Citrus Sinensis ID: 044090
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| 224132386 | 476 | predicted protein [Populus trichocarpa] | 0.996 | 0.584 | 0.684 | 2e-91 | |
| 224102827 | 477 | predicted protein [Populus trichocarpa] | 1.0 | 0.584 | 0.698 | 3e-90 | |
| 225440898 | 486 | PREDICTED: cell division protein ftsZ ho | 1.0 | 0.574 | 0.673 | 8e-89 | |
| 6685070 | 483 | FtsZ protein [Gentiana lutea] | 0.996 | 0.575 | 0.668 | 1e-86 | |
| 255575683 | 485 | Cell division protein ftsZ, putative [Ri | 0.992 | 0.571 | 0.652 | 1e-84 | |
| 255565619 | 491 | Cell division protein ftsZ, putative [Ri | 0.982 | 0.558 | 0.662 | 6e-82 | |
| 297827101 | 479 | hypothetical protein ARALYDRAFT_902736 [ | 0.974 | 0.567 | 0.611 | 2e-80 | |
| 378750401 | 485 | FtsZ2 protein [Manihot esculenta] | 0.992 | 0.571 | 0.632 | 2e-80 | |
| 18404086 | 478 | Tubulin/FtsZ-like protein [Arabidopsis t | 0.985 | 0.575 | 0.613 | 3e-80 | |
| 14787784 | 468 | FtsZ-like protein [Nicotiana tabacum] | 0.964 | 0.574 | 0.656 | 1e-79 |
| >gi|224132386|ref|XP_002328256.1| predicted protein [Populus trichocarpa] gi|222837771|gb|EEE76136.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 341 bits (874), Expect = 2e-91, Method: Compositional matrix adjust.
Identities = 195/285 (68%), Positives = 223/285 (78%), Gaps = 7/285 (2%)
Query: 1 MATCISTCFSPSHTCISKETQISGAS------LVKILDYRSDSWGACLRNVKDFPRFKCS 54
MA+C+S F+PS T IS +IS + + D + SWGAC RN + +CS
Sbjct: 1 MASCVSPPFTPSGTQISVGRRISTENRFGRIVTAQRFDKKKGSWGACGRNAVSISQIRCS 60
Query: 55 AKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGESVSESLRQSSVPNNNNE 114
+HN+SPNH KD FLDLHPEVSML D + KE G +V+ES +S +N NE
Sbjct: 61 VNSHNISPNH-KDSFLDLHPEVSMLRSDANDTYSSVRKETSGRNVTESSGDTSFMSNYNE 119
Query: 115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTRGL 174
AKIKV+GVGGGGSNAVNRMIESS+TGVEFWIVNTD QAMK+SPV+PENRLQ+G ELTRGL
Sbjct: 120 AKIKVVGVGGGGSNAVNRMIESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGL 179
Query: 175 GAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTV 234
GAGGNP +GMNAANESK AIEEA+ GADM+F+TAGMGGGTGTG APVIAG+AKSMGILTV
Sbjct: 180 GAGGNPDIGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAPVIAGVAKSMGILTV 239
Query: 235 GIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAVS 279
GI T PF FEGRRRA+QAQEG+A LRNNVDTLIVIPNDKLLTAVS
Sbjct: 240 GIVTSPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVS 284
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224102827|ref|XP_002312816.1| predicted protein [Populus trichocarpa] gi|222849224|gb|EEE86771.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225440898|ref|XP_002282740.1| PREDICTED: cell division protein ftsZ homolog 2-1, chloroplastic [Vitis vinifera] gi|147856408|emb|CAN80330.1| hypothetical protein VITISV_018274 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|6685070|gb|AAF23771.1|AF205859_1 FtsZ protein [Gentiana lutea] | Back alignment and taxonomy information |
|---|
| >gi|255575683|ref|XP_002528741.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223531835|gb|EEF33653.1| Cell division protein ftsZ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255565619|ref|XP_002523799.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223536887|gb|EEF38525.1| Cell division protein ftsZ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297827101|ref|XP_002881433.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. lyrata] gi|297327272|gb|EFH57692.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|378750401|gb|AFC37492.1| FtsZ2 protein [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|18404086|ref|NP_565839.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|42571077|ref|NP_973612.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|75220266|sp|O82533.2|FTZ21_ARATH RecName: Full=Cell division protein FtsZ homolog 2-1, chloroplastic; Short=AtFtsZ2-1; AltName: Full=Plastid division protein FTSZ2-1; Flags: Precursor gi|14195704|gb|AAC35987.2| plastid division protein FtsZ [Arabidopsis thaliana] gi|15292821|gb|AAK92779.1| putative plastid division protein FtsZ [Arabidopsis thaliana] gi|15636809|dbj|BAB68127.1| chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] gi|20197938|gb|AAD21440.2| plastid division protein (FtsZ) [Arabidopsis thaliana] gi|20259559|gb|AAM14122.1| putative plastid division FtsZ protein [Arabidopsis thaliana] gi|330254127|gb|AEC09221.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|330254128|gb|AEC09222.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14787784|emb|CAC44257.1| FtsZ-like protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| TAIR|locus:2049455 | 478 | FTSZ2-1 [Arabidopsis thaliana | 0.985 | 0.575 | 0.505 | 1.7e-66 | |
| TAIR|locus:2083258 | 473 | FTSZ2-2 [Arabidopsis thaliana | 0.777 | 0.458 | 0.575 | 1e-59 | |
| TIGR_CMR|BA_4045 | 386 | BA_4045 "cell division protein | 0.537 | 0.388 | 0.532 | 9.2e-36 | |
| UNIPROTKB|P17865 | 382 | ftsZ "Cell division protein Ft | 0.537 | 0.392 | 0.513 | 8.3e-35 | |
| TIGR_CMR|CHY_2060 | 352 | CHY_2060 "cell division protei | 0.537 | 0.426 | 0.5 | 1.3e-34 | |
| UNIPROTKB|P73456 | 430 | ftsZ "Cell division protein Ft | 0.534 | 0.346 | 0.496 | 4.6e-34 | |
| TAIR|locus:2161610 | 433 | FTSZ1-1 "homolog of bacterial | 0.526 | 0.339 | 0.503 | 8.5e-33 | |
| UNIPROTKB|P64170 | 379 | ftsZ "Cell division protein Ft | 0.523 | 0.385 | 0.486 | 9.8e-32 | |
| UNIPROTKB|P0A9A6 | 383 | ftsZ [Escherichia coli K-12 (t | 0.577 | 0.420 | 0.423 | 1e-29 | |
| TIGR_CMR|DET_0636 | 376 | DET_0636 "cell division protei | 0.537 | 0.398 | 0.447 | 3.4e-29 |
| TAIR|locus:2049455 FTSZ2-1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 676 (243.0 bits), Expect = 1.7e-66, P = 1.7e-66
Identities = 145/287 (50%), Positives = 184/287 (64%)
Query: 1 MATCISTCFSPSH----TCISK----ETQISGASLVKILDYRSDSWGACLRNVKDFPRFK 52
MAT +S CF+PS T + K E + + ++ +D + + + + P +
Sbjct: 1 MATYVSPCFTPSDSRLLTVLRKNVLPENHLGRLNSIRTIDSKKNRVVVAAQKSESSP-IR 59
Query: 53 CSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGESVSESLRQSSVPNNN 112
S + + + ++DPFL+LHPE+SML G+GT+ + KE V E + S P+N
Sbjct: 60 NSPRHYQ---SQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVVEDFEEPSAPSNY 116
Query: 113 NEAXXXXXXXXXXXSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTR 172
NEA SNAVNRMIES M+GVEFWIVNTD QAM++SPV+P+NRLQIG ELTR
Sbjct: 117 NEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTR 176
Query: 173 GLGAGGNPSVGMNAANESKVAIEEAISGADMIFXXXXXXXXXXXXXXXXXXXXXKSMGIL 232
GLGAGGNP +GMNAA ESK IEEA+ G+DM+F K+MGIL
Sbjct: 177 GLGAGGNPEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGIL 236
Query: 233 TVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAVS 279
TVGIAT PF FEGRRR +QAQEG+A+LR+NVDTLIVIPNDKLLTAVS
Sbjct: 237 TVGIATTPFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVS 283
|
|
| TAIR|locus:2083258 FTSZ2-2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4045 BA_4045 "cell division protein FtsZ" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P17865 ftsZ "Cell division protein FtsZ" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2060 CHY_2060 "cell division protein FtsZ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P73456 ftsZ "Cell division protein FtsZ" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161610 FTSZ1-1 "homolog of bacterial cytokinesis Z-ring protein FTSZ 1-1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P64170 ftsZ "Cell division protein FtsZ" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A9A6 ftsZ [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0636 DET_0636 "cell division protein FtsZ" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0066013202 | hypothetical protein (477 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.V.5360.1 | • | • | 0.900 | ||||||||
| gw1.XII.1867.1 | • | • | 0.898 | ||||||||
| gw1.XI.2542.1 | • | • | • | 0.846 | |||||||
| fgenesh4_pg.C_LG_I000919 | • | • | • | 0.833 | |||||||
| eugene3.149220001 | • | • | 0.831 | ||||||||
| eugene3.195680001 | • | • | 0.774 | ||||||||
| eugene3.205270002 | • | • | 0.738 | ||||||||
| fgenesh4_pg.C_scaffold_18231000001 | • | • | 0.728 | ||||||||
| fgenesh4_pg.C_scaffold_2755000002 | • | • | 0.715 | ||||||||
| fgenesh4_pg.C_scaffold_10565000001 | • | 0.605 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| PRK09330 | 384 | PRK09330, PRK09330, cell division protein FtsZ; Va | 1e-102 | |
| cd02201 | 304 | cd02201, FtsZ_type1, FtsZ is a GTPase that is simi | 7e-94 | |
| TIGR00065 | 349 | TIGR00065, ftsZ, cell division protein FtsZ | 4e-79 | |
| PRK13018 | 378 | PRK13018, PRK13018, cell division protein FtsZ; Pr | 9e-76 | |
| COG0206 | 338 | COG0206, FtsZ, Cell division GTPase [Cell division | 1e-72 | |
| smart00864 | 192 | smart00864, Tubulin, Tubulin/FtsZ family, GTPase d | 4e-70 | |
| cd02191 | 303 | cd02191, FtsZ, FtsZ is a GTPase that is similar to | 1e-55 | |
| pfam00091 | 210 | pfam00091, Tubulin, Tubulin/FtsZ family, GTPase do | 2e-42 | |
| cd02202 | 349 | cd02202, FtsZ_type2, FtsZ is a GTPase that is simi | 1e-20 | |
| cd00286 | 328 | cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ | 3e-14 |
| >gnl|CDD|236468 PRK09330, PRK09330, cell division protein FtsZ; Validated | Back alignment and domain information |
|---|
Score = 302 bits (775), Expect = e-102
Identities = 108/169 (63%), Positives = 126/169 (74%), Gaps = 2/169 (1%)
Query: 110 NNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCE 169
N A IKVIGVGGGG NAVNRMIE + GVEF NTDAQA+ S ++Q+G +
Sbjct: 9 EENQGAVIKVIGVGGGGGNAVNRMIEEGIQGVEFIAANTDAQALLKSKA--PVKIQLGEK 66
Query: 170 LTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSM 229
LTRGLGAG NP VG AA ES+ I EA+ GADM+F+TAGMGGGTGTGAAPV+A IAK +
Sbjct: 67 LTRGLGAGANPEVGRKAAEESREEIREALEGADMVFITAGMGGGTGTGAAPVVAEIAKEL 126
Query: 230 GILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAV 278
GILTV + T PF FEG++R QA+EG+ LR +VDTLIVIPNDKLL V
Sbjct: 127 GILTVAVVTKPFSFEGKKRMKQAEEGIEELRKHVDTLIVIPNDKLLEVV 175
|
Length = 384 |
| >gnl|CDD|100021 cd02201, FtsZ_type1, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|232805 TIGR00065, ftsZ, cell division protein FtsZ | Back alignment and domain information |
|---|
| >gnl|CDD|237273 PRK13018, PRK13018, cell division protein FtsZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223284 COG0206, FtsZ, Cell division GTPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|214867 smart00864, Tubulin, Tubulin/FtsZ family, GTPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|100020 cd02191, FtsZ, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|215710 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|100022 cd02202, FtsZ_type2, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| PRK09330 | 384 | cell division protein FtsZ; Validated | 100.0 | |
| PRK13018 | 378 | cell division protein FtsZ; Provisional | 100.0 | |
| TIGR00065 | 349 | ftsZ cell division protein FtsZ. This family consi | 100.0 | |
| cd02201 | 304 | FtsZ_type1 FtsZ is a GTPase that is similar to the | 100.0 | |
| cd02191 | 303 | FtsZ FtsZ is a GTPase that is similar to the eukar | 100.0 | |
| COG0206 | 338 | FtsZ Cell division GTPase [Cell division and chrom | 100.0 | |
| cd02202 | 349 | FtsZ_type2 FtsZ is a GTPase that is similar to the | 100.0 | |
| smart00864 | 192 | Tubulin Tubulin/FtsZ family, GTPase domain. This d | 100.0 | |
| PF00091 | 216 | Tubulin: Tubulin/FtsZ family, GTPase domain; Inter | 100.0 | |
| cd00286 | 328 | Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin | 99.96 | |
| cd06059 | 382 | Tubulin The tubulin superfamily includes five dist | 99.91 | |
| cd02190 | 379 | epsilon_tubulin The tubulin superfamily includes f | 99.87 | |
| PTZ00387 | 465 | epsilon tubulin; Provisional | 99.84 | |
| cd02187 | 425 | beta_tubulin The tubulin superfamily includes five | 99.84 | |
| PLN00220 | 447 | tubulin beta chain; Provisional | 99.83 | |
| cd02186 | 434 | alpha_tubulin The tubulin superfamily includes fiv | 99.82 | |
| COG5023 | 443 | Tubulin [Cytoskeleton] | 99.82 | |
| cd02189 | 446 | delta_tubulin The tubulin superfamily includes fiv | 99.82 | |
| PTZ00335 | 448 | tubulin alpha chain; Provisional | 99.82 | |
| cd02188 | 431 | gamma_tubulin Gamma-tubulin is a ubiquitous phylog | 99.81 | |
| PLN00222 | 454 | tubulin gamma chain; Provisional | 99.8 | |
| PTZ00010 | 445 | tubulin beta chain; Provisional | 99.79 | |
| PLN00221 | 450 | tubulin alpha chain; Provisional | 99.79 | |
| KOG1374 | 448 | consensus Gamma tubulin [Cytoskeleton] | 99.58 | |
| PF13809 | 345 | Tubulin_2: Tubulin like | 99.25 | |
| KOG1376 | 407 | consensus Alpha tubulin [Cytoskeleton] | 98.57 | |
| KOG1375 | 369 | consensus Beta tubulin [Cytoskeleton] | 98.47 | |
| cd06060 | 493 | misato Human Misato shows similarity with Tubulin/ | 98.42 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 95.46 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 95.46 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 95.08 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 94.8 | |
| PF14881 | 180 | Tubulin_3: Tubulin domain | 94.78 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 94.75 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 94.58 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 94.4 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 94.17 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 94.11 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 93.92 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 93.87 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 93.77 | |
| PRK10886 | 196 | DnaA initiator-associating protein DiaA; Provision | 93.64 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 93.23 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 93.07 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 93.04 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 92.86 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 92.62 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 92.58 | |
| PRK08223 | 287 | hypothetical protein; Validated | 92.31 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 91.86 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 91.51 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 91.3 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 90.9 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 90.69 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 90.68 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 90.66 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 90.53 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 90.52 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 90.5 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 90.39 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 90.36 | |
| PLN00106 | 323 | malate dehydrogenase | 90.27 | |
| PRK00414 | 192 | gmhA phosphoheptose isomerase; Reviewed | 90.17 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 89.97 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 89.96 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 89.92 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 89.68 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 89.66 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 89.38 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 89.13 | |
| PLN02602 | 350 | lactate dehydrogenase | 88.99 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 88.69 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 88.66 | |
| TIGR00441 | 154 | gmhA phosphoheptose isomerase. Involved in lipopol | 88.41 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 88.34 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 88.32 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 88.16 | |
| PF00289 | 110 | CPSase_L_chain: Carbamoyl-phosphate synthase L cha | 88.0 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 87.98 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 87.59 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 87.57 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 87.44 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 87.4 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 87.31 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 87.12 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 86.98 | |
| PRK07411 | 390 | hypothetical protein; Validated | 86.82 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 86.75 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 86.51 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 86.28 | |
| PF06908 | 177 | DUF1273: Protein of unknown function (DUF1273); In | 86.14 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 85.97 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 85.86 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 85.85 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 85.7 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 85.7 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 85.66 | |
| KOG1495 | 332 | consensus Lactate dehydrogenase [Energy production | 85.62 | |
| PRK13936 | 197 | phosphoheptose isomerase; Provisional | 85.47 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 85.44 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 85.11 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 84.93 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 84.91 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 84.7 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 84.65 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 84.46 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 84.4 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 84.23 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 84.21 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 83.58 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 83.58 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 83.55 | |
| PRK13937 | 188 | phosphoheptose isomerase; Provisional | 83.39 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 83.13 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 83.0 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 82.97 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 82.82 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 82.68 | |
| PRK13938 | 196 | phosphoheptose isomerase; Provisional | 82.45 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 82.18 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 82.18 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 82.17 | |
| cd05297 | 423 | GH4_alpha_glucosidase_galactosidase Glycoside Hydr | 82.11 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 81.93 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 81.88 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 81.8 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 81.68 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 81.58 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 81.54 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 81.51 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 81.37 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 81.35 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 81.29 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 81.15 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 81.15 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 80.96 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 80.96 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 80.42 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 80.38 | |
| COG1023 | 300 | Gnd Predicted 6-phosphogluconate dehydrogenase [Ca | 80.27 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 80.18 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 80.16 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 80.09 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 80.04 |
| >PRK09330 cell division protein FtsZ; Validated | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-47 Score=366.41 Aligned_cols=165 Identities=65% Similarity=0.998 Sum_probs=160.3
Q ss_pred CCCceEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHHHhcCCCCCCCeEEcCcccccCCCCCCCchhhHHHHHHHH
Q 044090 112 NNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTRGLGAGGNPSVGMNAANESK 191 (279)
Q Consensus 112 ~~~~kI~VIGIGgaG~NIVd~l~~~~~~~ve~iavNTD~~~L~~s~v~a~~ri~iG~~~t~G~GaG~np~~G~eaa~e~~ 191 (279)
...++|+||||||||||+||+|++.++.+++|||+|||.++|..++ +++||+||+..|+|+|+|+||++|++++++++
T Consensus 11 ~~~~~IkViGvGG~G~Nav~~m~~~~~~~v~fia~NTD~q~L~~~~--a~~ki~lG~~~t~GlGaG~~pe~G~~aaee~~ 88 (384)
T PRK09330 11 NQGAVIKVIGVGGGGGNAVNRMIEEGIQGVEFIAANTDAQALLKSK--APVKIQLGEKLTRGLGAGANPEVGRKAAEESR 88 (384)
T ss_pred ccCCeEEEEEECCcHHHHHHHHHHcCCCCceEEEEeCcHHHHhcCC--CCeEEEcCCcccccCCCCCCHHHHHHHHHHHH
Confidence 4568999999999999999999999999999999999999999875 58999999999999999999999999999999
Q ss_pred HHHHHHhcCCCEEEEEeecCCCcccCHHHHHHHHHHHcCCcEEEEEccCCCCchhHHHHHHHHHHHHHHHhCCEEEEEec
Q 044090 192 VAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPN 271 (279)
Q Consensus 192 e~I~~~Le~~D~vfIvAGLGGGTGSG~aPvIaeiake~gi~tvaIvtlPf~~Eg~~r~~NA~~gL~~L~e~aD~vIv~DN 271 (279)
++|+++|++||+|||+||||||||||++|+|++++|++++++++|||+||.|||.+|++||.++|++|++++|++|+|||
T Consensus 89 e~I~~~l~~~D~vfI~AGmGGGTGTGaapvIA~iake~g~ltvaVvt~PF~fEG~~r~~nA~~gL~~L~~~~D~vIvi~N 168 (384)
T PRK09330 89 EEIREALEGADMVFITAGMGGGTGTGAAPVVAEIAKELGILTVAVVTKPFSFEGKKRMKQAEEGIEELRKHVDTLIVIPN 168 (384)
T ss_pred HHHHHHHcCCCEEEEEecCCCcccHHHHHHHHHHHHHcCCcEEEEEecCccccchhHHHHHHHHHHHHHHHCCEEEEEec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHhhh
Q 044090 272 DKLLTAV 278 (279)
Q Consensus 272 d~L~~i~ 278 (279)
|+|++++
T Consensus 169 d~L~~~~ 175 (384)
T PRK09330 169 DKLLEVV 175 (384)
T ss_pred HHHHhhc
Confidence 9999876
|
|
| >PRK13018 cell division protein FtsZ; Provisional | Back alignment and domain information |
|---|
| >TIGR00065 ftsZ cell division protein FtsZ | Back alignment and domain information |
|---|
| >cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >cd02191 FtsZ FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >COG0206 FtsZ Cell division GTPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02202 FtsZ_type2 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes | Back alignment and domain information |
|---|
| >smart00864 Tubulin Tubulin/FtsZ family, GTPase domain | Back alignment and domain information |
|---|
| >PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins | Back alignment and domain information |
|---|
| >cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation | Back alignment and domain information |
|---|
| >cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PTZ00387 epsilon tubulin; Provisional | Back alignment and domain information |
|---|
| >cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PLN00220 tubulin beta chain; Provisional | Back alignment and domain information |
|---|
| >cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >COG5023 Tubulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PTZ00335 tubulin alpha chain; Provisional | Back alignment and domain information |
|---|
| >cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily | Back alignment and domain information |
|---|
| >PLN00222 tubulin gamma chain; Provisional | Back alignment and domain information |
|---|
| >PTZ00010 tubulin beta chain; Provisional | Back alignment and domain information |
|---|
| >PLN00221 tubulin alpha chain; Provisional | Back alignment and domain information |
|---|
| >KOG1374 consensus Gamma tubulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13809 Tubulin_2: Tubulin like | Back alignment and domain information |
|---|
| >KOG1376 consensus Alpha tubulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1375 consensus Beta tubulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd06060 misato Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14881 Tubulin_3: Tubulin domain | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10886 DnaA initiator-associating protein DiaA; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00414 gmhA phosphoheptose isomerase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >TIGR00441 gmhA phosphoheptose isomerase | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PF06908 DUF1273: Protein of unknown function (DUF1273); InterPro: IPR024718 This entry represents a functionally uncharacterised domain | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13936 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK13937 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >PRK13938 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 279 | ||||
| 2vam_A | 382 | Ftsz B. Subtilis Length = 382 | 2e-35 | ||
| 4e6e_A | 314 | Crystal Structure Of A Putative Cell Division Prote | 2e-35 | ||
| 2rhh_A | 325 | Synthetic Gene Encoded Bacillus Subtilis Ftsz With | 3e-35 | ||
| 3vo8_A | 392 | Staphylococcus Aureus Ftsz Gdp-Form Length = 392 | 3e-34 | ||
| 4dxd_A | 396 | Staphylococcal Aureus Ftsz In Complex With 723 Leng | 3e-34 | ||
| 3voa_A | 308 | Staphylococcus Aureus Ftsz 12-316 Gdp-Form Length = | 7e-34 | ||
| 1rlu_A | 382 | Mycobacterium Tuberculosis Ftsz In Complex With Gtp | 2e-33 | ||
| 2q1x_A | 379 | Crystal Structure Of Cell Division Protein Ftsz Fro | 2e-33 | ||
| 3vo9_A | 308 | Staphylococcus Aureus Ftsz Apo-Form (Semet) Length | 1e-30 | ||
| 2vaw_A | 394 | Ftsz Pseudomonas Aeruginosa Gdp Length = 394 | 8e-29 | ||
| 1ofu_A | 320 | Crystal Structure Of Sula:ftsz From Pseudomonas Aer | 2e-28 | ||
| 1w5f_A | 353 | Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Leng | 1e-27 | ||
| 2r6r_1 | 338 | Aquifex Aeolicus Ftsz Length = 338 | 3e-26 | ||
| 1w5e_A | 364 | Ftsz W319y Mutant, P1 (m. Jannaschii) Length = 364 | 4e-21 | ||
| 1fsz_A | 372 | Crystal Structure Of The Cell-Division Protein Ftsz | 5e-21 | ||
| 1w58_1 | 364 | Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 | 5e-21 |
| >pdb|2VAM|A Chain A, Ftsz B. Subtilis Length = 382 | Back alignment and structure |
|
| >pdb|4E6E|A Chain A, Crystal Structure Of A Putative Cell Division Protein Ftsz (Tfu_1113) From Thermobifida Fusca Yx-Er1 At 2.22 A Resolution Length = 314 | Back alignment and structure |
| >pdb|2RHH|A Chain A, Synthetic Gene Encoded Bacillus Subtilis Ftsz With Bound Sulfate Ion Length = 325 | Back alignment and structure |
| >pdb|3VO8|A Chain A, Staphylococcus Aureus Ftsz Gdp-Form Length = 392 | Back alignment and structure |
| >pdb|4DXD|A Chain A, Staphylococcal Aureus Ftsz In Complex With 723 Length = 396 | Back alignment and structure |
| >pdb|3VOA|A Chain A, Staphylococcus Aureus Ftsz 12-316 Gdp-Form Length = 308 | Back alignment and structure |
| >pdb|1RLU|A Chain A, Mycobacterium Tuberculosis Ftsz In Complex With Gtp-Gamma-S Length = 382 | Back alignment and structure |
| >pdb|2Q1X|A Chain A, Crystal Structure Of Cell Division Protein Ftsz From Mycobacterium Tuberculosis In Complex With Citrate. Length = 379 | Back alignment and structure |
| >pdb|3VO9|A Chain A, Staphylococcus Aureus Ftsz Apo-Form (Semet) Length = 308 | Back alignment and structure |
| >pdb|2VAW|A Chain A, Ftsz Pseudomonas Aeruginosa Gdp Length = 394 | Back alignment and structure |
| >pdb|1OFU|A Chain A, Crystal Structure Of Sula:ftsz From Pseudomonas Aeruginosa Length = 320 | Back alignment and structure |
| >pdb|1W5F|A Chain A, Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Length = 353 | Back alignment and structure |
| >pdb|2R6R|1 Chain 1, Aquifex Aeolicus Ftsz Length = 338 | Back alignment and structure |
| >pdb|1W5E|A Chain A, Ftsz W319y Mutant, P1 (m. Jannaschii) Length = 364 | Back alignment and structure |
| >pdb|1FSZ|A Chain A, Crystal Structure Of The Cell-Division Protein Ftsz At 2.8a Resolution Length = 372 | Back alignment and structure |
| >pdb|1W58|1 Chain 1, Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| 1rq2_A | 382 | Cell division protein FTSZ; cell cycle, tubulin, G | 1e-103 | |
| 2vxy_A | 382 | FTSZ, cell division protein FTSZ; GTP-binding, nuc | 1e-103 | |
| 4dxd_A | 396 | Cell division protein FTSZ; rossmann fold, GTPase, | 1e-103 | |
| 1w5f_A | 353 | Cell division protein FTSZ; complete proteome, GTP | 1e-102 | |
| 2vap_A | 364 | FTSZ, cell division protein FTSZ homolog 1; polyme | 1e-101 | |
| 2r75_1 | 338 | Cell division protein FTSZ; GTPase, tubulin-like, | 1e-101 | |
| 1ofu_A | 320 | FTSZ, cell division protein FTSZ; bacterial cell d | 5e-99 | |
| 2vaw_A | 394 | FTSZ, cell division protein FTSZ; bacterial cell d | 1e-98 | |
| 4ei7_A | 389 | Plasmid replication protein REPX; GTP hydrolase, p | 3e-61 | |
| 3v3t_A | 360 | Cell division GTPase FTSZ, diverged; TUBZ, tubulin | 7e-44 | |
| 3m89_A | 427 | FTSZ/tubulin-related protein; partition, TUBZ, GTP | 9e-16 | |
| 3r4v_A | 315 | Putative uncharacterized protein; tubulin, unknown | 2e-10 |
| >1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Length = 382 | Back alignment and structure |
|---|
Score = 306 bits (785), Expect = e-103
Identities = 100/171 (58%), Positives = 126/171 (73%), Gaps = 2/171 (1%)
Query: 109 PNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGC 168
P +N A IKV+G+GGGG NAVNRMIE + GVEF +NTDAQA+ +S + +L +G
Sbjct: 6 PPHNYLAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDA--DVKLDVGR 63
Query: 169 ELTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKS 228
+ TRGLGAG +P VG AA ++K IEE + GADM+FVTAG GGGTGTG APV+A IA+
Sbjct: 64 DSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARK 123
Query: 229 MGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAVS 279
+G LTVG+ T PF FEG+RR+ QA+ G+A LR + DTLIVIPND+LL
Sbjct: 124 LGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGD 174
|
| >2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Length = 382 | Back alignment and structure |
|---|
| >4dxd_A Cell division protein FTSZ; rossmann fold, GTPase, GTP binding, cell cycle-inhibitor COM; HET: GDP 9PC; 2.01A {Staphylococcus aureus} Length = 396 | Back alignment and structure |
|---|
| >1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Length = 353 | Back alignment and structure |
|---|
| >2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Length = 364 | Back alignment and structure |
|---|
| >2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Length = 338 | Back alignment and structure |
|---|
| >1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 320 | Back alignment and structure |
|---|
| >2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 394 | Back alignment and structure |
|---|
| >4ei7_A Plasmid replication protein REPX; GTP hydrolase, plasmid segregation; HET: GDP; 1.90A {Bacillus cereus} PDB: 4ei8_A 4ei9_A* Length = 389 | Back alignment and structure |
|---|
| >3v3t_A Cell division GTPase FTSZ, diverged; TUBZ, tubulin/FTSZ related, rossmann fold, GTP bindi structural protein; 2.30A {Clostridium botulinum C} Length = 360 | Back alignment and structure |
|---|
| >3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A 2xka_A* 2xkb_A* Length = 427 | Back alignment and structure |
|---|
| >3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A* Length = 315 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| 4dxd_A | 396 | Cell division protein FTSZ; rossmann fold, GTPase, | 100.0 | |
| 2vxy_A | 382 | FTSZ, cell division protein FTSZ; GTP-binding, nuc | 100.0 | |
| 1ofu_A | 320 | FTSZ, cell division protein FTSZ; bacterial cell d | 100.0 | |
| 1w5f_A | 353 | Cell division protein FTSZ; complete proteome, GTP | 100.0 | |
| 2r75_1 | 338 | Cell division protein FTSZ; GTPase, tubulin-like, | 100.0 | |
| 2vaw_A | 394 | FTSZ, cell division protein FTSZ; bacterial cell d | 100.0 | |
| 1rq2_A | 382 | Cell division protein FTSZ; cell cycle, tubulin, G | 100.0 | |
| 2vap_A | 364 | FTSZ, cell division protein FTSZ homolog 1; polyme | 100.0 | |
| 4ei7_A | 389 | Plasmid replication protein REPX; GTP hydrolase, p | 100.0 | |
| 3v3t_A | 360 | Cell division GTPase FTSZ, diverged; TUBZ, tubulin | 100.0 | |
| 3m89_A | 427 | FTSZ/tubulin-related protein; partition, TUBZ, GTP | 100.0 | |
| 3r4v_A | 315 | Putative uncharacterized protein; tubulin, unknown | 99.98 | |
| 2btq_B | 426 | Tubulin btubb; structural protein, cytoskeletal pr | 99.95 | |
| 2bto_A | 473 | Tubulin btuba; bacterial tubulin, polymerization, | 99.94 | |
| 3cb2_A | 475 | Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m | 99.9 | |
| 3ryc_B | 445 | Tubulin beta chain; alpha-tubulin, beta-tubulin, G | 99.87 | |
| 3ryc_A | 451 | Tubulin alpha chain; alpha-tubulin, beta-tubulin, | 99.85 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.74 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.33 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 95.3 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.29 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 95.07 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 94.95 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.77 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 94.58 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 94.41 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 94.41 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 94.37 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 94.37 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 93.78 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 93.49 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 93.47 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 93.2 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 93.13 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 93.13 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.09 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 92.91 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 92.89 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 92.85 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 92.79 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 92.73 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 92.37 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 92.35 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 92.26 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 92.2 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 92.16 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 91.94 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 91.81 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 91.76 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 91.69 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 91.65 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 91.42 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 91.35 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 91.3 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 91.23 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 91.21 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 91.16 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 91.11 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 91.1 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 91.1 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 90.95 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 90.82 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 90.74 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 90.74 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 90.62 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 90.59 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 90.47 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 90.39 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 90.34 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 90.28 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 90.13 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 89.89 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 89.81 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 89.29 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 88.85 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 88.7 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 88.67 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 88.45 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 88.34 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 88.16 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 87.95 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 87.6 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 87.51 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 87.3 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 87.12 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 86.88 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 86.64 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 86.62 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 86.44 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 86.38 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 86.37 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 86.36 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 86.27 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 86.22 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 86.01 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 85.66 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 85.37 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 85.34 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 85.32 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 85.21 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 85.09 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 84.99 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 84.97 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 84.82 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 84.81 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 84.74 | |
| 3hn7_A | 524 | UDP-N-acetylmuramate-L-alanine ligase; ATP-binding | 84.64 | |
| 1up7_A | 417 | 6-phospho-beta-glucosidase; hydrolase, family4 hyd | 84.6 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 84.38 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 84.35 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 83.8 | |
| 1tk9_A | 188 | Phosphoheptose isomerase 1; lipopolysaccharide bio | 83.43 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 83.4 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 83.27 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 83.25 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 82.91 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 82.74 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 82.69 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 82.55 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 82.42 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 82.32 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 82.25 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 82.12 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 81.86 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 81.66 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 81.39 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 81.21 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 81.17 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 81.14 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 81.11 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 81.04 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 80.82 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 80.67 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 80.57 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 80.55 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 80.54 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 80.43 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 80.15 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 80.06 |
| >4dxd_A Cell division protein FTSZ; rossmann fold, GTPase, GTP binding, cell cycle-inhibitor COM; HET: GDP 9PC; 2.01A {Staphylococcus aureus} PDB: 3vo8_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-47 Score=367.62 Aligned_cols=167 Identities=63% Similarity=0.992 Sum_probs=159.4
Q ss_pred CCCCceEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHHHhcCCCCCCCeEEcCcccccCCCCCCCchhhHHHHHHH
Q 044090 111 NNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTRGLGAGGNPSVGMNAANES 190 (279)
Q Consensus 111 ~~~~~kI~VIGIGgaG~NIVd~l~~~~~~~ve~iavNTD~~~L~~s~v~a~~ri~iG~~~t~G~GaG~np~~G~eaa~e~ 190 (279)
....++|+||||||||+|+||+|++.++.+++|||+|||.|+|..++ +++||+||++.|+|+|||+||++|++++++.
T Consensus 14 ~~~~~~IkVIGVGG~G~NaVn~m~~~~~~gvefiaiNTD~qaL~~s~--a~~ki~lG~~~t~GlGAG~np~vG~eaaee~ 91 (396)
T 4dxd_A 14 FNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSK--AESKIQIGEKLTRGLGAGANPEIGKKAAEES 91 (396)
T ss_dssp ----CCEEEEEEHHHHHHHHHHHHHHCCCSEEEEEEESCHHHHHTCC--CSEEEECCHHHHTTSCCTTCHHHHHHHHHHT
T ss_pred cCCCCeEEEEEECCcHHHHHHHHHHhCCCCceEEEEECCHHHHhcCC--CccEEEcCccccCCCCCCCChHHHHHHHHHH
Confidence 35578999999999999999999999999999999999999999875 5899999999999999999999999999999
Q ss_pred HHHHHHHhcCCCEEEEEeecCCCcccCHHHHHHHHHHHcCCcEEEEEccCCCCchhHHHHHHHHHHHHHHHhCCEEEEEe
Q 044090 191 KVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIP 270 (279)
Q Consensus 191 ~e~I~~~Le~~D~vfIvAGLGGGTGSG~aPvIaeiake~gi~tvaIvtlPf~~Eg~~r~~NA~~gL~~L~e~aD~vIv~D 270 (279)
+++|++++++||+|||+||||||||||++|+|+++++++++++|+|||.||.|||.+|+|||.+++++|++++|++|+||
T Consensus 92 ~d~Ir~~le~~D~ffItagmGGGTGSGaapvIaeiake~g~LtvsVVt~Pf~~Eg~~r~yNA~lgl~~L~e~vD~vIvId 171 (396)
T 4dxd_A 92 REQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIP 171 (396)
T ss_dssp HHHHHHHHTTCSEEEEEEETTSSHHHHHHHHHHHHHHHTTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHHSSEEEEEE
T ss_pred HHHHHHHHcCCCEEEEEeccCCCccccHHHHHHHHHHhcCCceEEEEeCCccccchHHHHHHHHHHHHHHhhCCEEEEEc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chHHHhhhC
Q 044090 271 NDKLLTAVS 279 (279)
Q Consensus 271 Nd~L~~i~~ 279 (279)
||+|+++|.
T Consensus 172 NeaL~~I~~ 180 (396)
T 4dxd_A 172 NDRLLDIVD 180 (396)
T ss_dssp GGGGGGTCC
T ss_pred CHHHHHhhc
Confidence 999999973
|
| >2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* | Back alignment and structure |
|---|
| >1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 | Back alignment and structure |
|---|
| >1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 | Back alignment and structure |
|---|
| >2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* | Back alignment and structure |
|---|
| >2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 | Back alignment and structure |
|---|
| >1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* | Back alignment and structure |
|---|
| >2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* | Back alignment and structure |
|---|
| >4ei7_A Plasmid replication protein REPX; GTP hydrolase, plasmid segregation; HET: GDP; 1.90A {Bacillus cereus} PDB: 4ei8_A 4ei9_A* | Back alignment and structure |
|---|
| >3v3t_A Cell division GTPase FTSZ, diverged; TUBZ, tubulin/FTSZ related, rossmann fold, GTP bindi structural protein; 2.30A {Clostridium botulinum C} | Back alignment and structure |
|---|
| >3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A 2xka_A* 2xkb_A* | Back alignment and structure |
|---|
| >3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A* | Back alignment and structure |
|---|
| >2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} | Back alignment and structure |
|---|
| >2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* | Back alignment and structure |
|---|
| >3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* | Back alignment and structure |
|---|
| >3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... | Back alignment and structure |
|---|
| >3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* | Back alignment and structure |
|---|
| >3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 279 | ||||
| d1ofua1 | 198 | c.32.1.1 (A:11-208) Cell-division protein FtsZ {Ps | 6e-61 | |
| d1rq2a1 | 198 | c.32.1.1 (A:8-205) Cell-division protein FtsZ {Myc | 1e-55 | |
| d2vapa1 | 209 | c.32.1.1 (A:23-231) Cell-division protein FtsZ {Ar | 1e-54 | |
| d1w5fa1 | 194 | c.32.1.1 (A:22-215) Cell-division protein FtsZ {Th | 2e-50 |
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Length = 198 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tubulin nucleotide-binding domain-like superfamily: Tubulin nucleotide-binding domain-like family: Tubulin, GTPase domain domain: Cell-division protein FtsZ species: Pseudomonas aeruginosa [TaxId: 287]
Score = 189 bits (482), Expect = 6e-61
Identities = 96/164 (58%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
Query: 115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTRGL 174
A IKVIGVGGGG NAVN M ++++ GVEF NTDAQA+K LQ+G +T+GL
Sbjct: 2 AVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAA--RTVLQLGPGVTKGL 59
Query: 175 GAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTV 234
GAG NP VG AA E + I E + GADM+F+T GMGGGTGTGAAP+IA +AK MGILTV
Sbjct: 60 GAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTV 119
Query: 235 GIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKLLTAV 278
+ T PF FEGR+R A EG+ L +VD+LI IPN+KLLT +
Sbjct: 120 AVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTIL 163
|
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 209 | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Length = 194 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| d1rq2a1 | 198 | Cell-division protein FtsZ {Mycobacterium tubercul | 100.0 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 100.0 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 100.0 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 100.0 | |
| d2btoa1 | 244 | Tubulin alpha-subunit {Prosthecobacter dejongeii [ | 99.85 | |
| d1tubb1 | 243 | Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 | 99.84 | |
| d1tuba1 | 245 | Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 | 99.83 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.89 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 96.58 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 96.31 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.26 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.12 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 95.99 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.95 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 95.88 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.78 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 95.72 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 95.67 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 95.5 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 95.33 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 94.54 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 94.49 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 94.46 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 94.38 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 93.87 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 93.81 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 93.67 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 93.54 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 93.31 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 93.04 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 92.57 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 92.55 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.51 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 92.46 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.43 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 91.99 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 91.95 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 91.54 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 91.5 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 91.29 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 91.26 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 90.68 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 90.34 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 90.26 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 89.58 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 89.11 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 88.99 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 88.72 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 88.53 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 88.53 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 87.81 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 87.11 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 86.93 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 86.75 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 86.54 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 86.46 | |
| d1x94a_ | 191 | Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T | 86.09 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 86.04 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 85.95 | |
| d1tk9a_ | 188 | Phosphoheptose isomerase GmhA1 {Campylobacter jeju | 85.83 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 85.76 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 84.6 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 82.43 | |
| d1b74a1 | 105 | Glutamate racemase {Aquifex pyrophilus [TaxId: 271 | 82.36 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 82.06 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 81.7 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 81.3 |
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tubulin nucleotide-binding domain-like superfamily: Tubulin nucleotide-binding domain-like family: Tubulin, GTPase domain domain: Cell-division protein FtsZ species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00 E-value=4.5e-49 Score=346.86 Aligned_cols=162 Identities=60% Similarity=0.972 Sum_probs=152.8
Q ss_pred ceEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHHHhcCCCCCCCeEEcCcccccCCCCCCCchhhHHHHHHHHHHH
Q 044090 115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCELTRGLGAGGNPSVGMNAANESKVAI 194 (279)
Q Consensus 115 ~kI~VIGIGgaG~NIVd~l~~~~~~~ve~iavNTD~~~L~~s~v~a~~ri~iG~~~t~G~GaG~np~~G~eaa~e~~e~I 194 (279)
++|+||||||||||++|+|+++++.+++|+++|||.++|..+. +++|+++|++.|+|+|+|+||++|+++++++.++|
T Consensus 2 a~IkViGvGGaG~n~vn~~~~~~~~~v~~iainTD~~~L~~~~--~~~ki~iG~~~t~G~Gagg~p~~g~~aa~e~~~~I 79 (198)
T d1rq2a1 2 AVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSD--ADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEI 79 (198)
T ss_dssp CCEEEEEEHHHHHHHHHHHHHTTCCSEEEEEEESCHHHHHHCC--CSEEEECCTTTC-----CCCHHHHHHHHHHTHHHH
T ss_pred CeEEEEEeCchHHHHHHHHHHcCCCCceEEEEcchHHHHhcCC--cchhhccccccccCCCcCcChhhhHhhHHHHHHHH
Confidence 5899999999999999999999999999999999999999876 48999999999999999999999999999999999
Q ss_pred HHHhcCCCEEEEEeecCCCcccCHHHHHHHHHHHcCCcEEEEEccCCCCchhHHHHHHHHHHHHHHHhCCEEEEEechHH
Q 044090 195 EEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIVIPNDKL 274 (279)
Q Consensus 195 ~~~Le~~D~vfIvAGLGGGTGSG~aPvIaeiake~gi~tvaIvtlPf~~Eg~~r~~NA~~gL~~L~e~aD~vIv~DNd~L 274 (279)
+++|+++|+|||+||||||||||++|+|++++|++++++++|||+||+|||.+|..+|.++|++|++++|++|+||||+|
T Consensus 80 ~~~l~~~d~vfi~AGlGGgTGtGaaPviA~iake~g~l~v~ivt~PF~~EG~~r~~~A~~gl~~L~~~~D~~Ivi~Nd~L 159 (198)
T d1rq2a1 80 EELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRL 159 (198)
T ss_dssp HHHHTTCSEEEEEEETTSSHHHHHHHHHHHHHHHHTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHHCSEEEEEEHHHH
T ss_pred HHHhcCCCEEEEEEecCCCCCcchHHHHHHHHHHcCCcEEEEEecChHHHHHHHHHHHHHHHHHHHHhhCeEEEechhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred Hhhh
Q 044090 275 LTAV 278 (279)
Q Consensus 275 ~~i~ 278 (279)
+++.
T Consensus 160 ~~~~ 163 (198)
T d1rq2a1 160 LQMG 163 (198)
T ss_dssp TTSS
T ss_pred Hhhc
Confidence 9864
|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} | Back information, alignment and structure |
|---|
| >d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|