Citrus Sinensis ID: 045360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MENCTVNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETKLECKKKELERTQSSIKELLSFRRRVRRRENEVESIERELDSMKKKQKKYSDDIGMKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcc
cccHEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccEcEEEEcHHHHHHHHHHHHccccccHHHHHHHHHHc
MENCTVNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETKLECKKKELERTQSSIKELLSFRRRVRRRENEVESIERELDSMKKKQKKYSDDIGMKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIkrardpaslvldamsgfypphsserdvEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
MENCTVNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDlgkkslekqsndvdmKIMLLDQRAKeieskesdlvLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELkekklgevqrLVEErekqialkdskissiQSMIEEYEEELKAKEKSYDEVkkslrlcetkleckkkelertqssikellsfrrrvrrrenevesiereldsmkkkqkkysddigmkerEYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREfqvkkeelssikseivecSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKgledrfqdlevkerlfekrvkdfeirekefdsirktvegqgknlelqVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLltvapeinaqvRDEALKVA
MENCTVNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQkkmellknllekCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIeeyeeelkakekSYDEVKKSlrlcetkleckkkelertQSSIKELLSFrrrvrrrenevesiereLDSMKKKQKKYSDDIGMKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRnlqlllnqhlqKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
**************************DIAHEQANSVLKFTVQWKDLEKHFDL***************IML*************DLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELK******************************************************************************************************************************************LLKIFKKSI*******************EIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIR**********************************RNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINA**********
************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************AM******************LIRRSCILLLEHLLTV*******VRDEALKV*
MENCTVNISEELRA********RRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETKLECKKKELERTQSSIKELLSFRRRV*************************DDIGMKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
*ENCTVNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKMELLKNLLEKCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETKLECKKKELERTQSSIKELLSFRRRVRRRENEVESIERELDSMKKKQKKYSDDIGMKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENCTVNISEExxxxxxxxxxxxxxxxxxxxxANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVDMKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRLCETKLECKKKELERTQSSIKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKIFKKSxxxxxxxxxxxxxxxxxxxxxIVECSDEVELKRNELNLIQHASNKLQFDLIQTMEIGYLRELKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLELQVKIEEQENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
449524874 888 PREDICTED: uncharacterized LOC101218416, 0.965 0.591 0.277 5e-43
449466953 1145 PREDICTED: uncharacterized protein LOC10 0.965 0.458 0.277 7e-43
224130844 1006 predicted protein [Populus trichocarpa] 0.818 0.442 0.305 1e-42
147767145 1701 hypothetical protein VITISV_031269 [Viti 0.312 0.099 0.372 5e-22
255542460 716 Protein FRIGIDA, putative [Ricinus commu 0.540 0.410 0.303 3e-20
356541044 885 PREDICTED: uncharacterized protein LOC10 0.770 0.473 0.250 2e-18
297813019 1191 predicted protein [Arabidopsis lyrata su 0.799 0.365 0.267 5e-18
224130848 954 predicted protein [Populus trichocarpa] 0.610 0.348 0.302 4e-17
356544329 1117 PREDICTED: uncharacterized protein LOC10 0.867 0.422 0.274 5e-17
224130856 1033 predicted protein [Populus trichocarpa] 0.226 0.119 0.391 3e-16
>gi|449524874|ref|XP_004169446.1| PREDICTED: uncharacterized LOC101218416, partial [Cucumis sativus] Back     alignment and taxonomy information
 Score =  182 bits (461), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 179/644 (27%), Positives = 315/644 (48%), Gaps = 119/644 (18%)

Query: 6   VNISEELRAAESKKQALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGKKSLEKQSNDVD 65
           + ++  ++ +E K+  L ++ +  H +A+S L F++QWKDLE HF+  ++ +  Q  +V+
Sbjct: 5   LGVASNMKLSEWKQSNLCKAHEQLHSEASSFLLFSLQWKDLETHFESTREMILTQCEEVE 64

Query: 66  MKIMLLDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDC------- 118
                  +R K I  KE  LV +E+ I EC+ E+  ++ EL  + ++I +CD        
Sbjct: 65  -------RREKAIALKEEKLVDLEKCILECSKEVELRKNELSELNRLIVKCDSAVKGKEM 117

Query: 119 ELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQKKME----LLKNLLEKCCDEIEL 174
           EL+L    L +LS  + +K +EL      +++ + + ++ E    +++  ++ C   +EL
Sbjct: 118 ELELMHERLGVLSKDIKMKEDELCRACRRLSDLEKEFEEKEKDFEMVRERIDDCEHAMEL 177

Query: 175 KEKKLGEVQRLVEEREKQIALKDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETK 234
           KE+KL  V +L+EER  +  LK+  + SI++++  +EEEL  KEK +D ++ +++    +
Sbjct: 178 KEQKLNGVMQLIEERLMECELKEKSVESIRALLRNHEEELAIKEKQFDAIQMAIKDSNGE 237

Query: 235 LECKKKELERTQSSI------KELLSFRRRVRRRENEVESIERELDSMKKKQKKYSDDIG 288
           L+ K+KELE  Q+ I      K L    + ++ R  E++  E+E D M  K    S+D+ 
Sbjct: 238 LKLKEKELETIQNMIATKWKEKRLDKIEKTIKVRTEELDLKEQEFDVMWSKLGALSEDLL 297

Query: 289 MKEREYNGLKKEVEDLSQELASKDKLLKIFKKSIEECSREFQVKKEELSSIKSEIVECSD 348
            KE E   +K  +++ S+EL  ++K L   ++SI +C     +    +S+I+  I+ECS 
Sbjct: 298 SKESELESIKSCIKEHSKELDVQEKQLDGTQQSIRDCQNAVMMLTNYVSTIEKAIIECSK 357

Query: 349 EVELKRNELNLI----------------QHASNKLQFDLIQTMEIGYLRELKEKEKLFDS 392
           E EL+ N  + +                QH S  L  D         L  LK +++ F++
Sbjct: 358 EWELEENHHHSLKETVDGNSNDFSSVVEQHGSISLTVD-------KCLEGLKSQKEHFNA 410

Query: 393 LKKGLEDRFQDLEVKERLFEKRVKDF---------------------------------- 418
           L+K +E+R + LE  E  F++R+++                                   
Sbjct: 411 LRKFIEERSKYLENVENNFKRRMEELNKKDEKVSLYLKEIESLKADMDSQILLLEKDREE 470

Query: 419 ---------------EIREKEFDSIRKTVE---------GQGKNLELQVKIEE------- 447
                          E +EKE + +R  ++             NL LQVK EE       
Sbjct: 471 LRLKEIQHKAPDEELESKEKEINLVRALIQKCNEKVKLIDDPNNLHLQVKTEESGCKPAG 530

Query: 448 -------QENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPP 500
                         G+ L  LL +HL+ HDL+ +++  T+K + DPA LVLDAM  FYP 
Sbjct: 531 SSNTLHFPTGSALDGKLLLALLCEHLKLHDLVRAELMITLKASSDPAKLVLDAMRWFYPT 590

Query: 501 HSSERDVEFQVGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA 544
           H+  +D +     ++R CI L E LL  +P+I   +++EAL++A
Sbjct: 591 HTESKDAKIDFYNVKRGCIFLSELLLNFSPKITPPLKEEALRLA 634

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449466953|ref|XP_004151190.1| PREDICTED: uncharacterized protein LOC101218416 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224130844|ref|XP_002328390.1| predicted protein [Populus trichocarpa] gi|222838105|gb|EEE76470.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147767145|emb|CAN75646.1| hypothetical protein VITISV_031269 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542460|ref|XP_002512293.1| Protein FRIGIDA, putative [Ricinus communis] gi|223548254|gb|EEF49745.1| Protein FRIGIDA, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356541044|ref|XP_003538993.1| PREDICTED: uncharacterized protein LOC100783311 [Glycine max] Back     alignment and taxonomy information
>gi|297813019|ref|XP_002874393.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320230|gb|EFH50652.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224130848|ref|XP_002328391.1| predicted protein [Populus trichocarpa] gi|222838106|gb|EEE76471.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544329|ref|XP_003540605.1| PREDICTED: uncharacterized protein LOC100782802 [Glycine max] Back     alignment and taxonomy information
>gi|224130856|ref|XP_002328393.1| predicted protein [Populus trichocarpa] gi|222838108|gb|EEE76473.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query544
TAIR|locus:2181241 1181 AT5G27220 "AT5G27220" [Arabido 0.687 0.316 0.25 3.9e-15
TAIR|locus:2082214269 AT3G12190 "AT3G12190" [Arabido 0.329 0.665 0.291 5.9e-14
TAIR|locus:2181251 948 AT5G27230 [Arabidopsis thalian 0.191 0.109 0.298 3.9e-13
DICTYBASE|DDB_G0290503 1492 DDB_G0290503 [Dictyostelium di 0.779 0.284 0.230 1.2e-10
DICTYBASE|DDB_G02869851024 zipA "zipper-like domain-conta 0.790 0.419 0.200 4.3e-10
UNIPROTKB|G3MX17 1712 G3MX17 "Uncharacterized protei 0.580 0.184 0.212 1.4e-08
UNIPROTKB|G3MYT9 1752 G3MYT9 "Uncharacterized protei 0.580 0.180 0.212 9.4e-09
DICTYBASE|DDB_G0274893 915 DDB_G0274893 "unknown" [Dictyo 0.323 0.192 0.2 0.00099
RGD|13101671411 Eea1 "early endosome antigen 1 0.295 0.114 0.277 1.1e-08
UNIPROTKB|E1BAT8 1788 KIF20B "Uncharacterized protei 0.409 0.124 0.228 1.3e-08
TAIR|locus:2181241 AT5G27220 "AT5G27220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 230 (86.0 bits), Expect = 3.9e-15, Sum P(2) = 3.9e-15
 Identities = 106/424 (25%), Positives = 176/424 (41%)

Query:    47 EKHFDLGKKSLEKQSNDVDMKIMLLDQ----RAK---EIESKESDLVLVEERIKECNFEL 99
             EK  D  K  LEK   DV+ +   L +    R K   EIE K  DL LV ++I EC  E 
Sbjct:   227 EKQLDQMKIDLEKYCVDVNAEKKNLGRTQTHRRKLEEEIERKTKDLTLVMDKIAEC--EK 284

Query:   100 ACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREELSLVQESVNNCQVDQXXXX 159
               +++ L L+ K  GE    ++LK  +L  + + L+  R E+++V E +   Q       
Sbjct:   285 LFERRSLELI-KTQGE----VELKGKQLEQMDIDLERHRGEVNVVMEHLEKSQT------ 333

Query:   160 XXXXXXXXCCDEIELKEKKLGEVQRLVEEREKQIALKDSKISSIQSMIXXXXXXXXXXXX 219
                       +EIE K K+L  V     E  K I L + +++  Q ++            
Sbjct:   334 ----RSRELAEEIERKRKELTAVLDKTAEYGKTIELVEEELALQQKLLDIRSSELVSKKK 389

Query:   220 SYDEVKKSXXXXXXXXXXXXXXXXXXQSSIKELLSFXXXXXXXXXXXXXXXXXLDSMKKK 279
               D +                     +S  KEL                     +S+K  
Sbjct:   390 ELDGLSLDLELVNSLNNELKETVQRIESKGKELEDMERLIQERSGHN-------ESIKLL 442

Query:   280 QKKYSDDIGMKEREYNGLKKEVEDLSQELASKDKLLKIF--------------KKSIEEC 325
              +++S+++ +KE  +N + + V  LS E+ SK+K ++                +K +EE 
Sbjct:   443 LEEHSEELAIKEERHNEIAEAVRKLSLEIVSKEKTIQQLSEKQHSKQTKLDSTEKCLEET 502

Query:   326 SREFQVKKEELSSIKSEIVECSDEVELKRNELNLIQHASNKLQFDL--IQTME--IGYLR 381
             + E   K+ EL S+K    EC    E+K  EL   Q    K+Q  L   Q+ E  +  L+
Sbjct:   503 TAELVSKENELCSVKDTYRECLQNWEIKEKELKSFQEEVKKIQDSLKDFQSKEAELVKLK 562

Query:   382 E-LKEKEKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFEIREKEFDSIRKTVEGQGKNLE 440
             E L E EK     KK +  R + +E+K++  + R +  + ++++  S  + +    K  E
Sbjct:   563 ESLTEHEKELGLKKKQIHVRSEKIELKDKKLDAREERLDKKDEQLKSAEQKLAKCVKEYE 622

Query:   441 LQVK 444
             L  K
Sbjct:   623 LNAK 626
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2082214 AT3G12190 "AT3G12190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181251 AT5G27230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290503 DDB_G0290503 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G3MX17 G3MX17 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYT9 G3MYT9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274893 DDB_G0274893 "unknown" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1310167 Eea1 "early endosome antigen 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAT8 KIF20B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
pfam07899 293 pfam07899, Frigida, Frigida-like protein 1e-14
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-12
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-09
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 2e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-08
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-07
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 3e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.003
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 0.003
pfam13166713 pfam13166, AAA_13, AAA domain 0.004
pfam05667536 pfam05667, DUF812, Protein of unknown function (DU 0.004
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.004
>gnl|CDD|219629 pfam07899, Frigida, Frigida-like protein Back     alignment and domain information 
 Score = 74.3 bits (183), Expect = 1e-14
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 451 LTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQ 510
                R L   + ++ ++   +  ++   ++ A DPA LVLDA+ GFYPP  S+   E +
Sbjct: 20  EKMDSRGLLKFVIENRKELASLREEVPAALRCAPDPAKLVLDAIEGFYPPD-SKGGKEDK 78

Query: 511 VGLIRRSCILLLEHLLTVAPEINAQVRDEALKVA 544
           +  +RRSC+LLLE L+ V P I+  V++EA K+A
Sbjct: 79  MVDVRRSCVLLLEQLVRVNPPISPDVKEEAKKLA 112

This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time. Length = 293
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 544
PF07899 290 Frigida: Frigida-like protein; InterPro: IPR012474 99.94
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.24
PRK02224 880 chromosome segregation protein; Provisional 99.15
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.06
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.04
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.91
PRK01156895 chromosome segregation protein; Provisional 98.89
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.87
PRK03918880 chromosome segregation protein; Provisional 98.84
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 98.8
PRK03918 880 chromosome segregation protein; Provisional 98.79
PRK01156895 chromosome segregation protein; Provisional 98.78
COG11961163 Smc Chromosome segregation ATPases [Cell division 98.75
COG11961163 Smc Chromosome segregation ATPases [Cell division 98.72
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.67
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 98.67
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.65
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.54
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.52
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 98.22
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.14
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 98.06
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 97.99
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.9
KOG09331174 consensus Structural maintenance of chromosome pro 97.87
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.73
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.72
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.67
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.67
PHA02562562 46 endonuclease subunit; Provisional 97.63
PHA02562562 46 endonuclease subunit; Provisional 97.62
KOG0933 1174 consensus Structural maintenance of chromosome pro 97.61
KOG00181141 consensus Structural maintenance of chromosome pro 97.58
PF00038312 Filament: Intermediate filament protein; InterPro: 97.52
PRK11637428 AmiB activator; Provisional 97.51
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.42
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 97.4
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.39
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.3
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.27
PRK11637428 AmiB activator; Provisional 97.19
PRK04778569 septation ring formation regulator EzrA; Provision 97.19
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.16
PF00038312 Filament: Intermediate filament protein; InterPro: 97.09
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 97.07
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 96.97
KOG0018 1141 consensus Structural maintenance of chromosome pro 96.95
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.94
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.76
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.72
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.62
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.58
PRK04863 1486 mukB cell division protein MukB; Provisional 96.55
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.46
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.45
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 96.38
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.33
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.29
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 96.26
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.22
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 96.22
PRK04863 1486 mukB cell division protein MukB; Provisional 96.17
KOG09641200 consensus Structural maintenance of chromosome pro 96.12
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.04
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.03
KOG0977546 consensus Nuclear envelope protein lamin, intermed 95.97
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.97
PRK09039343 hypothetical protein; Validated 95.95
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 95.94
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.8
COG4372499 Uncharacterized protein conserved in bacteria with 95.77
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 95.68
PRK04778569 septation ring formation regulator EzrA; Provision 95.48
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 95.32
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.0
PRK09039343 hypothetical protein; Validated 94.91
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.87
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 94.86
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.86
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 94.85
KOG0963629 consensus Transcription factor/CCAAT displacement 94.74
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.63
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 94.62
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 94.6
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.52
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 94.51
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.36
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.26
PF05010207 TACC: Transforming acidic coiled-coil-containing p 94.18
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.16
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 94.06
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.76
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 93.59
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.5
PF05911769 DUF869: Plant protein of unknown function (DUF869) 92.93
KOG1003205 consensus Actin filament-coating protein tropomyos 92.77
COG3883265 Uncharacterized protein conserved in bacteria [Fun 92.46
KOG0979 1072 consensus Structural maintenance of chromosome pro 92.42
COG4942420 Membrane-bound metallopeptidase [Cell division and 91.97
KOG2991330 consensus Splicing regulator [RNA processing and m 91.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 91.94
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.46
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 91.38
PRK10869553 recombination and repair protein; Provisional 91.25
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.24
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.12
KOG0963629 consensus Transcription factor/CCAAT displacement 91.09
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.08
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 90.86
PF14662193 CCDC155: Coiled-coil region of CCDC155 90.67
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 90.64
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 90.58
KOG0977546 consensus Nuclear envelope protein lamin, intermed 90.52
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 90.45
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.17
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 90.13
KOG09791072 consensus Structural maintenance of chromosome pro 88.99
COG4372499 Uncharacterized protein conserved in bacteria with 88.72
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 88.55
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 88.52
PF13851201 GAS: Growth-arrest specific micro-tubule binding 88.04
COG2433652 Uncharacterized conserved protein [Function unknow 87.95
COG4477570 EzrA Negative regulator of septation ring formatio 87.61
COG5185622 HEC1 Protein involved in chromosome segregation, i 87.58
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 87.08
KOG1003205 consensus Actin filament-coating protein tropomyos 87.04
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 86.82
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 86.69
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 86.11
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 85.93
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 85.77
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 85.53
COG4942420 Membrane-bound metallopeptidase [Cell division and 85.52
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 85.47
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 85.41
TIGR00634563 recN DNA repair protein RecN. All proteins in this 85.28
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 84.98
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 84.91
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 83.76
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 83.69
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 83.67
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 83.42
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 83.31
TIGR026801353 conserved hypothetical protein TIGR02680. Members 82.76
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 82.47
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 81.83
TIGR00634563 recN DNA repair protein RecN. All proteins in this 81.35
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 80.73
KOG4673 961 consensus Transcription factor TMF, TATA element m 80.57
PRK11281 1113 hypothetical protein; Provisional 80.33
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 80.32
PF05010207 TACC: Transforming acidic coiled-coil-containing p 80.01
>PF07899 Frigida: Frigida-like protein; InterPro: IPR012474 This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana (Mouse-ear cress) (Q9FDW0 from SWISSPROT) Back     alignment and domain information 
Probab=99.94  E-value=3.9e-27  Score=240.42  Aligned_cols=95  Identities=36%  Similarity=0.625  Sum_probs=89.6

Q ss_pred             CCcccchhhhHHHHHHhhhhhHhhHHHHHHhhhhCCChhhHHHHhhcCcCCCCCCCcchhhhhhhhHHHHHHHHhhhhhc
Q 045360          449 ENLTSKGRNLQLLLNQHLQKHDLIFSKIFNTIKRARDPASLVLDAMSGFYPPHSSERDVEFQVGLIRRSCILLLEHLLTV  528 (544)
Q Consensus       449 ~~l~md~~gL~~f~~~~~ke~~~lr~ei~~AL~~a~DPaklVLdai~~f~~~~~~~~~~~~~~~~~r~~cilLLE~L~~~  528 (544)
                      .|.+|||+||++||++|++++++||+|||+||++|||||+||||||+||||++++. +++.++.++||+||+|||+|+++
T Consensus        18 lC~~MD~~gL~~fv~~~~k~~~~lr~Ev~~AL~~A~DPAkLVLdai~~f~~~~~~~-~~~~~~~~~r~~cilLLE~L~~~   96 (290)
T PF07899_consen   18 LCEKMDGKGLRKFVSENRKELASLREEVPAALRCAPDPAKLVLDAIEGFYPPGSKN-KKDSKLVDVRRACILLLEQLMRI   96 (290)
T ss_pred             HHHHCCHHHHHHHHHHhhhhHHHHHHHHHHHHHcCCChHHHHHHHHHcccCCcccc-ccCcchhhHHHHHHHHHHHHhhc
Confidence            46799999999999999999999999999999999999999999999999999876 44567788999999999999999


Q ss_pred             CCCCChhHHHHHhhcC
Q 045360          529 APEINAQVRDEALKVA  544 (544)
Q Consensus       529 ~p~i~~~vke~A~~lA  544 (544)
                      +|.|+|+||++|++||
T Consensus        97 ~~~is~~vke~A~~lA  112 (290)
T PF07899_consen   97 SPEISPEVKEEAKKLA  112 (290)
T ss_pred             CCCCCHHHHHHHHHHH
Confidence            9999999999999987

This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time [].
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query544
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-18
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 5e-05
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 88.4 bits (218), Expect = 2e-18
 Identities = 81/589 (13%), Positives = 197/589 (33%), Gaps = 149/589 (25%)

Query: 7   NISEELRAAESKK------------QALRRSFDIAHEQANSVLKFTVQWKDLEKHFDLGK 54
           ++ +  ++  SK+                R F     +   +++  V+ + L  ++    
Sbjct: 37  DVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVE-EVLRINYKFLM 95

Query: 55  KSLEKQSNDVDMK-IMLLDQRAK-----EIESKESDLVLVEE---RIKECNFELACKQKE 105
             ++ +     M   M ++QR +     ++ +K +  V   +   ++++   EL   +  
Sbjct: 96  SPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYN--VSRLQPYLKLRQALLEL---RPA 150

Query: 106 LGL-VQKMIGECDCELQLKESELNLLSVSLDLKREELS------LVQESVNNCQVDQKKM 158
             + +  ++G        K + +  L V L  K +         L   ++ NC   +  +
Sbjct: 151 KNVLIDGVLG-SG-----K-TWV-ALDVCLSYKVQCKMDFKIFWL---NLKNCNSPETVL 199

Query: 159 ELLKNLLEKC-------CDEIELKEKKLGEVQ----RLVEEREKQIAL------------ 195
           E+L+ LL +         D     + ++  +Q    RL++ +  +  L            
Sbjct: 200 EMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAW 259

Query: 196 -------------KDSKISSIQSMIEEYEEELKAKEKSYDEVKKSLRLCETKLECKKKEL 242
                        +  +++   S        L     +     +   L    L+C+ ++L
Sbjct: 260 NAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTP-DEVKSLLLKYLDCRPQDL 318

Query: 243 ERTQSSIKELL------SFRRRVRRREN-------EVES-IERELDSMKKK--QKKYSD- 285
            R   +           S R  +   +N       ++ + IE  L+ ++    +K +   
Sbjct: 319 PREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRL 378

Query: 286 -------DIGMKERE---YNGLKKEVEDLSQELASK---DKLLKIFKKSIEECSREFQVK 332
                   I         ++ +K +V  +  +L      +K  K    SI     E +VK
Sbjct: 379 SVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVK 438

Query: 333 KEELSSIKSEIVEC-SDEVELKRNELNLIQ-----------HASNKLQFDLIQTMEIGYL 380
            E   ++   IV+  +       ++L               H  N    + +    + +L
Sbjct: 439 LENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFL 498

Query: 381 --RELKEK---EKLFDSLKKGLEDRFQDLEVKERLFEKRVKDFE-IREKEFDSIRKTVEG 434
             R L++K   +    +    + +  Q L    + ++  + D +   E+  ++I   +  
Sbjct: 499 DFRFLEQKIRHDSTAWNASGSILNTLQQL----KFYKPYICDNDPKYERLVNAILDFLPK 554

Query: 435 QGKNLELQVKIEEQENLTSKGRNL-QLLLNQHLQKHDLIFSKIFNTIKR 482
             +NL           + SK  +L ++ L     + + IF +    ++R
Sbjct: 555 IEENL-----------ICSKYTDLLRIALM---AEDEAIFEEAHKQVQR 589
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query544
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.61
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.35
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.65
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.4
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.02
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.33
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.78
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 91.25
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 90.58
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.47
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 90.39
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 90.11
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 89.07
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 88.96
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.54
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 87.77
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 87.04
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 86.29
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 84.9
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 84.57
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.41
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
Probab=98.61  E-value=2.3e-07  Score=110.72  Aligned_cols=70  Identities=14%  Similarity=0.056  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhhhHHHHHHHHHHhHHHHHHH
Q 045360           71 LDQRAKEIESKESDLVLVEERIKECNFELACKQKELGLVQKMIGECDCELQLKESELNLLSVSLDLKREE  140 (544)
Q Consensus        71 ~e~lekEIes~ekeie~L~~~iee~~~el~~le~ql~~~~~eI~e~~kEi~~~~~El~~l~~~le~~~~e  140 (544)
                      +..+..++..+...+..+...+.++...+..++.+...+...+......+.....++..+...+..+...
T Consensus       859 l~~L~~eL~el~~~L~~le~~l~ele~~l~~Le~e~~~l~~~L~~e~~~l~~~e~~l~~l~~~~~~Le~~  928 (1184)
T 1i84_S          859 MQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEI  928 (1184)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3333333333333344444444444444444443333333333333333333333333333333333333
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00