Provisional	97.7
PRK00784		488	cobyric acid synthase; Provisional	97.66
TIGR00313		475	cobQ cobyric acid synthase CobQ.	97.64
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	97.6
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	97.55
KOG0781		587	consensus Signal recognition particle receptor, al	97.54
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	97.36
PRK13505		557	formate--tetrahydrofolate ligase; Provisional	97.33
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	97.29
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	97.25
cd00477		524	FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca	97.24
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	97.24
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	97.17
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	97.15
TIGR02237		209	recomb_radB DNA repair and recombination protein R	97.12
PRK06067		234	flagellar accessory protein FlaH; Validated	97.1
COG1341		398	Predicted GTPase or GTP-binding protein [General f	97.09
KOG1534		273	consensus Putative transcription factor FET5 [Tran	97.07
PRK13506		578	formate--tetrahydrofolate ligase; Provisional	97.04
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	97.04
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	97.03
KOG1533		290	consensus Predicted GTPase [General function predi	97.0
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	96.98
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	96.97
PRK07667		193	uridine kinase; Provisional	96.95
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	96.94
PRK05973		237	replicative DNA helicase; Provisional	96.92
PRK00889		175	adenylylsulfate kinase; Provisional	96.86
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	96.84
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	96.83
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	96.8
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	96.8
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	96.79
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	96.74
cd00983		325	recA RecA is a bacterial enzyme which has roles in	96.73
PRK04328		249	hypothetical protein; Provisional	96.72
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	96.7
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	96.69
PRK07952		244	DNA replication protein DnaC; Validated	96.67
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	96.65
PRK06696		223	uridine kinase; Validated	96.63
PRK06526		254	transposase; Provisional	96.63
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	96.63
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.62
PRK11823		446	DNA repair protein RadA; Provisional	96.6
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	96.58
PRK03846		198	adenylylsulfate kinase; Provisional	96.57
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	96.55
PF13245		76	AAA_19: Part of AAA domain	96.54
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	96.53
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	96.5
COG1484		254	DnaC DNA replication protein [DNA replication, rec	96.5
PRK09354		349	recA recombinase A; Provisional	96.5
PLN02974		817	adenosylmethionine-8-amino-7-oxononanoate transami	96.48
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	96.46
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	96.45
PRK08181		269	transposase; Validated	96.43
cd03113		255	CTGs CTP synthetase (CTPs) is a two-domain protein	96.43
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	96.42
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	96.36
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	96.35
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	96.3
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	96.27
PRK06762		166	hypothetical protein; Provisional	96.27
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	96.26
PRK08533		230	flagellar accessory protein FlaH; Reviewed	96.24
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	96.2
PRK05595		444	replicative DNA helicase; Provisional	96.19
PRK08506		472	replicative DNA helicase; Provisional	96.18
TIGR00665		434	DnaB replicative DNA helicase. This model describe	96.17
PHA00729		226	NTP-binding motif containing protein	96.15
PRK05748		448	replicative DNA helicase; Provisional	96.05
PRK08760		476	replicative DNA helicase; Provisional	96.03
KOG0635		207	consensus Adenosine 5'-phosphosulfate kinase [Inor	96.0
PRK09183		259	transposase/IS protein; Provisional	96.0
PRK06749		428	replicative DNA helicase; Provisional	95.97
PRK09302		509	circadian clock protein KaiC; Reviewed	95.97
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.95
PRK06321		472	replicative DNA helicase; Provisional	95.94
PRK09165		497	replicative DNA helicase; Provisional	95.9
PRK08006		471	replicative DNA helicase; Provisional	95.88
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	95.84
PRK05541		176	adenylylsulfate kinase; Provisional	95.83
cd03116		159	MobB Molybdenum is an essential trace element in t	95.83
PRK08840		464	replicative DNA helicase; Provisional	95.78
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	95.75
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	95.74
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	95.74
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.74
PRK06904		472	replicative DNA helicase; Validated	95.73
PRK09302		509	circadian clock protein KaiC; Reviewed	95.66
PRK12377		248	putative replication protein; Provisional	95.66
smart00382		148	AAA ATPases associated with a variety of cellular	95.65
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	95.62
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.59
TIGR02236		310	recomb_radA DNA repair and recombination protein R	95.56
PF13479		213	AAA_24: AAA domain	95.56
PRK04296		190	thymidine kinase; Provisional	95.55
PRK05480		209	uridine/cytidine kinase; Provisional	95.47
PRK14495		452	putative molybdopterin-guanine dinucleotide biosyn	95.41
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	95.41
PRK08084		235	DNA replication initiation factor; Provisional	95.38
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	95.37
PRK05636		505	replicative DNA helicase; Provisional	95.34
PRK15453		290	phosphoribulokinase; Provisional	95.34
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	95.33
PRK04301		317	radA DNA repair and recombination protein RadA; Va	95.33
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	95.32
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.29
PRK07004		460	replicative DNA helicase; Provisional	95.28
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	95.28
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	95.28
PRK08727		233	hypothetical protein; Validated	95.24
PRK08233		182	hypothetical protein; Provisional	95.24
PRK05439		311	pantothenate kinase; Provisional	95.23
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	95.15
PRK09519		790	recA DNA recombination protein RecA; Reviewed	95.09
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	95.08
COG4240		300	Predicted kinase [General function prediction only	95.08
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	95.04
PRK06835		329	DNA replication protein DnaC; Validated	94.96
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	94.92
KOG2749		415	consensus mRNA cleavage and polyadenylation factor	94.92
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	94.9
PRK00131		175	aroK shikimate kinase; Reviewed	94.87
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	94.86
PRK06893		229	DNA replication initiation factor; Validated	94.86
PRK08939		306	primosomal protein DnaI; Reviewed	94.85
PTZ00035		337	Rad51 protein; Provisional	94.8
PRK05642		234	DNA replication initiation factor; Validated	94.79
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	94.78
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	94.77
PRK08903		227	DnaA regulatory inactivator Hda; Validated	94.76
PRK00089		292	era GTPase Era; Reviewed	94.72
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	94.66
PF00154		322	RecA: recA bacterial DNA recombination protein; In	94.64
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	94.57
PF06418		276	CTP_synth_N: CTP synthase N-terminus; InterPro: IP	94.56
PF12846		304	AAA_10: AAA-like domain	94.52
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	94.5
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	94.48
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	94.44
COG3598		402	RepA RecA-family ATPase [DNA replication, recombin	94.41
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	94.39
PRK12740		668	elongation factor G; Reviewed	94.38
PRK06851		367	hypothetical protein; Provisional	94.33
PRK08116		268	hypothetical protein; Validated	94.15
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	94.14
PRK06921		266	hypothetical protein; Provisional	94.13
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	94.12
PF05729		166	NACHT: NACHT domain	94.12
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	94.1
PF13173		128	AAA_14: AAA domain	94.08
PRK07773		886	replicative DNA helicase; Validated	94.04
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	93.92
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	93.84
TIGR00682		311	lpxK tetraacyldisaccharide 4'-kinase. Also called	93.79
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	93.78
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	93.78
PHA02530		300	pseT polynucleotide kinase; Provisional	93.77
PRK06547		172	hypothetical protein; Provisional	93.76
PRK08118		167	topology modulation protein; Reviewed	93.69
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	93.65
PRK00652		325	lpxK tetraacyldisaccharide 4'-kinase; Reviewed	93.61
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	93.54
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	93.51
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	93.46
PRK10490		895	sensor protein KdpD; Provisional	93.38
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	93.31
PLN02796		347	D-glycerate 3-kinase	93.29
TIGR00235		207	udk uridine kinase. Model contains a number of lon	93.27
COG2403		449	Predicted GTPase [General function prediction only	93.26
PRK12339		197	2-phosphoglycerate kinase; Provisional	93.14
PLN03046		460	D-glycerate 3-kinase; Provisional	93.13
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	93.13
PF00004		132	AAA: ATPase family associated with various cellula	93.11
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	93.07
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	93.06
PRK06217		183	hypothetical protein; Validated	93.01
COG1072		283	CoaA Panthothenate kinase [Coenzyme metabolism]	93.0
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	92.92
PRK04220		301	2-phosphoglycerate kinase; Provisional	92.92
cd00881		189	GTP_translation_factor GTP translation factor fami	92.91
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	92.85
COG1159		298	Era GTPase [General function prediction only]	92.8
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	92.76
PRK06761		282	hypothetical protein; Provisional	92.76
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	92.64
PRK13808		333	adenylate kinase; Provisional	92.6
PRK07261		171	topology modulation protein; Provisional	92.59
PTZ00301		210	uridine kinase; Provisional	92.5
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	92.5
COG2874		235	FlaH Predicted ATPases involved in biogenesis of a	92.44
COG0504		533	PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide	92.42
TIGR00376		637	DNA helicase, putative. The gene product may repre	92.39
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	92.38
PRK01906		338	tetraacyldisaccharide 4'-kinase; Provisional	92.34
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	92.29
PRK07933		213	thymidylate kinase; Validated	92.27
PRK13946		184	shikimate kinase; Provisional	92.27
COG0305		435	DnaB Replicative DNA helicase [DNA replication, re	92.23
TIGR00337		525	PyrG CTP synthase. CTP synthase is involved in pyr	92.1
PRK03839		180	putative kinase; Provisional	92.1
PRK00698		205	tmk thymidylate kinase; Validated	91.98
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	91.97
PRK05380		533	pyrG CTP synthetase; Validated	91.96
PLN02327		557	CTP synthase	91.91
PRK06851		367	hypothetical protein; Provisional	91.9
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	91.87
PF02606		326	LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr	91.62
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	91.46
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	91.38
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	91.27
PLN02924		220	thymidylate kinase	91.24
PRK12338		319	hypothetical protein; Provisional	91.22
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	91.13
PRK13947		171	shikimate kinase; Provisional	90.99
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	90.94
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	90.77
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	90.74
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	90.67
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	90.62
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	90.54
PRK13973		213	thymidylate kinase; Provisional	90.53
PRK12422		445	chromosomal replication initiation protein; Provis	90.46
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	90.35
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	90.21
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	90.2
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	90.2
PRK03731		171	aroL shikimate kinase II; Reviewed	90.2
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	90.2
PRK04040		188	adenylate kinase; Provisional	90.18
PRK13948		182	shikimate kinase; Provisional	90.18
CHL00181		287	cbbX CbbX; Provisional	90.17
PRK13949		169	shikimate kinase; Provisional	90.15
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	90.09
PRK00411		394	cdc6 cell division control protein 6; Reviewed	90.09
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	90.08
PLN02348		395	phosphoribulokinase	89.96
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	89.94
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	89.84
COG2256		436	MGS1 ATPase related to the helicase subunit of the	89.75
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	89.74
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	89.58
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	89.55
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	89.35
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	89.33
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	89.27
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	89.22
PRK14528		186	adenylate kinase; Provisional	89.2
PLN02200		234	adenylate kinase family protein	89.2
PLN03025		319	replication factor C subunit; Provisional	89.18
PLN02165		334	adenylate isopentenyltransferase	89.12
COG1855		604	ATPase (PilT family) [General function prediction	89.06
PRK00625		173	shikimate kinase; Provisional	89.03
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	88.79
TIGR00503		527	prfC peptide chain release factor 3. This translat	88.76
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	88.75
PRK01184		184	hypothetical protein; Provisional	88.73
PRK15494		339	era GTPase Era; Provisional	88.72
PRK08356		195	hypothetical protein; Provisional	88.71
PRK14730		195	coaE dephospho-CoA kinase; Provisional	88.7
PRK14532		188	adenylate kinase; Provisional	88.68
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	88.67
PRK00149		450	dnaA chromosomal replication initiation protein; R	88.61
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	88.44
PRK02496		184	adk adenylate kinase; Provisional	88.43
PRK14531		183	adenylate kinase; Provisional	88.36
PLN03126		478	Elongation factor Tu; Provisional	88.36
PRK12402		337	replication factor C small subunit 2; Reviewed	88.29
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	88.2
PRK13975		196	thymidylate kinase; Provisional	88.19
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	88.03
PRK14088		440	dnaA chromosomal replication initiation protein; P	87.88
PRK14527		191	adenylate kinase; Provisional	87.86
PRK09866		741	hypothetical protein; Provisional	87.85
PRK14491		597	putative bifunctional molybdopterin-guanine dinucl	87.76
COG1663		336	LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env	87.75
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	87.75
PF01268		557	FTHFS: Formate--tetrahydrofolate ligase; InterPro:	87.58
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	87.55
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	87.49
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	87.42
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	87.4
PTZ00088		229	adenylate kinase 1; Provisional	87.39
PRK13695		174	putative NTPase; Provisional	87.36
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	87.31
PRK13764		602	ATPase; Provisional	87.27
PRK05057		172	aroK shikimate kinase I; Reviewed	87.25
PRK00081		194	coaE dephospho-CoA kinase; Reviewed	87.23
PRK10536		262	hypothetical protein; Provisional	87.17
COG0237		201	CoaE Dephospho-CoA kinase [Coenzyme metabolism]	86.97
PLN03127		447	Elongation factor Tu; Provisional	86.93
PRK00440		319	rfc replication factor C small subunit; Reviewed	86.9
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	86.86
COG3265		161	GntK Gluconate kinase [Carbohydrate transport and	86.73
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	86.73
KOG3062		281	consensus RNA polymerase II elongator associated p	86.73
COG0125		208	Tmk Thymidylate kinase [Nucleotide transport and m	86.56
PRK13976		209	thymidylate kinase; Provisional	86.45
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	86.38
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	86.29
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	86.23
PRK04182		180	cytidylate kinase; Provisional	86.19
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	86.17
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	86.06
PF13555		62	AAA_29: P-loop containing region of AAA domain	85.78
PRK04195		482	replication factor C large subunit; Provisional	85.68
PRK14733		204	coaE dephospho-CoA kinase; Provisional	85.54
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	85.29
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	85.18
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	85.16
PRK07429		327	phosphoribulokinase; Provisional	85.13
TIGR03783		829	Bac_Flav_CT_G Bacteroides conjugation system ATPas	85.08
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	85.02
PRK13342		413	recombination factor protein RarA; Reviewed	84.99
PRK11545		163	gntK gluconate kinase 1; Provisional	84.98
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	84.98
PRK14530		215	adenylate kinase; Provisional	84.95
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	84.93
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	84.86
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	84.84
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	84.79
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	84.74
PRK12337		475	2-phosphoglycerate kinase; Provisional	84.72
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	84.71
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	84.63
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	84.55
PRK00279		215	adk adenylate kinase; Reviewed	84.55
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	84.49
PF02572		172	CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase	84.28
PRK14734		200	coaE dephospho-CoA kinase; Provisional	84.25
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	84.08
PLN02422		232	dephospho-CoA kinase	84.07
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	83.9
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	83.69
PRK10865		857	protein disaggregation chaperone; Provisional	83.69
KOG2028		554	consensus ATPase related to the helicase subunit o	83.67
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	83.64
COG0857		354	Pta BioD-like N-terminal domain of phosphotransace	83.59
KOG2878		282	consensus Predicted kinase [General function predi	83.43
PRK14086		617	dnaA chromosomal replication initiation protein; P	83.37
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	83.36
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	83.33
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	83.31
PTZ00451		244	dephospho-CoA kinase; Provisional	83.23
PF01202		158	SKI: Shikimate kinase; InterPro: IPR000623 Shikima	83.2
TIGR03754		643	conj_TOL_TraD conjugative coupling factor TraD, TO	83.14
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	83.12
PRK14738		206	gmk guanylate kinase; Provisional	83.11
PLN02318		656	phosphoribulokinase/uridine kinase	83.1
TIGR03172		232	probable selenium-dependent hydroxylase accessory	83.07
PLN02840		421	tRNA dimethylallyltransferase	83.07
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	83.03
PRK14731		208	coaE dephospho-CoA kinase; Provisional	82.92
KOG1969		877	consensus DNA replication checkpoint protein CHL12	82.79
TIGR02746		797	TraC-F-type type-IV secretion system protein TraC.	82.72
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	82.39
smart00487		201	DEXDc DEAD-like helicases superfamily.	82.12
PF02223		186	Thymidylate_kin: Thymidylate kinase; InterPro: IPR	82.11
TIGR00017		217	cmk cytidylate kinase. This family consists of cyt	82.02
PF07726		131	AAA_3: ATPase family associated with various cellu	81.83
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	81.69
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	81.62
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	81.58
COG3973		747	Superfamily I DNA and RNA helicases [General funct	81.38
cd01918		149	HprK_C HprK/P, the bifunctional histidine-containi	81.33
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	81.3
PF01591		222	6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130	81.23
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	81.13
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	81.02
PRK14087		450	dnaA chromosomal replication initiation protein; P	80.91
PRK13833		323	conjugal transfer protein TrbB; Provisional	80.9
PRK13721		844	conjugal transfer ATP-binding protein TraC; Provis	80.88
PLN02748		468	tRNA dimethylallyltransferase	80.88
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	80.85
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	80.74
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	80.67
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	80.59
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	80.46
COG0645		170	Predicted kinase [General function prediction only	80.41
PRK14737		186	gmk guanylate kinase; Provisional	80.36
PRK00300		205	gmk guanylate kinase; Provisional	80.36
PRK09376		416	rho transcription termination factor Rho; Provisio	80.29
TIGR03743		634	SXT_TraD conjugative coupling factor TraD, SXT/TOL	80.29
PRK14732		196	coaE dephospho-CoA kinase; Provisional	80.26
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	80.22
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	80.2
TIGR00174		287	miaA tRNA isopentenyltransferase (miaA). Catalyzes	80.19
PRK13873		811	conjugal transfer ATPase TrbE; Provisional	80.07

>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=4.4e-55  Score=397.11  Aligned_cols=314  Identities=40%  Similarity=0.674  Sum_probs=279.5

Q ss_pred             chHHhhcCCCcEEEEEcCCCCccHHHHHHHHHHHHHHcCCCeeEEecCCCCCchhhhhcccCCCceeeeccCCCCccccc
Q 043873           76 GFDEMVAGTQRKHYMLGGKGGVGKTSCAASLAVKFANHGHPTIVISTDPAHSLSDSFAQDLSGGTLVPVEGVDSPLFALE  155 (413)
Q Consensus        76 ~~~~~~~~~~~~i~~~s~kgGvGKtT~a~~lA~~la~~g~~vllvd~Dp~~sls~~lg~~~~~~~~~~v~~~~~~l~~~~  155 (413)
                      .++.++++....++|++|||||||||+++.||..+|.-+.+||+|++||+||+++.|++... +.++.++|..+ |++++
T Consensus         9 ~l~nil~q~slKwifVGGKGGVGKTTcs~sLAvqla~~r~~vLiISTDPAHNlSDAF~qkft-k~pt~V~Gf~n-LfAME   86 (323)
T KOG2825|consen    9 TLQNILEQTSLKWIFVGGKGGVGKTTCSCSLAVQLAKVRESVLIISTDPAHNLSDAFSQKFT-KTPTKVEGFEN-LFAME   86 (323)
T ss_pred             hHHHHhhcceeeEEEEcCcCCcCccchhhHHHHHHhccCCceEEeecCcccchHHHHHHHhc-CCCccccChhh-heeee
Confidence            67888999889999999999999999999999999999999999999999999999999887 57889999999 99999


Q ss_pred             cChHHHHHHHHHhhccCCCCCCchhhHHhhhchhhhHHHhhhhhhccccCCCCCChHHHHHHHHHHHHHHhhccCCccEE
Q 043873          156 INPEKAREEFRTASQGSGGSGDGMKDLMDSMGLGMLADQLGELKLGELLDTPPPGLDEAIAISKVMQFVESQQYNMFTRI  235 (413)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ll~~~~pg~~e~~~~~~l~~~l~~~~~~~yD~V  235 (413)
                      +||.....+..+.......     ....  .|.+.+.+..          ...||.+|.+.+..++.+++..+   ||+|
T Consensus        87 IDp~~e~~~~~~m~~~~~~-----n~~~--~g~g~l~e~~----------~~~Pgideamsfae~~klvk~~~---F~~v  146 (323)
T KOG2825|consen   87 IDPNVEMGDMPEMFGNAAN-----NEGS--DGKGMLQELA----------NAFPGIDEAMSFAEVMKLVKGMN---FDVV  146 (323)
T ss_pred             cCCchhhhhhHHHhhcccc-----cccc--cchhHHHHHH----------hcCCChhHHHhHHHHHHHhhccc---cceE
Confidence            9998766555544332211     0111  1122223222          24799999999999999997643   8899


Q ss_pred             EEcCCCChhHHhhccchHHHHHHHhHHHHHHHHHhhhhHHHHhhhCCcccchhHHHHHHHHHHHHHHHHHHHhcCCCCce
Q 043873          236 VFDTAPTGHTLRLLSLPDFLDASIGKMMKLKKKLASTTSAFKSVFGKEKKQQDVASDKVEQLRERMAKVRDLFRDPDATE  315 (413)
Q Consensus       236 IiDtpPt~~~l~~L~lp~~l~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~l~~l~~~~~~~~~~l~d~~~t~  315 (413)
                      ||||+|||||||+|.+|.+++..+++++.++.++....+.+.+++|.+....|++.+.++.+++.++++++.++||+.|.
T Consensus       147 VFDTAPTGHTLRlL~fP~~lek~lgKl~~l~~k~~pm~sq~~sm~g~~~~~~~~l~~kle~~~~~i~~vn~qFkdpd~Tt  226 (323)
T KOG2825|consen  147 VFDTAPTGHTLRLLQFPTTLEKGLGKLLSLKNKIGPMLSQMGSMFGMEDAGADDLAGKLEELLEVIEKVNEQFKDPDCTT  226 (323)
T ss_pred             EeccCCCcceehhhccchHHHHHHHHHHHHHHHHHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHHHcCCCCCce
Confidence            99999999999999999999999999999999999999999999998777777899999999999999999999999999


Q ss_pred             EEEEecCccchHHHHHHHHHHHHhcCCCcceEEEecccCCCC-CchHHHHHHHHHHHHHHHHhhcCCCCCCCceEEccCC
Q 043873          316 FVIVTIPTVMAISESSRLHASLRKECIPVQRLIVNQVLPPSA-SDCKFCAMKRKDQMRVLETIMSDPQLANLRLVQAPLV  394 (413)
Q Consensus       316 ~vlVt~pe~~~~~ea~r~~~~l~~~gi~v~gvVvN~v~~~~~-~~~~~~~~~~~~q~~~l~~i~~d~~~~~~~~~~~p~~  394 (413)
                      ||+|++||.++++|++|+++.|.++++++..||||++++++. .+|++|+.|.+.|.+||+.|.++  +.+..++++|++
T Consensus       227 FVcVcI~eflslyEteRliqeL~k~~idthnIIVNQLL~~~~~~~ck~C~ar~k~Q~kyLdqi~el--yedfhv~klPl~  304 (323)
T KOG2825|consen  227 FVCVCIAEFLSLYETERLIQELAKQGIDTHNIIVNQLLFPDNEVSCKKCAARRKMQSKYLDQIEEL--YEDFHVVKLPLL  304 (323)
T ss_pred             EEEEEHHHHHhHHHHHHHHHHHHhcCCcccceeeeeccCCCCccchHHHHHHHHHHHHHhhhHHHH--Hhhcceeecccc
Confidence            999999999999999999999999999999999999998776 78999999999999999999984  668999999999


Q ss_pred             CCCCCCHHHHHHHHHhhhC
Q 043873          395 DVEIRGVPALKFMGDMIWK  413 (413)
Q Consensus       395 ~~e~~g~~aL~~l~~~~~~  413 (413)
                      +.|++|+++|+.+++.+|+
T Consensus       305 ~~EvrG~~al~~fse~l~k  323 (323)
T KOG2825|consen  305 PMEVRGVEALNFFSEILLK  323 (323)
T ss_pred             hhhhcCHHHHHHHHHHhcC
Confidence            9999999999999999986

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA)	Back alignment and domain information

>TIGR00345 arsA arsenite-activated ATPase (arsA)	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK11670 antiporter inner membrane protein; Provisional	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>TIGR01969 minD_arch cell division ATPase MinD, archaeal	Back alignment and domain information

>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]	Back alignment and domain information

>TIGR01007 eps_fam capsular exopolysaccharide family	Back alignment and domain information

>PRK13869 plasmid-partitioning protein RepA; Provisional	Back alignment and domain information

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ	Back alignment and domain information

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR01968 minD_bact septum site-determining protein MinD	Back alignment and domain information

>PHA02518 ParA-like protein; Provisional	Back alignment and domain information

>PHA02519 plasmid partition protein SopA; Reviewed	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>PRK13705 plasmid-partitioning protein SopA; Provisional	Back alignment and domain information

>PRK13233 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>PRK10037 cell division protein; Provisional	Back alignment and domain information

>TIGR03453 partition_RepA plasmid partitioning protein RepA	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>PRK13231 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring	Back alignment and domain information

>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins	Back alignment and domain information

>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family	Back alignment and domain information

>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13886 conjugal transfer protein TraL; Provisional	Back alignment and domain information

>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>TIGR00347 bioD dethiobiotin synthase	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning []	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK00090 bioD dithiobiotin synthetase; Reviewed	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05632 phosphate acetyltransferase; Reviewed	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A	Back alignment and domain information

>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism]	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12374 putative dithiobiotin synthetase; Provisional	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK13505 formate--tetrahydrofolate ligase; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>PRK13506 formate--tetrahydrofolate ligase; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK06749 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification]	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position []	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07773 replicative DNA helicase; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK10490 sensor protein KdpD; Provisional	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>COG2403 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PRK07933 thymidylate kinase; Validated	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00337 PyrG CTP synthase	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK05380 pyrG CTP synthetase; Validated	Back alignment and domain information

>PLN02327 CTP synthase	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability []	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>PRK12338 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13973 thymidylate kinase; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional	Back alignment and domain information

>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PRK00081 coaE dephospho-CoA kinase; Reviewed	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only]	Back alignment and domain information

>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13976 thymidylate kinase; Provisional	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14733 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>PRK07429 phosphoribulokinase; Provisional	Back alignment and domain information

>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK11545 gntK gluconate kinase 1; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2	Back alignment and domain information

>PRK14734 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PLN02422 dephospho-CoA kinase	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only]	Back alignment and domain information

>KOG2878 consensus Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PTZ00451 dephospho-CoA kinase; Provisional	Back alignment and domain information

>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2	Back alignment and domain information

>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC	Back alignment and domain information

>PLN02840 tRNA dimethylallyltransferase	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK14731 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02746 TraC-F-type type-IV secretion system protein TraC	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2	Back alignment and domain information

>TIGR00017 cmk cytidylate kinase	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional	Back alignment and domain information

>PLN02748 tRNA dimethylallyltransferase	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>COG0645 Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily	Back alignment and domain information

>PRK14732 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00174 miaA tRNA isopentenyltransferase (miaA)	Back alignment and domain information

>PRK13873 conjugal transfer ATPase TrbE; Provisional	Back alignment and domain information

Homologous Structure Templates