Citrus Sinensis ID: 044343
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| 168023762 | 1015 | predicted protein [Physcomitrella patens | 0.527 | 0.104 | 0.504 | 3e-23 | |
| 356575289 | 633 | PREDICTED: transcription factor PIF3-lik | 0.447 | 0.142 | 0.505 | 2e-21 | |
| 356534971 | 665 | PREDICTED: transcription factor PIF3-lik | 0.562 | 0.169 | 0.434 | 7e-21 | |
| 238015240 | 435 | unknown [Zea mays] | 0.592 | 0.273 | 0.436 | 1e-20 | |
| 238008194 | 638 | unknown [Zea mays] gi|413946840|gb|AFW79 | 0.572 | 0.180 | 0.442 | 2e-20 | |
| 56784181 | 565 | putative BP-5 protein [Oryza sativa Japo | 0.547 | 0.194 | 0.445 | 2e-20 | |
| 297606720 | 447 | Os07g0143200 [Oryza sativa Japonica Grou | 0.502 | 0.225 | 0.435 | 3e-20 | |
| 297596562 | 637 | Os01g0286100 [Oryza sativa Japonica Grou | 0.547 | 0.172 | 0.445 | 3e-20 | |
| 23495742 | 417 | transcription factor BHLH9-like protein | 0.502 | 0.242 | 0.435 | 3e-20 | |
| 222618221 | 705 | hypothetical protein OsJ_01348 [Oryza sa | 0.547 | 0.156 | 0.445 | 3e-20 |
| >gi|168023762|ref|XP_001764406.1| predicted protein [Physcomitrella patens subsp. patens] gi|162684270|gb|EDQ70673.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
Score = 114 bits (284), Expect = 3e-23, Method: Compositional matrix adjust.
Identities = 55/109 (50%), Positives = 82/109 (75%), Gaps = 3/109 (2%)
Query: 71 KRTHSAEVHNQSERRRRDRINKRLKSLKELVPNCNKSDRASVLDDAVNYVKALRHQLEMM 130
KR+ +AEVHNQSERRRRDRIN+++++L+EL+PN NK+D+AS+LD+A++Y+K L+ QL+MM
Sbjct: 731 KRSRAAEVHNQSERRRRDRINEKMRALQELIPNSNKTDKASMLDEAIDYLKILQLQLQMM 790
Query: 131 SAQGGAIFQSPFMSPSGHQSTEVPQISPNVPISPKLGMGS-GIGTGMVD 178
S + G P + P G Q ++PQ+ P V P +GM G+G GM++
Sbjct: 791 SIRTGMTL-PPMVMPPGLQHMQMPQM-PQVAAMPSMGMVQMGLGMGMME 837
|
Source: Physcomitrella patens subsp. patens Species: Physcomitrella patens Genus: Physcomitrella Family: Funariaceae Order: Funariales Class: Bryopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356575289|ref|XP_003555774.1| PREDICTED: transcription factor PIF3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356534971|ref|XP_003536024.1| PREDICTED: transcription factor PIF3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|238015240|gb|ACR38655.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|238008194|gb|ACR35132.1| unknown [Zea mays] gi|413946840|gb|AFW79489.1| putative HLH DNA-binding domain superfamily protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|56784181|dbj|BAD81566.1| putative BP-5 protein [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|297606720|ref|NP_001058876.2| Os07g0143200 [Oryza sativa Japonica Group] gi|255677508|dbj|BAF20790.2| Os07g0143200 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|297596562|ref|NP_001042775.2| Os01g0286100 [Oryza sativa Japonica Group] gi|215717101|dbj|BAG95464.1| unnamed protein product [Oryza sativa Japonica Group] gi|255673123|dbj|BAF04689.2| Os01g0286100 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|23495742|dbj|BAC19953.1| transcription factor BHLH9-like protein [Oryza sativa Japonica Group] gi|24059945|dbj|BAC21408.1| transcription factor BHLH9-like protein [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|222618221|gb|EEE54353.1| hypothetical protein OsJ_01348 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| UNIPROTKB|Q5NAE0 | 565 | P0498A12.33 "Putative BP-5 pro | 0.636 | 0.226 | 0.397 | 1.2e-19 | |
| TAIR|locus:2012345 | 524 | PIF3 "AT1G09530" [Arabidopsis | 0.835 | 0.320 | 0.337 | 8.5e-17 | |
| UNIPROTKB|Q8GRJ1 | 417 | OJ1343_B12.103 "Transcription | 0.442 | 0.213 | 0.432 | 4.5e-16 | |
| TAIR|locus:2053733 | 430 | PIF4 "AT2G43010" [Arabidopsis | 0.761 | 0.355 | 0.345 | 1e-15 | |
| UNIPROTKB|Q7FA23 | 181 | OSJNBa0058K23.6 "Os04g0618600 | 0.517 | 0.574 | 0.405 | 5.4e-15 | |
| TAIR|locus:2061634 | 478 | PIL5 "phytochrome interacting | 0.567 | 0.238 | 0.391 | 6.2e-15 | |
| UNIPROTKB|Q948F6 | 298 | OSJNBa0049O12.18 "Putative SPA | 0.487 | 0.328 | 0.393 | 8.5e-15 | |
| TAIR|locus:2041369 | 416 | PIL1 "phytochrome interacting | 0.537 | 0.259 | 0.383 | 9.4e-15 | |
| TAIR|locus:2126876 | 399 | UNE10 "AT4G00050" [Arabidopsis | 0.681 | 0.343 | 0.346 | 1.1e-14 | |
| TAIR|locus:2077680 | 444 | PIL6 "AT3G59060" [Arabidopsis | 0.731 | 0.331 | 0.318 | 3e-14 |
| UNIPROTKB|Q5NAE0 P0498A12.33 "Putative BP-5 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 242 (90.2 bits), Expect = 1.2e-19, P = 1.2e-19
Identities = 56/141 (39%), Positives = 85/141 (60%)
Query: 40 QTSHSLDTDVDDFSDATEISEGMERKPDNRP-KRTHSAEVHNQSEXXXXXXINKRLKSLK 98
+ S S D D+DD G+ RK R KR+ +AEVHN SE IN+++++L+
Sbjct: 284 ECSASQDDDLDD-------EPGVLRKSGTRSTKRSRTAEVHNLSERRRRDRINEKMRALQ 336
Query: 99 ELVPNCNKSDRASVLDDAVNYVKALRHQLEMMSAQGGAIFQSPFMSPSGHQSTEVPQISP 158
EL+PNCNK D+AS+LD+A+ Y+K L+ Q++MMS G + P + P+ Q ++P ++
Sbjct: 337 ELIPNCNKIDKASMLDEAIEYLKTLQLQVQMMS-MGTGLCIPPMLLPTAMQHLQIPPMAH 395
Query: 159 NVPISPKLGMGSGIGTGMVDV 179
P LGMG G G G+ D+
Sbjct: 396 ----FPHLGMGLGYGMGVFDM 412
|
|
| TAIR|locus:2012345 PIF3 "AT1G09530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8GRJ1 OJ1343_B12.103 "Transcription factor BHLH9-like protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053733 PIF4 "AT2G43010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7FA23 OSJNBa0058K23.6 "Os04g0618600 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061634 PIL5 "phytochrome interacting factor 3-like 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q948F6 OSJNBa0049O12.18 "Putative SPATULA" [Oryza sativa (taxid:4530)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041369 PIL1 "phytochrome interacting factor 3-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126876 UNE10 "AT4G00050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077680 PIL6 "AT3G59060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 1e-14 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 2e-14 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 2e-13 |
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Score = 65.3 bits (160), Expect = 1e-14
Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
Query: 80 NQSERRRRDRINKRLKSLKELVPNCN---KSDRASVLDDAVNYVKALRHQLE 128
N ERRRR +IN+ L+ L+P K +A +L A+ Y+K+L+ +L+
Sbjct: 1 NARERRRRRKINEAFDELRSLLPTLPKNKKLSKAEILRLAIEYIKSLQEELQ 52
|
Length = 53 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.59 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.57 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.5 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 99.45 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 99.41 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 99.28 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 99.15 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.83 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 98.63 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 98.53 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 98.34 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 98.3 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 98.17 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 97.71 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 96.79 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 95.8 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 95.03 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 95.02 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 92.31 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 91.35 |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
Probab=99.59 E-value=2.2e-15 Score=101.45 Aligned_cols=49 Identities=49% Similarity=0.899 Sum_probs=46.6
Q ss_pred hhhhhHHHHHHHHHHHHHHHHHHhhcCCC-----CCcchHhHHHHHHHHHHHHH
Q 044343 76 AEVHNQSERRRRDRINKRLKSLKELVPNC-----NKSDRASVLDDAVNYVKALR 124 (201)
Q Consensus 76 ~~~H~~~ER~RR~~in~~~~~Lr~lvP~~-----~K~dKasiL~~AI~YIk~Lq 124 (201)
|..|+..||+||++||++|.+|+.+||.+ .|++|++||+.||+||++||
T Consensus 2 R~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq 55 (55)
T PF00010_consen 2 RQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ 55 (55)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred CchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence 67899999999999999999999999987 38999999999999999997
|
; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B .... |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 5e-18 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 1e-14 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 5e-14 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 6e-14 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 1e-13 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 4e-10 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 5e-08 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 5e-08 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 1e-07 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 2e-04 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 4e-04 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Score = 74.0 bits (182), Expect = 5e-18
Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
Query: 71 KRTHSAEVHNQSERRRRDRINKRLKSLKELVPNCN-KSDRASVLDDAVNYVKALRHQLEM 129
R HN E+R R IN ++ LK+LV K ++++VL A++Y++ L+H +
Sbjct: 2 SRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQK 61
Query: 130 MSAQ 133
+ +
Sbjct: 62 LKQE 65
|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.75 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.72 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.69 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.68 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.67 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.67 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.66 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.65 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.62 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.61 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.6 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.48 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.43 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.38 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.37 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 99.08 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 99.04 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.69 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.75 E-value=1.6e-18 Score=125.64 Aligned_cols=63 Identities=29% Similarity=0.488 Sum_probs=58.3
Q ss_pred ccchhhhhHHHHHHHHHHHHHHHHHHhhcCCC-CCcchHhHHHHHHHHHHHHHHHHHHHhhccC
Q 044343 73 THSAEVHNQSERRRRDRINKRLKSLKELVPNC-NKSDRASVLDDAVNYVKALRHQLEMMSAQGG 135 (201)
Q Consensus 73 ~~~~~~H~~~ER~RR~~in~~~~~Lr~lvP~~-~K~dKasiL~~AI~YIk~Lq~~v~~l~~~~~ 135 (201)
..++..|+.+||+||++||++|.+|+.+||++ .|++|++||.+||+||++||.+++.|+.++.
T Consensus 4 ~~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~ 67 (82)
T 1am9_A 4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENL 67 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34678999999999999999999999999998 6999999999999999999999999987653
|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 201 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 6e-16 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 2e-15 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 1e-14 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 1e-14 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 4e-14 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 8e-14 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 1e-13 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 2e-13 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.6 bits (165), Expect = 6e-16
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 6/65 (9%)
Query: 71 KRTHSAEVHNQSERRRRDRINKRLKSLKELVPNCN--KSDRASVLDDAVNYVKALRHQLE 128
KR H HN ER+RRD I SL++ VP+ K+ RA +LD A Y++ +R +
Sbjct: 2 KRAH----HNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH 57
Query: 129 MMSAQ 133
Sbjct: 58 THQQD 62
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.67 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.67 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.62 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69 E-value=1.2e-17 Score=118.50 Aligned_cols=61 Identities=30% Similarity=0.540 Sum_probs=56.6
Q ss_pred cchhhhhHHHHHHHHHHHHHHHHHHhhcCCCC-CcchHhHHHHHHHHHHHHHHHHHHHhhcc
Q 044343 74 HSAEVHNQSERRRRDRINKRLKSLKELVPNCN-KSDRASVLDDAVNYVKALRHQLEMMSAQG 134 (201)
Q Consensus 74 ~~~~~H~~~ER~RR~~in~~~~~Lr~lvP~~~-K~dKasiL~~AI~YIk~Lq~~v~~l~~~~ 134 (201)
.+|..|+.+||+||++||++|.+|+.|||++. |++|++||..||+||++|+.+++.|..++
T Consensus 5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~ 66 (80)
T d1am9a_ 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQEN 66 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 35778999999999999999999999999865 99999999999999999999999998765
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|