Citrus Sinensis ID: 044275


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKGPRVVAVAQKKPHADMLKARKAENKPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKKQLNDNGAGVSEDSWKSTSEVQSGKSSSSEINDEAEQEFSSQVSSYFMGFYCFSSRN
cccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccc
ccccccccccccHHHHHHHHHHHHccHHHHHHcccccccccccccccHHHEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHEEEccccc
MKGPRVVAVAQKKPHADMLKARKaenkpkkekagkkkdsnapkrplsaYFIFMEDFRKsfkesfpdnksvaamgkaggqkwksmseaeKAPYVQKALNKKAEYELALEAYKKQLndngagvsedswkstsevqsgksssseiNDEAEQEFSSQVSSYFMGFYCFSSRN
mkgprvvavaqkkphadmlkarkaenkpkkekagkkkdsnapkrplsAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKKQLndngagvsedswkstsevqsgksssseiNDEAEQEFSSQVSSYFMGFYCFSSRN
MKGPRVVAVAQKKPHADMLkarkaenkpkkekagkkkDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKKQLNDNGAGVSEDSWKstsevqsgkssssEINDEAEQEFSSQVSSYFMGFYCFSSRN
***********************************************AYFIFMEDFR**************************************************************************************************SYFMGFYCF****
********************************************PLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELAL************************************************SYFMGFYCFSSRN
*****************MLKARKA*****************PKRPLSAYFIFMEDFRKSFKESFPDNKSV***************EAEKAPYVQKALNKKAEYELALEAYKKQLND***********************************SQVSSYFMGFYCFSSRN
**********************************KKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKKQL********************************EQEFSSQVSSYFMGFYCFSS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGPRVVAVAQKKPHADMLKARKAENKPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYxxxxxxxxxxxxxxxxxxxxxLNDNGAGVSEDSWKSTSEVQSGKSSSSEINDEAEQEFSSQVSSYFMGFYCFSSRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
P93047141 High mobility group B pro yes no 0.625 0.744 0.594 3e-26
P40620149 HMG1/2-like protein OS=Vi N/A no 0.559 0.630 0.604 1e-24
O49596144 High mobility group B pro no no 0.565 0.659 0.593 4e-24
O49595178 High mobility group B pro no no 0.583 0.550 0.544 1e-23
P40619144 HMG1/2-like protein OS=Ip N/A no 0.702 0.819 0.457 7e-23
Q42344138 High mobility group B pro no no 0.708 0.862 0.471 4e-21
P26585152 HMG1/2-like protein OS=Gl no no 0.5 0.552 0.559 1e-20
P27347157 DNA-binding protein MNB1B N/A no 0.654 0.700 0.530 5e-20
O49597125 High mobility group B pro no no 0.553 0.744 0.468 2e-19
P40621161 HMG1/2-like protein OS=Tr N/A no 0.446 0.465 0.6 4e-18
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (73%), Gaps = 1/106 (0%)

Query: 27  KPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSE 86
           KP K   G  KD N PKRP SA+F+FMEDFR ++KE  P NKSVAA+GKAGG+KWKS+S+
Sbjct: 20  KPAKGAKGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSD 79

Query: 87  AEKAPYVQKALNKKAEYELALEAYKKQLNDNGAGVSEDSWKSTSEV 132
           +EKAPYV KA  +K EYE  ++AY K+L + G    E+S KS SEV
Sbjct: 80  SEKAPYVAKADKRKVEYEKNMKAYNKKL-EEGPKEDEESDKSVSEV 124




Binds preferentially double-stranded DNA.
Arabidopsis thaliana (taxid: 3702)
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function description
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description
>sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
255566393155 DNA-binding protein MNB1B, putative [Ric 0.672 0.729 0.638 2e-35
449468356142 PREDICTED: HMG1/2-like protein-like [Cuc 0.827 0.978 0.542 2e-33
145323962140 high mobility group B3 protein [Arabidop 0.690 0.828 0.535 1e-24
18394900141 high mobility group B3 protein [Arabidop 0.625 0.744 0.594 2e-24
8886929 662 F2D10.18 [Arabidopsis thaliana] 0.625 0.158 0.594 3e-24
297845042141 hypothetical protein ARALYDRAFT_472304 [ 0.690 0.822 0.511 4e-24
309243128139 high mobility group box 3 protein [Gossy 0.553 0.669 0.6 1e-23
224081483144 high mobility group family [Populus tric 0.559 0.652 0.618 1e-23
116778852157 unknown [Picea sitchensis] gi|116782574| 0.619 0.662 0.566 2e-23
118484838144 unknown [Populus trichocarpa] 0.559 0.652 0.608 3e-23
>gi|255566393|ref|XP_002524182.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223536551|gb|EEF38197.1| DNA-binding protein MNB1B, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/119 (63%), Positives = 98/119 (82%), Gaps = 6/119 (5%)

Query: 1   MKGPRVVAVAQKKPHADMLKARKAENKPKKEKAGKKK------DSNAPKRPLSAYFIFME 54
           MKGPR   +AQKKP + +LKARKAE+KP KE+A  +K      D++APKRP SA+FIFM+
Sbjct: 1   MKGPRNAVIAQKKPSSKVLKARKAESKPGKEEASSRKKKNVSKDTDAPKRPASAFFIFMD 60

Query: 55  DFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKKQ 113
           +FRK FKE +PDNK+V+A+GKAGG+KWKS+SE +KAPY++KAL +KAEYE  LEAYK+Q
Sbjct: 61  EFRKYFKEKYPDNKAVSAVGKAGGEKWKSLSETDKAPYLEKALKRKAEYEKVLEAYKQQ 119




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449468356|ref|XP_004151887.1| PREDICTED: HMG1/2-like protein-like [Cucumis sativus] gi|449517965|ref|XP_004166014.1| PREDICTED: HMG1/2-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|145323962|ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis thaliana] gi|332191890|gb|AEE30011.1| high mobility group B3 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18394900|ref|NP_564124.1| high mobility group B3 protein [Arabidopsis thaliana] gi|75220405|sp|P93047.1|HMGB3_ARATH RecName: Full=High mobility group B protein 3; AltName: Full=High mobility group protein B 2; Short=AtHMGbeta2; Short=HMG beta 2; AltName: Full=Nucleosome/chromatin assembly factor group D 03; Short=Nucleosome/chromatin assembly factor group D 3 gi|15724174|gb|AAL06479.1|AF411789_1 At1g20690/F2D10_15 [Arabidopsis thaliana] gi|1694976|emb|CAA70691.1| HMG1 [Arabidopsis thaliana] gi|2832361|emb|CAA74402.1| HMG protein [Arabidopsis thaliana] gi|20453325|gb|AAM19901.1| At1g20690/F2D10_15 [Arabidopsis thaliana] gi|21537072|gb|AAM61413.1| unknown [Arabidopsis thaliana] gi|22530942|gb|AAM96975.1| expressed protein [Arabidopsis thaliana] gi|23198424|gb|AAN15739.1| expressed protein [Arabidopsis thaliana] gi|332191888|gb|AEE30009.1| high mobility group B3 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8886929|gb|AAF80615.1|AC069251_8 F2D10.18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845042|ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] gi|297336244|gb|EFH66661.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|309243128|gb|ADD74180.2| high mobility group box 3 protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224081483|ref|XP_002306429.1| high mobility group family [Populus trichocarpa] gi|222855878|gb|EEE93425.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|116778852|gb|ABK21026.1| unknown [Picea sitchensis] gi|116782574|gb|ABK22556.1| unknown [Picea sitchensis] gi|116782678|gb|ABK22606.1| unknown [Picea sitchensis] gi|116782786|gb|ABK22657.1| unknown [Picea sitchensis] gi|116782898|gb|ABK22712.1| unknown [Picea sitchensis] gi|116791878|gb|ABK26144.1| unknown [Picea sitchensis] gi|148907501|gb|ABR16881.1| unknown [Picea sitchensis] gi|224284566|gb|ACN40016.1| unknown [Picea sitchensis] gi|224285212|gb|ACN40332.1| unknown [Picea sitchensis] gi|224286734|gb|ACN41070.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|118484838|gb|ABK94286.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.625 0.729 0.5 8.7e-24
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.511 0.623 0.505 5.1e-19
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.517 0.696 0.448 5.1e-19
TAIR|locus:2154433241 HMGB6 "high-mobility group box 0.613 0.427 0.428 3.3e-15
UNIPROTKB|Q32L31200 HMGB3 "High mobility group pro 0.660 0.555 0.336 3.1e-12
ZFIN|ZDB-GENE-030131-341205 hmgb1a "high-mobility group bo 0.660 0.541 0.339 3.9e-12
UNIPROTKB|F1RQ19202 LOC100517745 "Uncharacterized 0.660 0.549 0.327 6.4e-12
UNIPROTKB|E1BIU3186 LOC532409 "Uncharacterized pro 0.482 0.435 0.390 8.2e-12
MGI|MGI:1098219200 Hmgb3 "high mobility group box 0.660 0.555 0.345 1e-11
RGD|1564407200 Hmgb3 "high mobility group box 0.660 0.555 0.336 1e-11
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 273 (101.2 bits), Expect = 8.7e-24, P = 8.7e-24
 Identities = 58/116 (50%), Positives = 76/116 (65%)

Query:    38 DSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKAL 97
             D N PKRP SA+F+FMEDFR++FK+  P NKSVA +GKA G KWKS+S++EKAPYV KA 
Sbjct:    34 DPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAE 93

Query:    98 NKKAEYELALEAYKKQLNDNGAGVSEDSWKXXXXXXXXXXXXXEINDEAEQEFSSQ 153
              +K EYE  ++AY K+L + G    E+S K             E+NDE + E  S+
Sbjct:    94 KRKVEYEKNIKAYNKKLEE-GPKEDEESDKSVS----------EVNDEDDAEDGSE 138




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154433 HMGB6 "high-mobility group box 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L31 HMGB3 "High mobility group protein B3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-341 hmgb1a "high-mobility group box 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQ19 LOC100517745 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIU3 LOC532409 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1098219 Hmgb3 "high mobility group box 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564407 Hmgb3 "high mobility group box 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P93047HMGB3_ARATHNo assigned EC number0.59430.6250.7446yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 5e-17
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 7e-15
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 4e-14
smart0039870 smart00398, HMG, high mobility group 9e-13
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 1e-10
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 2e-10
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 3e-07
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 1e-05
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
 Score = 70.7 bits (174), Expect = 5e-17
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 42  PKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKA 101
           PKRPLSA+F+F ++ R   K   P  K  A + K  G+KWK++SE EK PY +KA  +KA
Sbjct: 1   PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEEKKPYEEKAEKEKA 59

Query: 102 EYELALEAYK 111
            YE A  AYK
Sbjct: 60  RYEKAYPAYK 69


Length = 69

>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
PTZ0019994 high mobility group protein; Provisional 99.91
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.82
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.81
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.8
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.79
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.79
smart0039870 HMG high mobility group. 99.78
COG5648211 NHP6B Chromatin-associated proteins containing the 99.78
KOG038196 consensus HMG box-containing protein [General func 99.75
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.72
KOG0527 331 consensus HMG-box transcription factor [Transcript 99.66
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.65
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 99.51
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 99.34
KOG0528511 consensus HMG-box transcription factor SOX5 [Trans 99.08
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.36
KOG2746 683 consensus HMG-box transcription factor Capicua and 98.31
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.15
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 97.1
COG5648211 NHP6B Chromatin-associated proteins containing the 96.71
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 94.65
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 92.9
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 91.67
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 85.58
PRK15117211 ABC transporter periplasmic binding protein MlaC; 80.69
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
Probab=99.91  E-value=3.1e-24  Score=153.45  Aligned_cols=85  Identities=42%  Similarity=0.640  Sum_probs=77.4

Q ss_pred             CcchhcccCCCCCCCCCCCCCHHHHHHHHHHHHHHHhCCCCc-cHHHHHHHHHhhhcCCChhhhhHHHHHHHHHHHHHHH
Q 044275           27 KPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNK-SVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYEL  105 (168)
Q Consensus        27 ~~kk~~kk~~kdp~~PKRP~sAy~lF~~e~r~~vk~~~p~~~-~~~ev~k~lg~~Wk~ls~~eK~~Y~~~A~~~k~~y~k  105 (168)
                      ..+++++++.+||+.||||+|||+|||.++|..|..+||+.. .+.+|+++||++|+.||+++|.+|+++|..++.+|..
T Consensus         8 ~~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~dk~rY~~   87 (94)
T PTZ00199          8 VLVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQEDKVRYEK   87 (94)
T ss_pred             ccccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHH
Confidence            334455677899999999999999999999999999999942 3899999999999999999999999999999999999


Q ss_pred             HHHHHH
Q 044275          106 ALEAYK  111 (168)
Q Consensus       106 e~~~y~  111 (168)
                      +|.+|+
T Consensus        88 e~~~Y~   93 (94)
T PTZ00199         88 EKAEYA   93 (94)
T ss_pred             HHHHHh
Confidence            999995



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 9e-09
1j3c_A79 Solution Structure Of The C-Terminal Domain Of The 3e-08
1j3d_A78 Solution Structure Of The C-Terminal Domain Of The 6e-08
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 8e-08
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 8e-08
1hme_A77 Structure Of The Hmg Box Motif In The B-Domain Of H 3e-06
2yrq_A173 Solution Structure Of The Tandem Hmg Box Domain Fro 4e-06
1nhm_A81 The Structure Of The Hmg Box And Its Interaction Wi 4e-06
2lhj_A97 Nmr Structure Of The High Mobility Group Protein-Li 4e-06
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 4e-06
1qrv_A73 Crystal Structure Of The Complex Of Hmg-D And Dna L 1e-05
1e7j_A74 Hmg-D Complexed To A Bulge Dna Length = 74 1e-05
3nm9_A73 Hmgd(M13a)-Dna Complex Length = 73 3e-05
1hma_A73 The Solution Structure And Dynamics Of The Dna Bind 4e-05
1hsm_A79 The Structure Of The Hmg Box And Its Interaction Wi 6e-05
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 1e-04
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 1e-04
1i11_A81 Solution Structure Of The Dna Binding Domain, Sox-5 1e-04
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 2e-04
1wgf_A90 Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 9e-04
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Query: 40 NAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNK 99 NAPKRP S +F+F +FR K + P S+ + K G+ W +++++EK PY+ KA Sbjct: 8 NAPKRPPSGFFLFCSEFRPKIKSTNP-GISIGDVAKKLGEMWNNLNDSEKQPYITKAAKL 66 Query: 100 KAEYELALEAYK 111 K +YE + YK Sbjct: 67 KEKYEKDVADYK 78
>pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 Back     alignment and structure
>pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 Back     alignment and structure
>pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 Back     alignment and structure
>pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 Back     alignment and structure
>pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|1QRV|A Chain A, Crystal Structure Of The Complex Of Hmg-D And Dna Length = 73 Back     alignment and structure
>pdb|1E7J|A Chain A, Hmg-D Complexed To A Bulge Dna Length = 74 Back     alignment and structure
>pdb|3NM9|A Chain A, Hmgd(M13a)-Dna Complex Length = 73 Back     alignment and structure
>pdb|1HMA|A Chain A, The Solution Structure And Dynamics Of The Dna Binding Domain Of Hmg-D From Drosophila Melanogaster Length = 73 Back     alignment and structure
>pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|1I11|A Chain A, Solution Structure Of The Dna Binding Domain, Sox-5 Hmg Box From Mouse Length = 81 Back     alignment and structure
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure
>pdb|1WGF|A Chain A, Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 4e-24
2lhj_A97 High mobility group protein homolog NHP1; structur 8e-23
1hme_A77 High mobility group protein fragment-B; DNA-bindin 1e-22
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 6e-22
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 2e-21
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 2e-21
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 5e-20
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 7e-20
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 1e-18
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 2e-18
1wgf_A90 Upstream binding factor 1; transcription factor, D 4e-18
1ckt_A71 High mobility group 1 protein; high-mobility group 5e-17
2yrq_A173 High mobility group protein B1; HMG box domain, DN 6e-17
2yrq_A173 High mobility group protein B1; HMG box domain, DN 1e-12
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 3e-16
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 9e-15
3tq6_A214 Transcription factor A, mitochondrial; transcripti 7e-14
3tq6_A214 Transcription factor A, mitochondrial; transcripti 5e-10
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 7e-13
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 9e-13
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 1e-12
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 6e-10
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 2e-11
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 6e-10
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 2e-09
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 2e-09
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 4e-09
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 2e-08
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 2e-08
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 9e-08
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 9e-08
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 1e-07
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 3e-07
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 3e-07
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 7e-07
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 8e-07
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 4e-24
 Identities = 38/92 (41%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 23  KAENKPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWK 82
               +PKK    KKKD NAPKR LSAY  F  + R   +   PD  +   +GK  G+KWK
Sbjct: 2   VTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPD-ITFGQVGKKLGEKWK 60

Query: 83  SMSEAEKAPYVQKALNKKAEYELALEAYKKQL 114
           +++  EK PY  KA   K  YE   E Y   L
Sbjct: 61  ALTPEEKQPYEAKAQADKKRYESEKELYNATL 92


>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.92
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.91
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.91
2lhj_A97 High mobility group protein homolog NHP1; structur 99.9
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.9
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.9
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.9
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.9
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.89
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.89
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.88
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.88
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.88
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.87
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.87
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.86
1ckt_A71 High mobility group 1 protein; high-mobility group 99.86
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.86
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.86
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.86
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.85
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.85
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.85
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.85
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.85
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.85
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.84
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.84
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.84
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.82
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.82
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.8
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.79
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.78
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.77
2cto_A93 Novel protein; high mobility group box domain, hel 99.77
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.76
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.76
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.68
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.92  E-value=5.7e-25  Score=157.99  Aligned_cols=86  Identities=31%  Similarity=0.532  Sum_probs=81.3

Q ss_pred             ccCCCCCCCCCCCCCHHHHHHHHHHHHHHHhCCCCccHHHHHHHHHhhhcCCChhhhhHHHHHHHHHHHHHHHHHHHHHh
Q 044275           33 AGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELALEAYKK  112 (168)
Q Consensus        33 kk~~kdp~~PKRP~sAy~lF~~e~r~~vk~~~p~~~~~~ev~k~lg~~Wk~ls~~eK~~Y~~~A~~~k~~y~ke~~~y~~  112 (168)
                      +++.+||++||||+|||||||+++|..|+.+||+ +++.+|+++||++|++|++++|++|+++|..++++|..+|..|+.
T Consensus         9 kk~~kdp~~pKrP~say~lF~~~~r~~i~~~~P~-~~~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~~Y~~   87 (102)
T 2co9_A            9 KKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPN-ATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRA   87 (102)
T ss_dssp             CSSCCCCCSCCCCCCHHHHTHHHHHHHHHHHCTT-SCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5567899999999999999999999999999999 799999999999999999999999999999999999999999999


Q ss_pred             hcCCCCC
Q 044275          113 QLNDNGA  119 (168)
Q Consensus       113 k~~~~~~  119 (168)
                      ++.....
T Consensus        88 ~~~~~~~   94 (102)
T 2co9_A           88 SLVSKSY   94 (102)
T ss_dssp             HHTSSCC
T ss_pred             hcccccc
Confidence            9877433



>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 5e-18
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-15
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-14
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 4e-13
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 7e-13
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-12
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-12
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 7e-12
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 9e-12
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 4e-11
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 1e-10
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 8e-10
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 72.2 bits (177), Expect = 5e-18
 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 27  KPKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSE 86
           +PKK    KKKD NAPKR LSAY  F  + R   +   PD  +   +GK  G+KWK+++ 
Sbjct: 6   EPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPD-ITFGQVGKKLGEKWKALTP 64

Query: 87  AEKAPYVQKALNKKAEYELALEAYKKQL 114
            EK PY  KA   K  YE   E Y   L
Sbjct: 65  EEKQPYEAKAQADKKRYESEKELYNATL 92


>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.91
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.89
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.88
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.85
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.84
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.83
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.82
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.81
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.79
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 97.06
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91  E-value=2.1e-24  Score=151.07  Aligned_cols=87  Identities=44%  Similarity=0.695  Sum_probs=80.8

Q ss_pred             cchhcccCCCCCCCCCCCCCHHHHHHHHHHHHHHHhCCCCccHHHHHHHHHhhhcCCChhhhhHHHHHHHHHHHHHHHHH
Q 044275           28 PKKEKAGKKKDSNAPKRPLSAYFIFMEDFRKSFKESFPDNKSVAAMGKAGGQKWKSMSEAEKAPYVQKALNKKAEYELAL  107 (168)
Q Consensus        28 ~kk~~kk~~kdp~~PKRP~sAy~lF~~e~r~~vk~~~p~~~~~~ev~k~lg~~Wk~ls~~eK~~Y~~~A~~~k~~y~ke~  107 (168)
                      .+++++++.++|++||||+|||+|||.++|..|+.+||+ .++.+|++.||.+|++||+++|.+|+.+|..++.+|..+|
T Consensus         7 ~~k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~-~~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~   85 (93)
T d1lwma_           7 PKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPD-ITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEK   85 (93)
T ss_dssp             TTSCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTT-SCHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCC-CcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            344456677899999999999999999999999999999 7999999999999999999999999999999999999999


Q ss_pred             HHHHhhcC
Q 044275          108 EAYKKQLN  115 (168)
Q Consensus       108 ~~y~~k~~  115 (168)
                      ..|+.+++
T Consensus        86 ~~y~~~l~   93 (93)
T d1lwma_          86 ELYNATLA   93 (93)
T ss_dssp             HHHHHHHC
T ss_pred             HHHHhccC
Confidence            99998763



>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure