Citrus Sinensis ID: 044056


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
NINKMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQVCCQSSGN
cccccccccccccccEEEEEEEcccccccHHHHHHHHHcccccccccccccHHHHHHHcccccEEEEccHHHHHHccccEEEEEcccccccccHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHcccccEEEEEcccccccHHHHHHcccc
ccccHHcccccccccEEEEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccEEEEEEcccHHHHHHHHccEEEEEcccccccccHHHHHHccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccEccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccHHcccHHccccc
ninkmegmarssdksITLVlfrgphfpashnyaKGYLQNYLSIKGLCFFLSMHSLyasygtseqmiasdsnvitranpmnLIIRFRvglegvdidalTNCAIKAARILgdvsgnaasCAELSIYLMLGLLRkhivptgetllgktVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQVCCQSSGN
ninkmegmarssdkSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAkrswashsqvccqssgn
NINKMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQVCCQSSGN
***************ITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQVCC*****
*****************LVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASH**********
*************KSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAK****************
***KMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQV*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NINKMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGTSEQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAKRSWASHSQVCCQSSGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q60HD7 533 D-3-phosphoglycerate dehy N/A no 0.624 0.221 0.3 4e-06
O08651 533 D-3-phosphoglycerate dehy yes no 0.624 0.221 0.292 5e-06
O43175 533 D-3-phosphoglycerate dehy yes no 0.624 0.221 0.3 5e-06
A5A6P1 533 D-3-phosphoglycerate dehy yes no 0.624 0.221 0.3 5e-06
A5GFY8 533 D-3-phosphoglycerate dehy yes no 0.624 0.221 0.307 7e-06
Q61753 533 D-3-phosphoglycerate dehy yes no 0.624 0.221 0.292 1e-05
Q5EAD2 533 D-3-phosphoglycerate dehy yes no 0.613 0.217 0.288 2e-05
O29445 527 D-3-phosphoglycerate dehy yes no 0.518 0.185 0.319 4e-05
Q5R7M2 533 D-3-phosphoglycerate dehy no no 0.624 0.221 0.292 5e-05
Q58424 524 D-3-phosphoglycerate dehy yes no 0.502 0.181 0.301 0.0003
>sp|Q60HD7|SERA_MACFA D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4 Back     alignment and function desciption
 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 22/140 (15%)

Query: 50  LSMHSLYASYGTSEQMIASDS-----NVITRANPMNLIIRFRVGLEGVDIDALTNCAIKA 104
           LS   L A     E +I   +     +VI  A  + ++ R   G++ VD++A T    K 
Sbjct: 36  LSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATR---KG 92

Query: 105 ARILGDVSGNAASCAELSIYLMLGLLRKHIVPT--------------GETLLGKTVFISG 150
             ++   +GN+ S AEL+  +++ L R+    T              G  L GKT+ I G
Sbjct: 93  VLVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILG 152

Query: 151 FGNIGVELAKRLRPFGVKII 170
            G IG E+A R++ FG+K I
Sbjct: 153 LGRIGREVATRMQSFGMKTI 172





Macaca fascicularis (taxid: 9541)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 9EC: 5
>sp|O08651|SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus GN=Phgdh PE=1 SV=3 Back     alignment and function description
>sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4 Back     alignment and function description
>sp|A5A6P1|SERA_PANTR D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes GN=PHGDH PE=2 SV=1 Back     alignment and function description
>sp|A5GFY8|SERA_PIG D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1 Back     alignment and function description
>sp|Q61753|SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3 Back     alignment and function description
>sp|Q5EAD2|SERA_BOVIN D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3 Back     alignment and function description
>sp|O29445|SERA_ARCFU D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serA PE=3 SV=1 Back     alignment and function description
>sp|Q5R7M2|SERA_PONAB D-3-phosphoglycerate dehydrogenase OS=Pongo abelii GN=PHGDH PE=2 SV=3 Back     alignment and function description
>sp|Q58424|SERA_METJA D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=serA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
224136053 343 predicted protein [Populus trichocarpa] 0.957 0.527 0.564 1e-48
118488445 343 unknown [Populus trichocarpa] 0.957 0.527 0.564 1e-48
225460279 373 PREDICTED: d-3-phosphoglycerate dehydrog 0.920 0.466 0.553 4e-46
359493304 333 PREDICTED: d-3-phosphoglycerate dehydrog 0.915 0.519 0.556 5e-46
255561522 380 phosphoglycerate dehydrogenase, putative 0.957 0.476 0.538 7e-46
296089431 343 unnamed protein product [Vitis vinifera] 0.899 0.495 0.554 7e-45
363807464 391 uncharacterized protein LOC100785085 [Gl 0.941 0.455 0.530 8e-45
449503247 337 PREDICTED: d-3-phosphoglycerate dehydrog 0.931 0.522 0.515 6e-42
357455585 382 D-3-phosphoglycerate dehydrogenase [Medi 0.920 0.455 0.510 7e-42
388510518 344 unknown [Medicago truncatula] 0.920 0.505 0.510 8e-42
>gi|224136053|ref|XP_002327369.1| predicted protein [Populus trichocarpa] gi|222835739|gb|EEE74174.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 132/195 (67%), Gaps = 14/195 (7%)

Query: 8   MARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSM-HSLYASYGTS-EQM 65
           M  +SDK IT VLF GP+FPASH Y K YLQ Y  I+     L++   + ++Y     + 
Sbjct: 1   MVGNSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKN 60

Query: 66  IASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYL 125
           +   SN+I+RA  M LI++F VG+EGVDIDA T   IK ARI GD +GNAASCAE++IYL
Sbjct: 61  MRLTSNIISRATQMKLIMQFGVGIEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYL 120

Query: 126 MLGLLRKHI------------VPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKIIAAK 173
           MLGLLRK               P GETL GKTVFI GFGNIG++LAKRLRPFGVKIIA K
Sbjct: 121 MLGLLRKQNEMQISIKQKRLGEPAGETLFGKTVFIMGFGNIGIDLAKRLRPFGVKIIATK 180

Query: 174 RSWASHSQVCCQSSG 188
           RSWA HS+   QS+G
Sbjct: 181 RSWALHSEGSLQSNG 195




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118488445|gb|ABK96037.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225460279|ref|XP_002282092.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493304|ref|XP_003634565.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561522|ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] gi|223538984|gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296089431|emb|CBI39250.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363807464|ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max] gi|255645066|gb|ACU23032.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449503247|ref|XP_004161907.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357455585|ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] gi|355487121|gb|AES68324.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388510518|gb|AFK43325.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2207046 373 AT1G72190 [Arabidopsis thalian 0.915 0.463 0.497 1.1e-39
ZFIN|ZDB-GENE-030131-647 528 phgdh "phosphoglycerate dehydr 0.513 0.183 0.336 4e-05
UNIPROTKB|P0A544 528 serA "D-3-phosphoglycerate deh 0.529 0.189 0.299 9.8e-05
UNIPROTKB|G4MVW0 322 MGG_10814 "D-3-phosphoglycerat 0.449 0.263 0.352 0.0001
RGD|61987 533 Phgdh "phosphoglycerate dehydr 0.518 0.183 0.304 0.00024
UNIPROTKB|Q5SZU1 499 PHGDH "D-3-phosphoglycerate de 0.518 0.196 0.313 0.00028
UNIPROTKB|E1C7Y3 525 PHGDH "Uncharacterized protein 0.507 0.182 0.307 0.0003
UNIPROTKB|O43175 533 PHGDH "D-3-phosphoglycerate de 0.518 0.183 0.313 0.00031
UNIPROTKB|A5GFY8 533 PHGDH "D-3-phosphoglycerate de 0.518 0.183 0.321 0.00031
TIGR_CMR|CHY_2698 525 CHY_2698 "D-3-phosphoglycerate 0.518 0.186 0.313 0.00041
TAIR|locus:2207046 AT1G72190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 423 (154.0 bits), Expect = 1.1e-39, P = 1.1e-39
 Identities = 93/187 (49%), Positives = 126/187 (67%)

Query:     4 KMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIK-GLCFFLSMHSLYASYGTS 62
             K+E +    D  +T VLF GPHFP S+N+ + YLQ Y  IK  +  +  +  +  +Y   
Sbjct:    39 KIERIVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHIC 98

Query:    63 EQM-IASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAEL 121
               M +  DSNVI+RA+ + LI+++ VGL+GVDIDA T   IK ARI  + +GNAASC+E+
Sbjct:    99 VAMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEM 158

Query:   122 SIYLMLGLLRKH----------IV--PTGETLLGKTVFISGFGNIGVELAKRLRPFGVKI 169
             +IYLMLGLL+K           ++  PTG+TLLGKTVFI G+GNIG+ELAKRL+PFG ++
Sbjct:   159 AIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPFGSRV 218

Query:   170 IAAKRSW 176
             IA KR W
Sbjct:   219 IATKRFW 225




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
ZFIN|ZDB-GENE-030131-647 phgdh "phosphoglycerate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P0A544 serA "D-3-phosphoglycerate dehydrogenase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|G4MVW0 MGG_10814 "D-3-phosphoglycerate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
RGD|61987 Phgdh "phosphoglycerate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SZU1 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7Y3 PHGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O43175 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFY8 PHGDH "D-3-phosphoglycerate dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2698 CHY_2698 "D-3-phosphoglycerate dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_410478
SubName- Full=Putative uncharacterized protein; (344 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.1441.1.1
annotation not avaliable (142 aa)
       0.401

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN02928 347 PLN02928, PLN02928, oxidoreductase family protein 1e-67
cd12175 311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2e-31
cd12172 306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 1e-17
COG0111 324 COG0111, SerA, Phosphoglycerate dehydrogenase and 1e-13
cd12173 304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 3e-13
cd12171 310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2e-12
cd05198 302 cd05198, formate_dh_like, Formate/glycerate and re 3e-12
COG1052 324 COG1052, LdhA, Lactate dehydrogenase and related d 8e-12
cd05303 301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 8e-12
PRK13581 526 PRK13581, PRK13581, D-3-phosphoglycerate dehydroge 1e-11
cd12165 314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2e-11
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 2e-11
cd12177 321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2e-11
cd12179 306 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2e-10
cd12178 317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 3e-10
cd12168 321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 5e-10
cd12161 315 cd12161, GDH_like_1, Putative glycerate dehydrogen 5e-10
cd12159 303 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 1e-09
cd12156 301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 2e-09
cd05300 313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 3e-09
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 4e-09
cd05301 309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 4e-09
cd12174 305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 4e-08
cd12166 300 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 9e-08
cd12157 318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 1e-07
cd05302 348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 2e-07
cd05299 312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 5e-07
PRK07574 385 PRK07574, PRK07574, formate dehydrogenase; Provisi 5e-07
pfam00389 312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 6e-07
PRK13243 333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 1e-06
cd12169 308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 2e-06
cd12155 314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 4e-06
cd12167 330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 5e-06
PLN03139 386 PLN03139, PLN03139, formate dehydrogenase; Provisi 9e-06
cd12162 307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2e-05
cd12158 343 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh 1e-04
cd12185 322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 2e-04
cd12180 308 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 3e-04
cd12183 328 cd12183, LDH_like_2, D-Lactate and related Dehydro 3e-04
pfam00208 237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 5e-04
COG0334 411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 8e-04
cd12154 310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 0.002
cd01619 323 cd01619, LDH_like, D-Lactate and related Dehydroge 0.002
cd12160 310 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 0.003
cd12187 329 cd12187, LDH_like_1, D-Lactate and related Dehydro 0.004
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
 Score =  209 bits (535), Expect = 1e-67
 Identities = 94/196 (47%), Positives = 123/196 (62%), Gaps = 14/196 (7%)

Query: 4   KMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIK-GLCFFLSMHSLYASYGTS 62
           K++     SD   T VLF GP FPAS++Y + YLQ Y  I+        +  + A+Y   
Sbjct: 6   KIDKRVHHSDMRPTRVLFCGPEFPASYSYTREYLQKYPFIQVDAVAREDVPDVIANYDIC 65

Query: 63  -EQMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAEL 121
             +M+  D+++I RA+ M LI++F VGLEGVD+DA T   IK ARI  + +GNAASCAE+
Sbjct: 66  VPKMMRLDADIIARASQMKLIMQFGVGLEGVDVDAATKHGIKVARIPSEGTGNAASCAEM 125

Query: 122 SIYLMLGLLRKHIV------------PTGETLLGKTVFISGFGNIGVELAKRLRPFGVKI 169
           +IYLMLGLLRK               P G+TL GKTVFI G+G IG+ELAKRLRPFGVK+
Sbjct: 126 AIYLMLGLLRKQNEMQISLKARRLGEPIGDTLFGKTVFILGYGAIGIELAKRLRPFGVKL 185

Query: 170 IAAKRSWASHSQVCCQ 185
           +A +RSW S  +    
Sbjct: 186 LATRRSWTSEPEDGLL 201


Length = 347

>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PLN02928 347 oxidoreductase family protein 100.0
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 100.0
PRK06487 317 glycerate dehydrogenase; Provisional 100.0
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 100.0
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 100.0
PRK06932 314 glycerate dehydrogenase; Provisional 100.0
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK13243 333 glyoxylate reductase; Reviewed 100.0
PRK12480 330 D-lactate dehydrogenase; Provisional 100.0
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.98
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.98
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.97
PLN03139 386 formate dehydrogenase; Provisional 99.97
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 99.97
PRK07574 385 formate dehydrogenase; Provisional 99.97
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 99.97
PLN02306 386 hydroxypyruvate reductase 99.97
PRK08605 332 D-lactate dehydrogenase; Validated 99.97
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.95
PRK06436 303 glycerate dehydrogenase; Provisional 99.95
KOG0069 336 consensus Glyoxylate/hydroxypyruvate reductase (D- 99.94
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.78
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.63
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.55
KOG0067 435 consensus Transcription factor CtBP [Transcription 99.55
PTZ00075 476 Adenosylhomocysteinase; Provisional 99.34
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.33
PRK13403 335 ketol-acid reductoisomerase; Provisional 98.59
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.42
PLN02494 477 adenosylhomocysteinase 98.28
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.24
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.11
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.94
PRK05479 330 ketol-acid reductoisomerase; Provisional 97.89
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.89
PLN02712 667 arogenate dehydrogenase 97.64
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.46
PLN02256 304 arogenate dehydrogenase 97.38
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.37
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.3
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.2
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.19
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 97.14
PRK09414 445 glutamate dehydrogenase; Provisional 97.13
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.05
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.05
PLN02712 667 arogenate dehydrogenase 97.0
PRK14031 444 glutamate dehydrogenase; Provisional 96.92
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 96.88
PRK05225 487 ketol-acid reductoisomerase; Validated 96.85
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.84
PLN02477 410 glutamate dehydrogenase 96.81
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.8
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.8
PRK14030 445 glutamate dehydrogenase; Provisional 96.8
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.73
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.7
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 96.64
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.51
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.45
KOG0409 327 consensus Predicted dehydrogenase [General functio 96.44
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.42
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.35
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.34
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 96.32
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 96.32
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 96.29
PRK06719157 precorrin-2 dehydrogenase; Validated 96.21
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.19
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 96.17
PLN02858 1378 fructose-bisphosphate aldolase 96.16
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.11
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 96.02
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.0
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.99
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.71
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.71
PLN00203 519 glutamyl-tRNA reductase 95.68
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.6
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 95.58
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.53
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.39
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 95.38
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 95.37
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.36
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.35
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 95.33
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.29
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.1
PRK12548 289 shikimate 5-dehydrogenase; Provisional 95.06
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.0
PRK14982 340 acyl-ACP reductase; Provisional 95.0
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.94
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 94.91
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 94.85
PF01262 168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.84
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 94.74
KOG1370 434 consensus S-adenosylhomocysteine hydrolase [Coenzy 94.72
PRK08328 231 hypothetical protein; Provisional 94.66
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.59
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 94.55
PRK04148134 hypothetical protein; Provisional 94.54
PRK13940 414 glutamyl-tRNA reductase; Provisional 94.53
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.51
PLN02948 577 phosphoribosylaminoimidazole carboxylase 94.37
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.28
PRK06841 255 short chain dehydrogenase; Provisional 94.28
PRK09496 453 trkA potassium transporter peripheral membrane com 94.28
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.27
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 94.25
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.2
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 94.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.09
cd01485 198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.06
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.05
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 93.97
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 93.93
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 93.79
PRK06153 393 hypothetical protein; Provisional 93.72
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 93.67
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 93.66
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 93.63
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.58
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 93.54
PLN02740 381 Alcohol dehydrogenase-like 93.34
PRK07831 262 short chain dehydrogenase; Provisional 93.29
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 93.28
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 93.25
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 93.22
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 93.22
PLN02586 360 probable cinnamyl alcohol dehydrogenase 93.18
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.14
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 93.1
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 93.07
COG0281 432 SfcA Malic enzyme [Energy production and conversio 93.03
PRK08223 287 hypothetical protein; Validated 92.92
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 92.91
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 92.89
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 92.87
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 92.8
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 92.77
PRK06141 314 ornithine cyclodeaminase; Validated 92.68
PRK05866 293 short chain dehydrogenase; Provisional 92.67
PLN02178 375 cinnamyl-alcohol dehydrogenase 92.65
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.56
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 92.55
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 92.47
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 92.43
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 92.4
PRK07411 390 hypothetical protein; Validated 92.36
PRK12862 763 malic enzyme; Reviewed 92.34
PRK12367 245 short chain dehydrogenase; Provisional 92.34
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 92.3
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 92.28
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.14
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.12
PRK12861 764 malic enzyme; Reviewed 92.08
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 92.08
PRK03562 621 glutathione-regulated potassium-efflux system prot 92.05
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 92.03
PRK10669558 putative cation:proton antiport protein; Provision 92.01
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 92.0
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 91.94
PRK06196 315 oxidoreductase; Provisional 91.94
PRK15116 268 sulfur acceptor protein CsdL; Provisional 91.91
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 91.87
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 91.86
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 91.84
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 91.76
cd05283 337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 91.72
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 91.72
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 91.66
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 91.6
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 91.56
PRK06197 306 short chain dehydrogenase; Provisional 91.5
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 91.47
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 91.47
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 91.46
PRK05562 223 precorrin-2 dehydrogenase; Provisional 91.46
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 91.36
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.28
PLN02780 320 ketoreductase/ oxidoreductase 91.18
PRK08324 681 short chain dehydrogenase; Validated 91.14
PLN02253 280 xanthoxin dehydrogenase 91.14
PRK03659 601 glutathione-regulated potassium-efflux system prot 91.1
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 91.09
PRK13529 563 malate dehydrogenase; Provisional 91.08
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 91.03
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 90.98
PRK11730 715 fadB multifunctional fatty acid oxidation complex 90.96
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 90.94
PLN02514 357 cinnamyl-alcohol dehydrogenase 90.92
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 90.85
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 90.85
PRK06701 290 short chain dehydrogenase; Provisional 90.82
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 90.81
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 90.8
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 90.78
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 90.76
PLN03209 576 translocon at the inner envelope of chloroplast su 90.54
PLN02695 370 GDP-D-mannose-3',5'-epimerase 90.51
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 90.5
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 90.49
PRK06720 169 hypothetical protein; Provisional 90.45
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 90.4
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 90.34
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 90.34
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 90.28
PRK07985 294 oxidoreductase; Provisional 90.27
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 90.25
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 90.22
PRK05854 313 short chain dehydrogenase; Provisional 90.2
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 90.13
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 90.08
PLN02827 378 Alcohol dehydrogenase-like 90.06
cd08269 312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 90.04
PRK14851 679 hypothetical protein; Provisional 89.97
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 89.8
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.72
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 89.57
PLN02602 350 lactate dehydrogenase 89.49
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 89.37
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 89.34
PRK07340 304 ornithine cyclodeaminase; Validated 89.34
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 89.29
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 89.23
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 89.23
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 89.17
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 89.07
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 89.03
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 88.96
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 88.89
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 88.79
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 88.74
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 88.73
PRK12814 652 putative NADPH-dependent glutamate synthase small 88.67
PRK06128 300 oxidoreductase; Provisional 88.64
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.58
PLN02427 386 UDP-apiose/xylose synthase 88.52
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 88.52
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 88.36
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 88.25
PRK08618 325 ornithine cyclodeaminase; Validated 88.2
cd08274 350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 88.07
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 88.06
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 87.92
PLN02572 442 UDP-sulfoquinovose synthase 87.91
cd08285 351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 87.86
PRK14804 311 ornithine carbamoyltransferase; Provisional 87.84
cd08264 325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 87.76
cd05284 340 arabinose_DH_like D-arabinose dehydrogenase. This 87.63
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 87.54
PRK12550 272 shikimate 5-dehydrogenase; Reviewed 87.49
TIGR02823 323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 87.4
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 87.37
cd05280 325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 87.35
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 87.34
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 87.31
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 87.29
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 87.28
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 87.24
cd08298 329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 87.19
PRK13512 438 coenzyme A disulfide reductase; Provisional 87.15
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 87.13
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 87.11
PRK01713 334 ornithine carbamoyltransferase; Provisional 87.11
PRK14852 989 hypothetical protein; Provisional 87.07
PRK06116 450 glutathione reductase; Validated 87.04
PRK06484 520 short chain dehydrogenase; Validated 87.0
cd08284 344 FDH_like_2 Glutathione-dependent formaldehyde dehy 86.95
cd08278 365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 86.92
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 86.92
cd08246 393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 86.88
PTZ00058 561 glutathione reductase; Provisional 86.87
PRK13984 604 putative oxidoreductase; Provisional 86.86
cd08232 339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 86.85
PTZ00317 559 NADP-dependent malic enzyme; Provisional 86.82
PLN02852 491 ferredoxin-NADP+ reductase 86.8
PRK12831 464 putative oxidoreductase; Provisional 86.74
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.73
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 86.72
PRK12831 464 putative oxidoreductase; Provisional 86.68
PTZ00188 506 adrenodoxin reductase; Provisional 86.67
PRK06370 463 mercuric reductase; Validated 86.66
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 86.62
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 86.59
cd05281 341 TDH Threonine dehydrogenase. L-threonine dehydroge 86.54
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 86.49
PRK07846 451 mycothione reductase; Reviewed 86.48
PRK12770 352 putative glutamate synthase subunit beta; Provisio 86.47
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 86.43
cd05286 320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 86.41
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 86.4
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 86.35
PLN02206 442 UDP-glucuronate decarboxylase 86.32
cd08286 345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 86.3
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 86.2
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 86.2
PRK07877 722 hypothetical protein; Provisional 86.16
PTZ00245 287 ubiquitin activating enzyme; Provisional 86.12
PRK10083 339 putative oxidoreductase; Provisional 86.01
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 86.0
PRK04523 335 N-acetylornithine carbamoyltransferase; Reviewed 85.99
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 85.93
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 85.93
PRK04284 332 ornithine carbamoyltransferase; Provisional 85.9
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 85.87
cd08287 345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 85.85
KOG2336 422 consensus Molybdopterin biosynthesis-related prote 85.78
COG5322 351 Predicted dehydrogenase [General function predicti 85.78
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 85.66
TIGR01751 398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 85.56
TIGR03316 357 ygeW probable carbamoyltransferase YgeW. Members o 85.43
PRK13771 334 putative alcohol dehydrogenase; Provisional 85.37
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 85.35
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 85.32
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 85.32
cd08265 384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 85.32
PRK06046 326 alanine dehydrogenase; Validated 85.31
PLN00106 323 malate dehydrogenase 85.31
PRK06567 1028 putative bifunctional glutamate synthase subunit b 85.25
PLN03129 581 NADP-dependent malic enzyme; Provisional 85.24
PRK07845 466 flavoprotein disulfide reductase; Reviewed 85.23
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 85.22
PLN00016 378 RNA-binding protein; Provisional 85.2
PRK07201 657 short chain dehydrogenase; Provisional 85.08
cd08252 336 AL_MDR Arginate lyase and other MDR family members 85.08
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 85.0
cd08240 350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 84.97
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 84.93
cd05282 323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 84.92
cd05285 343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 84.9
PRK02102 331 ornithine carbamoyltransferase; Validated 84.84
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 84.79
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 84.78
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 84.73
PLN02507 499 glutathione reductase 84.62
cd08279 363 Zn_ADH_class_III Class III alcohol dehydrogenase. 84.61
PRK09422 338 ethanol-active dehydrogenase/acetaldehyde-active r 84.59
PRK08291 330 ectoine utilization protein EutC; Validated 84.56
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 84.55
PLN02353473 probable UDP-glucose 6-dehydrogenase 84.39
PRK10262 321 thioredoxin reductase; Provisional 84.21
cd05279 365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 84.15
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 84.03
PRK14727 479 putative mercuric reductase; Provisional 83.93
PRK10754 327 quinone oxidoreductase, NADPH-dependent; Provision 83.92
cd08267 319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 83.84
TIGR02371 325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 83.82
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 83.74
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 83.69
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 83.68
PLN02546 558 glutathione reductase 83.67
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 83.54
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 83.44
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 83.44
PRK03515 336 ornithine carbamoyltransferase subunit I; Provisio 83.42
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 83.42
PRK13748 561 putative mercuric reductase; Provisional 83.41
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 83.36
PRK05855 582 short chain dehydrogenase; Validated 83.31
TIGR02053 463 MerA mercuric reductase. This model represents the 83.26
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 83.23
TIGR00658 304 orni_carb_tr ornithine carbamoyltransferase. Most 83.22
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 83.2
cd08235 343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 83.16
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 83.14
PRK14694 468 putative mercuric reductase; Provisional 83.09
PRK12779 944 putative bifunctional glutamate synthase subunit b 83.08
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 83.05
TIGR01285432 nifN nitrogenase molybdenum-iron cofactor biosynth 83.04
cd05289 309 MDR_like_2 alcohol dehydrogenase and quinone reduc 83.0
KOG2250 514 consensus Glutamate/leucine/phenylalanine/valine d 82.74
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 82.71
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 82.58
PTZ00354 334 alcohol dehydrogenase; Provisional 82.57
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 82.36
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 82.33
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 82.29
PTZ00153 659 lipoamide dehydrogenase; Provisional 82.26
PRK00779 304 ornithine carbamoyltransferase; Provisional 82.2
PLN02702 364 L-idonate 5-dehydrogenase 82.19
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 82.13
PRK08132 547 FAD-dependent oxidoreductase; Provisional 82.08
cd08263 367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 81.96
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 81.94
PRK05396 341 tdh L-threonine 3-dehydrogenase; Validated 81.83
TIGR00692 340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 81.78
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 81.74
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 81.7
cd08290 341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 81.7
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 81.62
cd08236 343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 81.6
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 81.52
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 81.44
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 81.36
cd08291 324 ETR_like_1 2-enoyl thioester reductase (ETR) like 81.26
PRK08105149 flavodoxin; Provisional 81.23
cd08256 350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 81.18
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 81.17
PLN02985 514 squalene monooxygenase 81.13
PRK09564 444 coenzyme A disulfide reductase; Reviewed 80.68
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 80.57
PTZ00052 499 thioredoxin reductase; Provisional 80.54
cd08276 336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 80.48
cd00316399 Oxidoreductase_nitrogenase The nitrogenase enzyme 80.4
cd05278 347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 80.23
PRK10537 393 voltage-gated potassium channel; Provisional 80.23
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 80.15
cd08297 341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 80.12
>PLN02928 oxidoreductase family protein Back     alignment and domain information
Probab=100.00  E-value=4.9e-36  Score=255.03  Aligned_cols=173  Identities=54%  Similarity=0.864  Sum_probs=145.4

Q ss_pred             ccccCCCCCCcceEEEeCCCCCCchhHHHHHhhcccCceeeeCch-hHHhhcCCCeE-EecCCCCCHHHHhcCCCCeEEE
Q 044056            6 EGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFL-SMHSLYASYGT-SEQMIASDSNVITRANPMNLII   83 (189)
Q Consensus         6 ~~~~~~~~~~~~~ilv~~~~~~~~~~~~~~~l~~~~~~~~~~~~~-~~~~~~~~adv-i~~~~~~~~~~l~~~p~Lk~I~   83 (189)
                      ++--+++++.+||||++.+..+....+.++.++.++.+.+...+. ++.+.++++|+ +.+..++++++++.+|+||||+
T Consensus         8 ~~~~~~~~~~~~~vl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~d~~i~~~~~~~~~~l~~~~~Lk~I~   87 (347)
T PLN02928          8 DKRVHHSDMRPTRVLFCGPEFPASYSYTREYLQKYPFIQVDAVAREDVPDVIANYDICVPKMMRLDADIIARASQMKLIM   87 (347)
T ss_pred             hhhccCCCCCCCEEEEECCCchhHHHHHHHHhhcCCeeEecCCCHHHHHHHhcCCcEEEECCCCCCHHHHhcCCCceEEE
Confidence            333466778889999998876654455667776665444443444 77888999999 6666789999999999999999


Q ss_pred             EcCCCCCcCChhHHhhCCeEEEecCCCCCCCchhHHHHHHHHHHHHHhcCC------------CCCCCCCCCCEEEEEcC
Q 044056           84 RFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHI------------VPTGETLLGKTVFISGF  151 (189)
Q Consensus        84 ~~~aG~d~id~~~~~~~gI~v~n~~g~~~~~a~~vAE~~l~liL~~~R~~~------------~~~~~~l~gktvGIvG~  151 (189)
                      +.++|+|++|++++.++||.|+|+|+++++++++||||+++++|+++|++.            ...+.+|.||||||||+
T Consensus        88 ~~~~G~d~id~~~~~~~gi~v~n~~~~~~~~~~~vAE~av~l~L~~~R~~~~~~~~~~~~~w~~~~~~~l~gktvGIiG~  167 (347)
T PLN02928         88 QFGVGLEGVDVDAATKHGIKVARIPSEGTGNAASCAEMAIYLMLGLLRKQNEMQISLKARRLGEPIGDTLFGKTVFILGY  167 (347)
T ss_pred             ECCcccCcCcHHHHHhCCCEEEECCCCCCcChHHHHHHHHHHHHHHHhCHHHHHHHHHcCCcccccccCCCCCEEEEECC
Confidence            999999999999999999999999997544889999999999999999987            12356899999999999


Q ss_pred             CHHHHHHHHHHccCCCEEEEEcCCCCC
Q 044056          152 GNIGVELAKRLRPFGVKIIAAKRSWAS  178 (189)
Q Consensus       152 G~IG~~vA~~l~afG~~V~~~~r~~~~  178 (189)
                      |+||+++|++|++|||+|++|||+.++
T Consensus       168 G~IG~~vA~~l~afG~~V~~~dr~~~~  194 (347)
T PLN02928        168 GAIGIELAKRLRPFGVKLLATRRSWTS  194 (347)
T ss_pred             CHHHHHHHHHHhhCCCEEEEECCCCCh
Confidence            999999999999999999999998543



>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01285 nifN nitrogenase molybdenum-iron cofactor biosynthesis protein NifN Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd00316 Oxidoreductase_nitrogenase The nitrogenase enzyme system catalyzes the ATP-dependent reduction of dinitrogen to ammonia Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2g76_A 335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 4e-07
2d0i_A 333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 7e-07
1gdh_A 320 Crystal Structure Of A Nad-Dependent D-Glycerate De 9e-05
2fss_A 365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 8e-04
>pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 22/140 (15%) Query: 50 LSMHSLYASYGTSEQMIASDS-----NVITRANPMNLIIRFRVGLEGVDIDALTNCAIKA 104 LS L A E +I + +VI A + ++ R G++ VD++A T K Sbjct: 56 LSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATR---KG 112 Query: 105 ARILGDVSGNAASCAELSIYLMLGLLRKHIVPT--------------GETLLGKTVFISG 150 ++ +GN+ S AEL+ +++ L R+ T G L GKT+ I G Sbjct: 113 ILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILG 172 Query: 151 FGNIGVELAKRLRPFGVKII 170 G IG E+A R++ FG+K I Sbjct: 173 LGRIGREVATRMQSFGMKTI 192
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 5e-16
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 5e-16
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 1e-15
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 6e-15
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 9e-15
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 2e-14
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 2e-14
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 2e-14
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 5e-14
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 6e-14
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 7e-14
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 1e-13
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 6e-13
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 8e-13
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 1e-12
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 2e-12
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 1e-11
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 1e-11
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 1e-11
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 2e-11
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 4e-11
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 5e-11
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 5e-11
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 5e-11
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 1e-10
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 3e-10
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 4e-10
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 5e-10
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 5e-10
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 2e-08
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 2e-08
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 3e-08
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 2e-06
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 5e-05
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 5e-05
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 6e-05
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 7e-05
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 1e-04
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 2e-04
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 2e-04
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 2e-04
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 3e-04
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 4e-04
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 4e-04
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 7e-04
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 8e-04
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
 Score = 73.9 bits (182), Expect = 5e-16
 Identities = 30/121 (24%), Positives = 46/121 (38%), Gaps = 21/121 (17%)

Query: 69  DSNVITRANPMNLIIRFRVGLEGVDIDALT--NCAIKAARILGDVSGNAASCAELSIYLM 126
               I +A  + L++   VG + +D+D +      I    + G    N  S AE  +  M
Sbjct: 75  TKERIDKAKKLKLVVVAGVGSDHIDLDYINQTGKKISVLEVTG---SNVVSVAEHVVMTM 131

Query: 127 LGLLR----------------KHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFGVKII 170
           L L+R                  I      + GKT+   G G IG  + +RL PF  K +
Sbjct: 132 LVLVRNFVPAHEQIINHDWEVAAIAKDAYDIEGKTIATIGAGRIGYRVLERLVPFNPKEL 191

Query: 171 A 171
            
Sbjct: 192 L 192


>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 100.0
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 100.0
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 100.0
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 100.0
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 100.0
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 100.0
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 100.0
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 100.0
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 100.0
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 100.0
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 100.0
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 100.0
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 100.0
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 100.0
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 100.0
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 100.0
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 100.0
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 100.0
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 99.98
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 99.98
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.98
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.98
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.97
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 99.97
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.97
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.97
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 99.97
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.97
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 99.97
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 99.97
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 99.97
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.96
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 99.95
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.91
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.83
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 99.55
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.51
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.43
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.23
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 99.17
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 99.09
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 99.04
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.94
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.88
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.73
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 98.67
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.59
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.4
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.12
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.07
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.06
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.97
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.96
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.96
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 97.8
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.73
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 97.67
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.6
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.59
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.59
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 96.66
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.43
3qha_A 296 Putative oxidoreductase; seattle structural genomi 97.39
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.37
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.37
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.32
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.31
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.27
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.27
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.24
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.23
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.22
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.21
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.19
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 97.17
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.15
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 97.1
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.0
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.99
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 96.96
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.83
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.81
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.8
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.76
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.66
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 96.66
2duw_A145 Putative COA-binding protein; ligand binding prote 96.61
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 96.4
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 96.33
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.33
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 96.31
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.31
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.29
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.22
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.2
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.18
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.18
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 96.17
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.16
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.16
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.16
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.13
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 96.1
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 96.05
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.02
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.0
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.98
1iuk_A140 Hypothetical protein TT1466; structural genomics, 95.96
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.95
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 95.94
2d59_A144 Hypothetical protein PH1109; COA binding, structur 95.94
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.92
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.92
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.91
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 95.91
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.86
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.82
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.81
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 95.8
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.75
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.73
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.71
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 95.7
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.67
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.66
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 95.46
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.44
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.42
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.4
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 95.38
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.37
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 95.34
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.28
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.26
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 95.25
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 95.21
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 95.19
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 95.18
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.16
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.13
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.13
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.12
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.07
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 95.06
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.01
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.0
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 94.99
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 94.98
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.96
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 94.95
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 94.94
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.92
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.89
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 94.84
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 94.84
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 94.81
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 94.79
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.78
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 94.78
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.71
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 94.54
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.54
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 94.54
4eye_A 342 Probable oxidoreductase; structural genomics, niai 94.52
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.52
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.46
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 94.46
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 94.45
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 94.42
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.41
3gms_A 340 Putative NADPH:quinone reductase; structural genom 94.41
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 94.4
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.34
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 94.34
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.34
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.32
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 94.32
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 94.3
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 94.23
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 94.23
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 94.18
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 94.17
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 94.16
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 94.12
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 94.11
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 94.09
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 94.08
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.07
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 94.06
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.05
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.04
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.02
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 93.98
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 93.96
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 93.95
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 93.93
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 93.93
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 93.86
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.86
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 93.84
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 93.81
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 93.81
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 93.78
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 93.72
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 93.63
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 93.58
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 93.55
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 93.54
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 93.5
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.49
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 93.46
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 93.46
2we8_A 386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 93.43
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 93.42
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.42
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 93.39
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 93.38
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 93.37
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 93.37
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 93.36
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.36
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 93.35
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 93.31
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.31
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 93.26
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 93.25
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 93.25
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 93.24
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.21
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 93.19
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 93.18
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.13
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 93.12
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 93.11
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 93.09
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.08
3rih_A 293 Short chain dehydrogenase or reductase; structural 92.96
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 92.96
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 92.92
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 92.92
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 92.9
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 92.89
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.89
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 92.88
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 92.88
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 92.86
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.86
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 92.84
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 92.83
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 92.81
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 92.8
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 92.78
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 92.78
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 92.76
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 92.72
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 92.7
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 92.69
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 92.69
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 92.64
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 92.63
4dqx_A 277 Probable oxidoreductase protein; structural genomi 92.59
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 92.58
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 92.57
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 92.57
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 92.5
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 92.47
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 92.47
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 92.41
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 92.4
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 92.4
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 92.38
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 92.37
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 92.36
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.35
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 92.33
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 92.31
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 92.29
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 92.25
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 92.25
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 92.24
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 92.22
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 92.22
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 92.21
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 92.2
3on5_A 362 BH1974 protein; structural genomics, joint center 92.14
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 92.14
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 92.14
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 92.12
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 92.03
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 92.02
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 92.01
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 92.01
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 91.98
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 91.97
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 91.97
3cxt_A 291 Dehydrogenase with different specificities; rossma 91.94
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 91.94
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 91.94
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 91.93
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 91.9
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 91.89
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 91.87
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 91.86
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 91.85
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 91.8
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 91.79
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 91.78
1lnq_A 336 MTHK channels, potassium channel related protein; 91.67
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 91.64
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 91.6
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 91.57
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 91.57
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 91.43
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 91.33
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 91.29
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 91.27
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 91.24
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.15
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 91.11
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 91.11
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 91.1
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 91.05
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 91.04
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 91.03
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 90.97
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 90.97
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 90.9
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 90.9
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 90.89
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 90.84
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 90.83
1xq1_A 266 Putative tropinone reducatse; structural genomics, 90.81
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 90.8
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 90.71
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 90.69
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 90.66
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 90.61
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 90.56
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 90.52
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 90.44
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 90.29
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 90.25
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 90.23
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 90.11
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 90.1
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 90.09
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 90.01
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 90.0
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 89.96
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 89.96
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 89.93
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 89.63
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 89.56
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 89.56
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 89.51
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 89.5
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 89.42
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 89.42
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 89.4
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 89.35
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 89.33
1xhl_A 297 Short-chain dehydrogenase/reductase family member 89.31
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 89.23
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 89.23
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 89.2
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 89.18
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 89.12
4f6c_A 427 AUSA reductase domain protein; thioester reductase 88.98
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 88.96
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 88.96
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 88.95
1dxh_A 335 Ornithine carbamoyltransferase; transcarbamylase; 88.86
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 88.84
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 88.84
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 88.73
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 88.73
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 88.65
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 88.56
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 88.38
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 88.34
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 88.33
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 88.3
2i6u_A 307 Otcase, ornithine carbamoyltransferase; X-RAY crys 88.3
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 88.28
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 88.27
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 88.24
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 88.16
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 88.11
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 88.09
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 87.93
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 87.86
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 87.8
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 87.78
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 87.76
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 87.7
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 87.69
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 87.6
1ojt_A 482 Surface protein; redox-active center, glycolysis, 87.56
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 87.55
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 87.44
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 87.33
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 87.29
4had_A 350 Probable oxidoreductase protein; structural genomi 87.23
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 87.2
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 87.17
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 87.13
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 87.08
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 86.9
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 86.85
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 86.82
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 86.66
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 86.66
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 86.58
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 86.45
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 86.42
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 86.21
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 86.21
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 86.17
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 86.16
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 86.1
2r7k_A 361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 86.01
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 85.98
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 85.95
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 85.84
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 85.82
1duv_G 333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 85.79
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 85.67
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 85.36
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 85.34
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 85.31
3q98_A 399 Transcarbamylase; rossmann fold, transferase; 2.00 85.3
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 85.27
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 85.08
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 85.06
3r7f_A 304 Aspartate carbamoyltransferase; aspartate transcar 85.01
3r9u_A 315 Thioredoxin reductase; structural genomics, center 85.0
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 84.94
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 84.81
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 84.72
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 84.72
1vlv_A 325 Otcase, ornithine carbamoyltransferase; TM1097, st 84.7
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 84.67
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 84.57
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 84.48
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 84.43
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 84.4
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 84.35
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 84.21
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 84.1
2bry_A 497 NEDD9 interacting protein with calponin homology a 84.07
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 83.74
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 83.73
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 83.72
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 83.55
2qrj_A 394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 83.45
1pvv_A 315 Otcase, ornithine carbamoyltransferase; dodecamer; 83.44
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 83.43
2w37_A 359 Ornithine carbamoyltransferase, catabolic; transca 83.4
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 83.34
4a8t_A 339 Putrescine carbamoyltransferase; trabnsferase PALO 83.14
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 83.05
1fec_A 490 Trypanothione reductase; redox-active center, oxid 83.01
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 82.78
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 82.67
4a8p_A 355 Putrescine carbamoyltransferase; ornithine agmatin 82.62
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 82.56
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 82.36
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 82.07
4dna_A 463 Probable glutathione reductase; structural genomic 82.02
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 81.94
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 81.94
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 81.8
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 81.79
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 81.43
1ml4_A 308 Aspartate transcarbamoylase; beta pleated sheet, p 81.41
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 81.22
4amu_A 365 Ornithine carbamoyltransferase, catabolic; ornithi 81.19
4ekn_B 306 Aspartate carbamoyltransferase; atcase, aspartate 81.02
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 80.94
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 80.86
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 80.85
4h31_A 358 Otcase, ornithine carbamoyltransferase; structural 80.85
1oth_A 321 Protein (ornithine transcarbamoylase); transferase 80.74
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 80.67
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 80.66
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 80.64
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 80.55
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 80.42
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 80.08
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 80.03
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
Probab=100.00  E-value=2.2e-35  Score=249.53  Aligned_cols=158  Identities=23%  Similarity=0.272  Sum_probs=133.1

Q ss_pred             CCcceEEEeCCCCCCchhHHHHHhhcccCceeeeC----ch-hHHhhcCCCeE-Eec-CCCCCHHHHhcC-CCCeEEEEc
Q 044056           14 KSITLVLFRGPHFPASHNYAKGYLQNYLSIKGLCF----FL-SMHSLYASYGT-SEQ-MIASDSNVITRA-NPMNLIIRF   85 (189)
Q Consensus        14 ~~~~~ilv~~~~~~~~~~~~~~~l~~~~~~~~~~~----~~-~~~~~~~~adv-i~~-~~~~~~~~l~~~-p~Lk~I~~~   85 (189)
                      +.|||||++.+..+..    .+.++...++++...    +. ++.+.++++|+ +.+ ..++++++|+++ |+||||++.
T Consensus        26 ~~~~kvlv~~~~~~~~----~~~l~~~~~v~~~~~~~~~~~~~l~~~~~~~d~li~~~~~~i~~~~l~~~~~~Lk~I~~~  101 (345)
T 4g2n_A           26 HPIQKAFLCRRFTPAI----EAELRQRFDLEVNLEDTVLTPSGIASRAHGAEVLFVTATEAITAEVIRKLQPGLKTIATL  101 (345)
T ss_dssp             -CCCEEEESSCCCHHH----HHHHHHHSEEEECTTCCCCCHHHHHHHTTTCSEEEECTTSCBCHHHHHHTTTTCCEEEES
T ss_pred             CCCCEEEEeCCCCHHH----HHHHHccCCEEEecCCCCCCHHHHHHHhcCCeEEEEeCCCCCCHHHHHhhcCCceEEEEc
Confidence            4579999999876543    234444334544322    23 67888999999 554 478999999997 799999999


Q ss_pred             CCCCCcCChhHHhhCCeEEEecCCCCCCCchhHHHHHHHHHHHHHhcCC----------C-------CCCCCCCCCEEEE
Q 044056           86 RVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHI----------V-------PTGETLLGKTVFI  148 (189)
Q Consensus        86 ~aG~d~id~~~~~~~gI~v~n~~g~~~~~a~~vAE~~l~liL~~~R~~~----------~-------~~~~~l~gktvGI  148 (189)
                      |+|+|+||+++++++||.|+|+||+   ++++||||+++++|++.|+++          .       ..+.+|+||||||
T Consensus       102 ~~G~D~id~~~a~~~gI~V~n~pg~---~~~~vAE~a~~l~L~~~R~~~~~~~~~r~g~W~~~~~~~~~g~~l~gktvGI  178 (345)
T 4g2n_A          102 SVGYDHIDMAAARSLGIKVLHTPDV---LSDACAEIAMLLVLNACRRGYEADRMVRSGSWPGWGPTQLLGMGLTGRRLGI  178 (345)
T ss_dssp             SSCCTTBCHHHHHHTTCEEECCCSC---CHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCCCTTTTCBCCCTTCEEEE
T ss_pred             CCcccccCHHHHHhCCEEEEECCcc---cchHHHHHHHHHHHHHHhCHHHHHHHHHcCCCcccCcccccccccCCCEEEE
Confidence            9999999999999999999999999   899999999999999999986          1       2368999999999


Q ss_pred             EcCCHHHHHHHHHHccCCCEEEEEcCCCCC
Q 044056          149 SGFGNIGVELAKRLRPFGVKIIAAKRSWAS  178 (189)
Q Consensus       149 vG~G~IG~~vA~~l~afG~~V~~~~r~~~~  178 (189)
                      ||+|+||+++|++|++|||+|++|||++.+
T Consensus       179 IGlG~IG~~vA~~l~~~G~~V~~~dr~~~~  208 (345)
T 4g2n_A          179 FGMGRIGRAIATRARGFGLAIHYHNRTRLS  208 (345)
T ss_dssp             ESCSHHHHHHHHHHHTTTCEEEEECSSCCC
T ss_pred             EEeChhHHHHHHHHHHCCCEEEEECCCCcc
Confidence            999999999999999999999999998643



>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehy 4e-07
d1hwxa1 293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 1e-04
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 5e-04
d1c1da1 201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 9e-04
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 0.002
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen 0.003
d1v9la1 242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 0.004
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Putative formate dehydrogenase
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
 Score = 44.6 bits (105), Expect = 4e-07
 Identities = 11/99 (11%), Positives = 29/99 (29%), Gaps = 19/99 (19%)

Query: 69  DSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSG-NAASCAELSIYLML 127
            +  + +   +  I     GL+ +  +++          +   +G N      +   +++
Sbjct: 41  TAEELAKMPRLKFIQVVTAGLDHLPWESI-----PPHVTVAGNAGSNGYGNERVWRQMVM 95

Query: 128 GLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFG 166
             +R              +     G     +AKR    G
Sbjct: 96  EAVR-------------NLITYATGGRPRNIAKREDYIG 121


>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.94
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.93
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.9
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.88
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.86
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.83
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.83
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.79
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.75
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.74
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 99.74
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.73
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.72
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.71
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.68
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.64
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.82
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.35
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.02
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.92
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.89
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.77
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.71
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.53
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.32
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.23
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.22
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.19
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 97.14
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.11
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.98
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.92
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.91
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.82
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.77
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.75
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.7
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.66
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.63
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.58
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.57
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.49
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.34
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.29
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.24
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.22
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.18
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.11
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.11
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.08
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.98
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.91
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.9
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.84
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.78
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.71
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 95.62
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.61
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.45
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.42
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.36
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.34
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.3
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.16
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.12
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.08
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.04
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.02
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.99
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.95
d1l7da1 183 Nicotinamide nucleotide transhydrogenase dI compon 94.93
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.88
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.86
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.84
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 94.78
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 94.77
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.76
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.73
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.55
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.52
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.34
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.17
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.15
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.14
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.09
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.08
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.83
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.81
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 93.6
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 93.48
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 93.44
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 93.38
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.27
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.17
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.96
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 92.92
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 92.71
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 92.55
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.52
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.43
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.28
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.2
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.79
d1v3va2 182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 91.75
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.72
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.68
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.25
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.81
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.78
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.68
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.55
d1qmga2 226 Class II ketol-acid reductoisomerase (KARI) {Spina 90.43
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 90.33
d1h6da1 221 Glucose-fructose oxidoreductase, N-terminal domain 90.17
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 89.62
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.15
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 88.51
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 88.4
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.15
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 87.56
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 87.44
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 87.06
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.01
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 86.17
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 86.11
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 85.88
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.48
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 84.25
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 84.1
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 83.25
d1vj1a2 187 Putative zinc-binding alcohol dehydrogenase {Mouse 82.3
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 81.99
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 81.93
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.47
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Putative formate dehydrogenase
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Probab=99.94  E-value=2e-29  Score=181.83  Aligned_cols=120  Identities=13%  Similarity=0.123  Sum_probs=99.7

Q ss_pred             ceEEEeCCCCCCchhHHHHHhhcccCceeeeCchhHHhhcCCCeE-EecCCCCCHHHHhcCCCCeEEEEcCCCCCcCChh
Q 044056           17 TLVLFRGPHFPASHNYAKGYLQNYLSIKGLCFFLSMHSLYASYGT-SEQMIASDSNVITRANPMNLIIRFRVGLEGVDID   95 (189)
Q Consensus        17 ~~ilv~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~adv-i~~~~~~~~~~l~~~p~Lk~I~~~~aG~d~id~~   95 (189)
                      |||+++.+.+++.    .+.++.+  .++...     ..++++|+ +.  ++++++.++++|+||||++.|+|+||+|++
T Consensus         1 Mki~v~~~lp~e~----~e~L~~~--~~v~~~-----~d~~~~d~~l~--~~~~~~~l~~~~~Lk~i~~~~aG~D~i~~~   67 (121)
T d1qp8a2           1 MELYVNFELPPEA----EEELRKY--FKIVRG-----GDLGNVEAALV--SRITAEELAKMPRLKFIQVVTAGLDHLPWE   67 (121)
T ss_dssp             CEEECCSCCCHHH----HHHHHTT--CEEECS-----SCCTTBCCCCB--SCCCHHHHHHCTTCCCEEBSSSCCTTSCCT
T ss_pred             CEEEEeCCCCHHH----HHHhhhc--ceEeec-----ccccccceeee--eccCHHHHhcCCCceEEEecccCcCCCCHH
Confidence            7899998876443    3445443  222221     23567888 54  479999999999999999999999999999


Q ss_pred             HHhhCCeEEEecCCCCCCCchhHHHHHHHHHHHHHhcCCCCCCCCCCCCEEEEEcCCHHHHHHHHHHccCC
Q 044056           96 ALTNCAIKAARILGDVSGNAASCAELSIYLMLGLLRKHIVPTGETLLGKTVFISGFGNIGVELAKRLRPFG  166 (189)
Q Consensus        96 ~~~~~gI~v~n~~g~~~~~a~~vAE~~l~liL~~~R~~~~~~~~~l~gktvGIvG~G~IG~~vA~~l~afG  166 (189)
                      .+ +++|.|+|++|+   |+.+||||+++++|++.|+             +||+|+|+||+++|+|+++||
T Consensus        68 ~~-~~~i~v~n~~g~---~~~~vae~~~~~il~~~r~-------------l~i~G~G~iG~~iA~r~~a~G  121 (121)
T d1qp8a2          68 SI-PPHVTVAGNAGS---NGYGNERVWRQMVMEAVRN-------------LITYATGGRPRNIAKREDYIG  121 (121)
T ss_dssp             TS-CTTSCEECCCSS---SSSSCHHHHHHHHHHHHHH-------------HHHHHTTSCCSCBCCGGGTC-
T ss_pred             Hh-ccCeEEEECCCC---ChHHHHHHHHHHHHHhcCC-------------EEEEcCCHHHHHHHHHHHhcC
Confidence            87 569999999999   9999999999999999984             799999999999999999998



>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure