Citrus Sinensis ID: 045511


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
cEEccHHHHHcccccccHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEEccccccc
ccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHcc
mfvnglkslkptlsFKQLNQIHAQIIKIPQPHILNTLLKLLTqsstpqnaiplynkmlncpssynhyTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISglskcgfhkeAIDMFcgidvkpnaNTLVSVLSACSslgsrklgKAIHAHSLRnlnenniildnavldfm
mfvnglkslkptLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAhslrnlnenniildnavldfm
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
***********TLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVL***
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVNGLKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q9LUJ2 842 Pentatricopeptide repeat- yes no 0.837 0.207 0.335 9e-26
Q9SZK1 559 Pentatricopeptide repeat- no no 0.794 0.296 0.358 2e-25
Q9SJG6 559 Pentatricopeptide repeat- no no 0.846 0.316 0.323 8e-24
Q9FJY7 620 Pentatricopeptide repeat- no no 0.861 0.290 0.288 2e-21
P93011 583 Pentatricopeptide repeat- no no 0.875 0.313 0.279 3e-21
A8MQA3 595 Pentatricopeptide repeat- no no 0.885 0.310 0.309 4e-21
Q9LN01 741 Pentatricopeptide repeat- no no 0.885 0.249 0.292 4e-21
Q9LTV8 694 Pentatricopeptide repeat- no no 0.789 0.237 0.331 2e-20
Q9C6T2 606 Pentatricopeptide repeat- no no 0.875 0.301 0.278 3e-20
Q9M9E2 866 Pentatricopeptide repeat- no no 0.669 0.161 0.368 5e-20
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 60/179 (33%), Positives = 109/179 (60%), Gaps = 4/179 (2%)

Query: 33  ILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHV 92
           + N+L++    S     AI L+ +M+N   S + YTF   L AC+ + A   G++IH  +
Sbjct: 101 MYNSLIRGYASSGLCNEAILLFLRMMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLI 160

Query: 93  IKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAI 152
           +K G+  D+F+QNSL+HFY    ++ SA ++F+ +   +VV+WT++I G ++  F K+A+
Sbjct: 161 VKMGYAKDLFVQNSLVHFYAECGELDSARKVFDEMSERNVVSWTSMICGYARRDFAKDAV 220

Query: 153 DMFCGI----DVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLD 207
           D+F  +    +V PN+ T+V V+SAC+ L   + G+ ++A    +  E N ++ +A++D
Sbjct: 221 DLFFRMVRDEEVTPNSVTMVCVISACAKLEDLETGEKVYAFIRNSGIEVNDLMVSALVD 279





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protein At4g38010 OS=Arabidopsis thaliana GN=PCMP-E45 PE=3 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protein At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=3 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1 Back     alignment and function description
>sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H73 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
449442521 517 PREDICTED: pentatricopeptide repeat-cont 0.928 0.375 0.610 6e-65
296083914 541 unnamed protein product [Vitis vinifera] 0.952 0.367 0.558 6e-53
357446587 528 Pentatricopeptide repeat-containing prot 0.933 0.369 0.553 5e-48
217074958 515 unknown [Medicago truncatula] gi|3885214 0.746 0.302 0.605 7e-48
449476231 472 PREDICTED: pentatricopeptide repeat-cont 0.665 0.294 0.641 7e-48
356555244 521 PREDICTED: pentatricopeptide repeat-cont 0.923 0.370 0.497 4e-45
147788829 725 hypothetical protein VITISV_018159 [Viti 0.660 0.190 0.598 2e-42
297741134 573 unnamed protein product [Vitis vinifera] 0.909 0.331 0.350 2e-28
225469326 590 PREDICTED: pentatricopeptide repeat-cont 0.909 0.322 0.350 2e-28
225463844 617 PREDICTED: pentatricopeptide repeat-cont 0.961 0.325 0.322 2e-27
>gi|449442521|ref|XP_004139030.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform 1 [Cucumis sativus] gi|449442523|ref|XP_004139031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 152/203 (74%)

Query: 6   LKSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYN 65
           LK LKP++S  Q  QIHA+++  P+PHI N LL  L  S  P+N + LYN+ML  PSS+N
Sbjct: 3   LKPLKPSISIAQFTQIHAKLLTNPKPHIFNPLLGSLVNSIFPENGLFLYNQMLRYPSSHN 62

Query: 66  HYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFN 125
           H+TFT ALKAC   H  QKGLEIHAH+IK GHL DIFIQNSLLHFY+   D+ SA  IF+
Sbjct: 63  HFTFTYALKACCFLHQTQKGLEIHAHLIKSGHLSDIFIQNSLLHFYILDGDVSSASLIFD 122

Query: 126 SVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGIDVKPNANTLVSVLSACSSLGSRKLGKA 185
           S+  PDVV+WT+IISGLSK GF KEA+  F  ++V+PN+ TLV+ LSACSSL   KLGKA
Sbjct: 123 SIPDPDVVSWTSIISGLSKLGFEKEALSKFLSMNVRPNSTTLVTALSACSSLRCLKLGKA 182

Query: 186 IHAHSLRNLNENNIILDNAVLDF 208
           IH   +R LNE N+IL+NA+LDF
Sbjct: 183 IHGLRMRTLNEENVILENALLDF 205




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296083914|emb|CBI24302.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357446587|ref|XP_003593569.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482617|gb|AES63820.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074958|gb|ACJ85839.1| unknown [Medicago truncatula] gi|388521431|gb|AFK48777.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449476231|ref|XP_004154679.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555244|ref|XP_003545944.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Back     alignment and taxonomy information
>gi|147788829|emb|CAN73311.1| hypothetical protein VITISV_018159 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741134|emb|CBI31865.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225469326|ref|XP_002268072.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225463844|ref|XP_002265179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
TAIR|locus:2121055 559 AT4G38010 "AT4G38010" [Arabido 0.827 0.309 0.358 1.8e-23
TAIR|locus:4010713895 595 AT4G21065 "AT4G21065" [Arabido 0.885 0.310 0.309 6.7e-21
TAIR|locus:2057574 583 AT2G33760 [Arabidopsis thalian 0.928 0.332 0.276 1.1e-20
TAIR|locus:2034456 606 AT1G31920 [Arabidopsis thalian 0.827 0.285 0.282 1.6e-20
TAIR|locus:2151501 697 AT5G46460 [Arabidopsis thalian 0.928 0.278 0.276 6.9e-20
TAIR|locus:2025946 638 CRR28 "CHLORORESPIRATORY REDUC 0.985 0.322 0.287 1.6e-19
TAIR|locus:2063771 689 AT2G03380 [Arabidopsis thalian 0.794 0.240 0.319 2e-19
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.669 0.161 0.368 3.5e-19
TAIR|locus:2040565 501 AT2G36730 [Arabidopsis thalian 0.933 0.389 0.295 6.2e-19
TAIR|locus:2122551 834 AT4G39530 [Arabidopsis thalian 0.669 0.167 0.317 6.8e-19
TAIR|locus:2121055 AT4G38010 "AT4G38010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 62/173 (35%), Positives = 94/173 (54%)

Query:    35 NTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIK 94
             NTLL        P+  I  Y   ++   S + +TF    KAC      ++G +IH  V K
Sbjct:    75 NTLLSSYAVCDKPRVTIFAYKTFVSNGFSPDMFTFPPVFKACGKFSGIREGKQIHGIVTK 134

Query:    95 YGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDM 154
              G   DI++QNSL+HFY    +  +A ++F  +   DVV+WT II+G ++ G +KEA+D 
Sbjct:   135 MGFYDDIYVQNSLVHFYGVCGESRNACKVFGEMPVRDVVSWTGIITGFTRTGLYKEALDT 194

Query:   155 FCGIDVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENNIILDNAVLD 207
             F  +DV+PN  T V VL +   +G   LGK IH   L+  +  ++   NA++D
Sbjct:   195 FSKMDVEPNLATYVCVLVSSGRVGCLSLGKGIHGLILKRASLISLETGNALID 247


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057574 AT2G33760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034456 AT1G31920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151501 AT5G46460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025946 CRR28 "CHLORORESPIRATORY REDUCTION28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063771 AT2G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040565 AT2G36730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017291001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (555 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-24
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-23
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-21
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-13
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-11
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  100 bits (250), Expect = 2e-24
 Identities = 47/146 (32%), Positives = 82/146 (56%), Gaps = 3/146 (2%)

Query: 50  AIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKGLEIHAHVIKYGHLHDIFIQNSLLH 109
           A+ LY++ML      + YTF   L+ C       +G E+HAHV+++G   D+ + N+L+ 
Sbjct: 171 ALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALIT 230

Query: 110 FYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFC---GIDVKPNANT 166
            YV   D+ SA  +F+ +   D ++W  +ISG  + G   E +++F     + V P+  T
Sbjct: 231 MYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMT 290

Query: 167 LVSVLSACSSLGSRKLGKAIHAHSLR 192
           + SV+SAC  LG  +LG+ +H + ++
Sbjct: 291 ITSVISACELLGDERLGREMHGYVVK 316


Length = 857

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.67
PRK11788389 tetratricopeptide repeat protein; Provisional 99.67
PF1304150 PPR_2: PPR repeat family 99.63
PF1304150 PPR_2: PPR repeat family 99.6
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.46
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.44
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.39
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.28
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.25
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.18
PF1285434 PPR_1: PPR repeat 99.18
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.18
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.12
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.11
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.1
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.06
PF1285434 PPR_1: PPR repeat 99.05
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.01
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.99
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.85
PRK12370553 invasion protein regulator; Provisional 98.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.78
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.74
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.73
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.73
PRK12370553 invasion protein regulator; Provisional 98.7
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.68
PRK11189296 lipoprotein NlpI; Provisional 98.68
PRK14574 822 hmsH outer membrane protein; Provisional 98.67
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.66
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.65
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.65
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.64
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.62
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.56
PRK14574 822 hmsH outer membrane protein; Provisional 98.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.53
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.44
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.42
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.41
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.4
KOG1129478 consensus TPR repeat-containing protein [General f 98.38
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.37
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.37
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.35
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.34
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.34
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.29
KOG2003 840 consensus TPR repeat-containing protein [General f 98.28
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.23
PRK11189296 lipoprotein NlpI; Provisional 98.2
KOG1126638 consensus DNA-binding cell division cycle control 98.2
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.19
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.19
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.18
PRK10370198 formate-dependent nitrite reductase complex subuni 98.17
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.15
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.14
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.12
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.12
KOG1129478 consensus TPR repeat-containing protein [General f 98.12
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.11
KOG2003 840 consensus TPR repeat-containing protein [General f 98.1
PRK15359144 type III secretion system chaperone protein SscB; 98.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.08
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.05
KOG1126638 consensus DNA-binding cell division cycle control 98.03
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.99
PRK15359144 type III secretion system chaperone protein SscB; 97.98
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.97
PRK10370198 formate-dependent nitrite reductase complex subuni 97.96
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.93
KOG2076 895 consensus RNA polymerase III transcription factor 97.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.92
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.91
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.91
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.9
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.88
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.83
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.83
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 97.83
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.79
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.78
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.73
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.7
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.69
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.67
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.63
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.59
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.58
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.57
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.56
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.55
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.52
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.48
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.46
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.45
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.45
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.44
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.43
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.41
KOG0547606 consensus Translocase of outer mitochondrial membr 97.4
KOG0547606 consensus Translocase of outer mitochondrial membr 97.39
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.36
KOG2076 895 consensus RNA polymerase III transcription factor 97.31
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.29
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.29
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.28
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.22
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.18
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.14
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.12
PF12688120 TPR_5: Tetratrico peptide repeat 97.12
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.11
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.11
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.03
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.01
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.01
PLN02789320 farnesyltranstransferase 96.96
KOG3941 406 consensus Intermediate in Toll signal transduction 96.93
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.91
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.9
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.87
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.82
PRK04841 903 transcriptional regulator MalT; Provisional 96.78
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.77
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.74
PRK04841 903 transcriptional regulator MalT; Provisional 96.72
KOG1125579 consensus TPR repeat-containing protein [General f 96.69
smart00299140 CLH Clathrin heavy chain repeat homology. 96.64
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.6
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.59
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.57
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 96.53
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.46
PF12688120 TPR_5: Tetratrico peptide repeat 96.45
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.32
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.31
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.3
KOG3941 406 consensus Intermediate in Toll signal transduction 96.27
COG4700251 Uncharacterized protein conserved in bacteria cont 96.21
KOG1128 777 consensus Uncharacterized conserved protein, conta 96.17
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 96.17
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.14
KOG0553304 consensus TPR repeat-containing protein [General f 96.13
PLN02789320 farnesyltranstransferase 96.12
smart00299140 CLH Clathrin heavy chain repeat homology. 96.11
PRK10803263 tol-pal system protein YbgF; Provisional 96.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.07
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.05
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.04
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.03
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 95.94
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.92
PRK10803263 tol-pal system protein YbgF; Provisional 95.84
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.78
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.77
PF1337173 TPR_9: Tetratricopeptide repeat 95.77
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.7
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 95.61
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.61
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.51
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.51
COG4700251 Uncharacterized protein conserved in bacteria cont 95.31
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 95.27
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.21
PF1337173 TPR_9: Tetratricopeptide repeat 95.08
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.01
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 94.99
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 94.98
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.96
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.78
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 94.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.68
KOG0553304 consensus TPR repeat-containing protein [General f 94.59
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.36
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.34
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.32
COG3629280 DnrI DNA-binding transcriptional activator of the 94.28
COG3629280 DnrI DNA-binding transcriptional activator of the 94.14
PF13762145 MNE1: Mitochondrial splicing apparatus component 93.96
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.96
COG4235287 Cytochrome c biogenesis factor [Posttranslational 93.94
KOG1125579 consensus TPR repeat-containing protein [General f 93.85
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.82
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.81
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 93.79
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.72
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 93.56
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.26
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.1
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.08
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.06
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 92.87
PF13929292 mRNA_stabil: mRNA stabilisation 92.72
KOG4555175 consensus TPR repeat-containing protein [Function 92.6
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.37
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 92.28
PF13929292 mRNA_stabil: mRNA stabilisation 92.25
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.01
KOG2610 491 consensus Uncharacterized conserved protein [Funct 91.97
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 91.94
PRK15331165 chaperone protein SicA; Provisional 91.76
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.38
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 91.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.31
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.24
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.23
PF13762145 MNE1: Mitochondrial splicing apparatus component 91.19
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.06
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.02
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 90.96
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 90.94
smart00638574 LPD_N Lipoprotein N-terminal Domain. 90.94
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.64
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.58
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.39
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.32
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.31
PF13512142 TPR_18: Tetratricopeptide repeat 90.3
PF1342844 TPR_14: Tetratricopeptide repeat 90.16
PRK15331165 chaperone protein SicA; Provisional 90.1
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 89.93
PF13512142 TPR_18: Tetratricopeptide repeat 89.74
KOG2610 491 consensus Uncharacterized conserved protein [Funct 89.58
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.48
COG1729262 Uncharacterized protein conserved in bacteria [Fun 89.47
PF1342844 TPR_14: Tetratricopeptide repeat 89.37
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.3
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.27
COG3898 531 Uncharacterized membrane-bound protein [Function u 88.63
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 88.5
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 88.49
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.39
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.15
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.14
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 87.39
KOG4162799 consensus Predicted calmodulin-binding protein [Si 87.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 87.17
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.99
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.72
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 86.57
COG3898 531 Uncharacterized membrane-bound protein [Function u 86.12
COG4649221 Uncharacterized protein conserved in bacteria [Fun 85.98
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 85.61
KOG4162799 consensus Predicted calmodulin-binding protein [Si 85.57
PF1343134 TPR_17: Tetratricopeptide repeat 85.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 85.42
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.39
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 84.88
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 84.71
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.37
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 84.34
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.33
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 83.99
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 83.61
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.33
cd0832684 CARD_CASP9 Caspase activation and recruitment doma 82.99
KOG4567370 consensus GTPase-activating protein [General funct 82.28
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 82.24
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.61
PHA02875 413 ankyrin repeat protein; Provisional 81.57
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 81.4
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.03
COG4105254 ComL DNA uptake lipoprotein [General function pred 80.78
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 80.74
PRK10564303 maltose regulon periplasmic protein; Provisional 80.72
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 80.6
COG3118304 Thioredoxin domain-containing protein [Posttransla 80.11
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-41  Score=288.94  Aligned_cols=204  Identities=20%  Similarity=0.310  Sum_probs=196.4

Q ss_pred             Chhcch-hccCCCcchHhHHHHHHHHhhCCCcccHHHHHHHHHcCCCccchHHHHHHhhhCCCCCCHHHHHHHHHHHhcc
Q 045511            1 MFVNGL-KSLKPTLSFKQLNQIHAQIIKIPQPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLA   79 (209)
Q Consensus         1 ~li~~~-~~~~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~p~~~t~~~ll~~~~~~   79 (209)
                      +||+++ +.|+.++|.+.|+++     ..+|+.+||++|.+|++.|+.++|.++|++|.+.|+.||..||+.++.+|++.
T Consensus       264 ~Li~~y~k~g~~~~A~~vf~~m-----~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~  338 (697)
T PLN03081        264 ALIDMYSKCGDIEDARCVFDGM-----PEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRL  338 (697)
T ss_pred             HHHHHHHHCCCHHHHHHHHHhC-----CCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhc
Confidence            367888 899999999888877     34799999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHHHHHhccCccHhHHHHHHHHHHhCCChhhHHHHHHhcCCCcHhHHHHHHHHHHhCCChHHHHHHHhhC-
Q 045511           80 HAHQKGLEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSVVFPDVVTWTTIISGLSKCGFHKEAIDMFCGI-  158 (209)
Q Consensus        80 ~~~~~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m-  158 (209)
                      |+++.|.++++.|.+.|+.||..+||+||++|++.|++++|.++|++|.+||..+||+||.+|++.|+.++|.++|++| 
T Consensus       339 g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~  418 (697)
T PLN03081        339 ALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMI  418 (697)
T ss_pred             cchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             --CCCCCHHhHHHHHHHhccccchhHHHHHHHHHHH-hccCCCchhHhHhhhcC
Q 045511          159 --DVKPNANTLVSVLSACSSLGSRKLGKAIHAHSLR-NLNENNIILDNAVLDFM  209 (209)
Q Consensus       159 --~~~p~~~t~~~li~~~~~~g~~~~a~~~~~~~~~-~~~~p~~~~~~~li~~y  209 (209)
                        |+.||..||+++|.+|++.|++++|.++|+.|.+ .|+.|+..+|+++|++|
T Consensus       419 ~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l  472 (697)
T PLN03081        419 AEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELL  472 (697)
T ss_pred             HhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHH
Confidence              9999999999999999999999999999999976 69999999999999875



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd08326 CARD_CASP9 Caspase activation and recruitment domain of Caspase-9 Back     alignment and domain information
>KOG4567 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.88
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.82
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.81
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.55
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.55
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.52
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.48
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.45
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.43
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.42
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.41
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.4
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.39
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.36
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.34
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.34
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.32
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.28
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.27
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.27
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.27
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.27
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.25
3u4t_A272 TPR repeat-containing protein; structural genomics 99.21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.19
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.19
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.18
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.16
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.15
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.14
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.14
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.09
3u4t_A272 TPR repeat-containing protein; structural genomics 99.09
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.06
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.06
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.03
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.99
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.85
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.84
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.84
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.83
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.82
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.81
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.8
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.8
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.78
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.76
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.76
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.75
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.75
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.75
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.74
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.73
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.73
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.72
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.67
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.66
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.65
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.64
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.64
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.59
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.59
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.54
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.53
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.53
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.52
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.52
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.51
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.5
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.45
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.43
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.42
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.37
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.36
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.36
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.35
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.34
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.3
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.3
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.3
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.3
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.29
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.26
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.24
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.24
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.23
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.2
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.2
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.11
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.1
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.07
3k9i_A117 BH0479 protein; putative protein binding protein, 98.04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.03
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.02
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.01
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.99
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.97
3k9i_A117 BH0479 protein; putative protein binding protein, 97.97
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.96
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.96
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.95
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.89
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.87
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.86
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.81
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 97.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.79
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.76
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.76
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.75
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.69
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.64
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.6
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.47
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.32
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.29
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.23
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.2
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.19
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.15
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.95
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.91
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.9
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.89
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.79
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.77
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.65
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.58
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.39
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.39
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.22
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.2
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.14
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.12
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 95.75
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.58
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.49
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 95.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.25
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.91
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.72
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.28
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.26
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.14
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.1
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 94.0
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 93.87
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.66
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.38
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.28
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 92.41
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.46
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.35
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 91.15
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.11
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.2
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.73
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 89.29
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 88.84
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 88.12
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.86
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.21
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.69
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.17
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.36
2p58_C116 Putative type III secretion protein YSCG; type III 85.18
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 81.32
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.03
2zu6_B307 Programmed cell death protein 4; protein-protein c 81.03
3hra_A201 Ankyrin repeat family protein; structural protein; 80.87
2p58_C116 Putative type III secretion protein YSCG; type III 80.24
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=8.5e-40  Score=269.45  Aligned_cols=179  Identities=15%  Similarity=0.201  Sum_probs=171.5

Q ss_pred             cccHHHHHHHHHcCCCccchHHHHHHhhhCCCCCCHHHHHHHHHHHhcccc---------HHHHHHHHHHHHHhccCccH
Q 045511           31 PHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHA---------HQKGLEIHAHVIKYGHLHDI  101 (209)
Q Consensus        31 ~~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~---------~~~a~~~~~~m~~~g~~~~~  101 (209)
                      ...++.+|++|++.|++++|.++|++|.+.|+.||..||+++|.+|++.+.         ++.|.++|++|.+.|+.||.
T Consensus        26 e~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~  105 (501)
T 4g26_A           26 EALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNE  105 (501)
T ss_dssp             HHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCH
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCH
Confidence            356899999999999999999999999999999999999999999987654         78899999999999999999


Q ss_pred             hHHHHHHHHHHhCCChhhHHHHHHhc----CCCcHhHHHHHHHHHHhCCChHHHHHHHhhC---CCCCCHHhHHHHHHHh
Q 045511          102 FIQNSLLHFYVTVKDIFSAHQIFNSV----VFPDVVTWTTIISGLSKCGFHKEAIDMFCGI---DVKPNANTLVSVLSAC  174 (209)
Q Consensus       102 ~~~~~ll~~~~~~g~~~~a~~~~~~~----~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m---~~~p~~~t~~~li~~~  174 (209)
                      .|||+||++|++.|++++|.++|++|    ..||..+||++|.+|++.|++++|.++|++|   |+.||..||++||++|
T Consensus       106 ~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~  185 (501)
T 4g26_A          106 ATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVS  185 (501)
T ss_dssp             HHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999    3699999999999999999999999999999   9999999999999999


Q ss_pred             ccccchhHHHHHHHHHHHhccCCCchhHhHhhhcC
Q 045511          175 SSLGSRKLGKAIHAHSLRNLNENNIILDNAVLDFM  209 (209)
Q Consensus       175 ~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~li~~y  209 (209)
                      ++.|++++|.+++++|++.|..|+..||+.|++.|
T Consensus       186 ~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F  220 (501)
T 4g26_A          186 MDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWF  220 (501)
T ss_dssp             HHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHH
T ss_pred             hhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHH
Confidence            99999999999999999999999999999998753



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.33
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.17
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.78
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.73
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.47
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.18
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.17
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.15
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.14
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.1
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.07
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.06
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.96
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.85
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.8
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.75
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.71
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.68
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.62
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.53
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.47
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.29
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.25
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.23
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.21
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.18
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.82
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.68
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.56
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.42
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.14
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.63
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.27
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.18
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.82
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 94.56
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.48
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.97
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 89.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.4
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.27
d1khda169 Anthranilate phosphoribosyltransferase (TrpD) {Pec 85.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 81.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.33  E-value=8.2e-11  Score=90.08  Aligned_cols=192  Identities=10%  Similarity=0.027  Sum_probs=155.2

Q ss_pred             hccCCCcchHhHHHHHHHHhhCC-CcccHHHHHHHHHcCCCccchHHHHHHhhhCCCCCCHHHHHHHHHHHhccccHHHH
Q 045511            7 KSLKPTLSFKQLNQIHAQIIKIP-QPHILNTLLKLLTQSSTPQNAIPLYNKMLNCPSSYNHYTFTQALKACSLAHAHQKG   85 (209)
Q Consensus         7 ~~~~~~~a~~~~~~~~~~~~~~p-~~~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a   85 (209)
                      ..+..+.|...+.+..+.   .| +..+|..+...+...|++++|...+++....+. .+...+..+-..+.+.|++++|
T Consensus       181 ~~~~~~~A~~~~~~al~~---~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A  256 (388)
T d1w3ba_         181 AQGEIWLAIHHFEKAVTL---DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLA  256 (388)
T ss_dssp             TTTCHHHHHHHHHHHHHH---CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHH
T ss_pred             ccCcHHHHHHHHHHHHHh---CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhh-hHHHHHHHHHHHHHHCCCHHHH
Confidence            345555566666655544   24 347888899999999999999999999887653 4567788888899999999999


Q ss_pred             HHHHHHHHHhccCccHhHHHHHHHHHHhCCChhhHHHHHHhc---CCCcHhHHHHHHHHHHhCCChHHHHHHHhhC-CCC
Q 045511           86 LEIHAHVIKYGHLHDIFIQNSLLHFYVTVKDIFSAHQIFNSV---VFPDVVTWTTIISGLSKCGFHKEAIDMFCGI-DVK  161 (209)
Q Consensus        86 ~~~~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~---~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m-~~~  161 (209)
                      .+.|+...+.. +.+..++..+...+...|++++|.+.++..   ...+...+..+...+...|++++|+..|++. .+.
T Consensus       257 ~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~  335 (388)
T d1w3ba_         257 IDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVF  335 (388)
T ss_dssp             HHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC
T ss_pred             HHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC
Confidence            99999988764 445778999999999999999999999877   3456778889999999999999999999998 777


Q ss_pred             CCH-HhHHHHHHHhccccchhHHHHHHHHHHHhccCCC-chhHhHh
Q 045511          162 PNA-NTLVSVLSACSSLGSRKLGKAIHAHSLRNLNENN-IILDNAV  205 (209)
Q Consensus       162 p~~-~t~~~li~~~~~~g~~~~a~~~~~~~~~~~~~p~-~~~~~~l  205 (209)
                      |+. .++..+-..+.+.|++++|...++...+.  .|+ +..+..|
T Consensus       336 p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~l  379 (388)
T d1w3ba_         336 PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNM  379 (388)
T ss_dssp             TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHH
Confidence            764 56888889999999999999999987654  564 3445444



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure