Citrus Sinensis ID: 045706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
cHHHHHHHHHHccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccEEEccccHHHHHHHHHccccccccccccccccccccc
HHHHHHHHHHHccEEEEEccEcccHHHHHHHcHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHcccHHHccEEEcccHHHHHHHHHHHccHHHccccccccHHHHcc
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHykdlnskpffpKLIEYITSGPVVCMAWEGAGVVASARKligstdplqaepgtirgdlavqtgrnvvhgsdspengkrEIGLWfkegelcqwtPAQAQWLRE
VGEIISRFekkgfkligLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGstdplqaepgtirgdlavqtgrnvvhgsdspengKREIGLWFKEGELCQWTPAQAQWLRE
VGEIISRFEkkgfkliglklfQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
****ISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGS**************L********************EIGLWFKEGELCQWTPAQAQW***
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q01402233 Nucleoside diphosphate ki N/A no 1.0 0.566 0.878 2e-66
O64903231 Nucleoside diphosphate ki yes no 1.0 0.571 0.893 4e-66
Q852S5232 Nucleoside diphosphate ki N/A no 1.0 0.568 0.871 2e-64
P47923230 Nucleoside diphosphate ki N/A no 1.0 0.573 0.856 2e-64
Q8DM56150 Nucleoside diphosphate ki yes no 1.0 0.88 0.628 5e-47
B8HUM7149 Nucleoside diphosphate ki yes no 1.0 0.885 0.628 1e-46
Q8YRP2149 Nucleoside diphosphate ki yes no 1.0 0.885 0.606 5e-46
Q3M7K5149 Nucleoside diphosphate ki yes no 1.0 0.885 0.606 5e-46
Q2JVI1149 Nucleoside diphosphate ki yes no 1.0 0.885 0.598 1e-45
A5GPE9152 Nucleoside diphosphate ki yes no 1.0 0.868 0.613 6e-45
>sp|Q01402|NDK2_SPIOL Nucleoside diphosphate kinase 2, chloroplastic OS=Spinacia oleracea GN=NDPK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/132 (87%), Positives = 126/132 (95%)

Query: 1   VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           VGEIISRFEKKGFKLIGLK++ CPK+LAEEHYKDL +K F+ KLI+YITSGPVVCMAWEG
Sbjct: 102 VGEIISRFEKKGFKLIGLKMYPCPKELAEEHYKDLKAKSFYQKLIDYITSGPVVCMAWEG 161

Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
            GVVAS+RKLIG+TDPLQAEPGTIRGDLAVQTGRNVVHGSDSP+NGKREIGLWFKEGE+C
Sbjct: 162 VGVVASSRKLIGATDPLQAEPGTIRGDLAVQTGRNVVHGSDSPDNGKREIGLWFKEGEIC 221

Query: 121 QWTPAQAQWLRE 132
           QWTPAQA WLRE
Sbjct: 222 QWTPAQAPWLRE 233
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Spinacia oleracea (taxid: 3562)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|O64903|NDK2_ARATH Nucleoside diphosphate kinase II, chloroplastic OS=Arabidopsis thaliana GN=NDPK2 PE=1 SV=2 Back     alignment and function description
>sp|Q852S5|NDK2_TOBAC Nucleoside diphosphate kinase 2, chloroplastic OS=Nicotiana tabacum GN=NDPK2 PE=1 SV=1 Back     alignment and function description
>sp|P47923|NDK2_PEA Nucleoside diphosphate kinase 2, chloroplastic OS=Pisum sativum GN=NDPK2 PE=1 SV=1 Back     alignment and function description
>sp|Q8DM56|NDK_THEEB Nucleoside diphosphate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|B8HUM7|NDK_CYAP4 Nucleoside diphosphate kinase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q8YRP2|NDK_NOSS1 Nucleoside diphosphate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q3M7K5|NDK_ANAVT Nucleoside diphosphate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q2JVI1|NDK_SYNJA Nucleoside diphosphate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|A5GPE9|NDK_SYNPW Nucleoside diphosphate kinase OS=Synechococcus sp. (strain WH7803) GN=ndk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
224121906152 predicted protein [Populus trichocarpa] 1.0 0.868 0.931 2e-66
255540363 242 nucleoside diphosphate kinase, putative 1.0 0.545 0.901 9e-66
225457446230 PREDICTED: nucleoside diphosphate kinase 1.0 0.573 0.909 2e-65
266607 233 RecName: Full=Nucleoside diphosphate kin 1.0 0.566 0.878 2e-64
356513927225 PREDICTED: nucleoside diphosphate kinase 1.0 0.586 0.893 2e-64
30697820231 nucleoside diphosphate kinase II [Arabid 1.0 0.571 0.893 3e-64
56965987153 Chain A, Crystal Structure Of Nucleoside 1.0 0.862 0.893 3e-64
255630417229 unknown [Glycine max] 1.0 0.576 0.886 3e-64
3063661152 nucleoside diphosphate kinase Ia [Arabid 1.0 0.868 0.893 4e-64
297797325230 hypothetical protein ARALYDRAFT_496515 [ 1.0 0.573 0.893 4e-64
>gi|224121906|ref|XP_002318702.1| predicted protein [Populus trichocarpa] gi|222859375|gb|EEE96922.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%)

Query: 1   VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           VGEIISRFEKKGFKL GLKLFQCPK+LAEEHYKDL +KPFFP LI+YITSGPVVCMAWEG
Sbjct: 21  VGEIISRFEKKGFKLTGLKLFQCPKELAEEHYKDLKAKPFFPGLIDYITSGPVVCMAWEG 80

Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
            GVVASARKLIGSTDPL+AEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC
Sbjct: 81  VGVVASARKLIGSTDPLKAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 140

Query: 121 QWTPAQAQWLRE 132
           QWTPAQA WLRE
Sbjct: 141 QWTPAQAPWLRE 152

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540363|ref|XP_002511246.1| nucleoside diphosphate kinase, putative [Ricinus communis] gi|223550361|gb|EEF51848.1| nucleoside diphosphate kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225457446|ref|XP_002263177.1| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic isoform 1 [Vitis vinifera] gi|297733614|emb|CBI14861.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|266607|sp|Q01402.1|NDK2_SPIOL RecName: Full=Nucleoside diphosphate kinase 2, chloroplastic; AltName: Full=Nucleoside diphosphate kinase II; Short=NDK II; Short=NDP kinase II; Short=NDPK II; Contains: RecName: Full=Nucleoside diphosphate kinase 2 high molecular weight; Contains: RecName: Full=Nucleoside diphosphate kinase 2 low molecular weight; Flags: Precursor gi|218273|dbj|BAA02018.1| nucleoside diphosphate kinase II [Spinacia oleracea] Back     alignment and taxonomy information
>gi|356513927|ref|XP_003525659.1| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic [Glycine max] Back     alignment and taxonomy information
>gi|30697820|ref|NP_568970.2| nucleoside diphosphate kinase II [Arabidopsis thaliana] gi|12644076|sp|O64903.2|NDK2_ARATH RecName: Full=Nucleoside diphosphate kinase II, chloroplastic; Short=NDK II; Short=NDP kinase II; Short=NDPK II; Short=NDPK Ia; Flags: Precursor gi|6065740|emb|CAB58230.1| nucleotide diphosphate kinase Ia [Arabidopsis thaliana] gi|10177312|dbj|BAB10573.1| nucleotide diphosphate kinase Ia [Arabidopsis thaliana] gi|16209700|gb|AAL14407.1| AT5g63310/MDC12_28 [Arabidopsis thaliana] gi|17529114|gb|AAL38767.1| putative nucleotide diphosphate kinase Ia [Arabidopsis thaliana] gi|21436481|gb|AAM51441.1| putative nucleotide diphosphate kinase Ia [Arabidopsis thaliana] gi|110742634|dbj|BAE99229.1| nucleoside diphosphate kinase Ia [Arabidopsis thaliana] gi|332010348|gb|AED97731.1| nucleoside diphosphate kinase II [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|56965987|pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965988|pdb|1S57|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965989|pdb|1S57|C Chain C, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965990|pdb|1S57|D Chain D, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965991|pdb|1S57|E Chain E, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965992|pdb|1S57|F Chain F, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis gi|56965993|pdb|1S59|A Chain A, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis gi|56965994|pdb|1S59|B Chain B, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis gi|56965995|pdb|1S59|C Chain C, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis gi|56965996|pdb|1S59|D Chain D, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis gi|56965997|pdb|1S59|E Chain E, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis gi|56965998|pdb|1S59|F Chain F, Structure Of Nucleoside Diphosphate Kinase 2 With Bound Dgtp From Arabidopsis Back     alignment and taxonomy information
>gi|255630417|gb|ACU15565.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|3063661|gb|AAC14280.1| nucleoside diphosphate kinase Ia [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297797325|ref|XP_002866547.1| hypothetical protein ARALYDRAFT_496515 [Arabidopsis lyrata subsp. lyrata] gi|297312382|gb|EFH42806.1| hypothetical protein ARALYDRAFT_496515 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:2161922231 NDPK2 "nucleoside diphosphate 1.0 0.571 0.810 3.7e-55
FB|FBgn0000150153 awd "abnormal wing discs" [Dro 1.0 0.862 0.492 3.6e-34
UNIPROTKB|Q6XI71150 awd "Nucleoside diphosphate ki 1.0 0.88 0.492 3.6e-34
TAIR|locus:2123421238 NDPK3 "nucleoside diphosphate 0.984 0.546 0.523 1.2e-33
MGI|MGI:1930182169 Nme3 "NME/NM23 nucleoside diph 1.0 0.781 0.492 1.1e-32
RGD|619879169 Nme3 "NME/NM23 nucleoside diph 1.0 0.781 0.492 1.1e-32
TIGR_CMR|CHY_0215149 CHY_0215 "nucleoside diphospha 1.0 0.885 0.515 1.4e-32
UNIPROTKB|G3V816169 Nme3 "Nucleoside diphosphate k 1.0 0.781 0.492 1.4e-32
UNIPROTKB|Q3T0Q4152 NME2 "Nucleoside diphosphate k 1.0 0.868 0.469 1.8e-32
UNIPROTKB|A5PK70169 NME3 "Nucleoside diphosphate k 1.0 0.781 0.477 2.9e-32
TAIR|locus:2161922 NDPK2 "nucleoside diphosphate kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 569 (205.4 bits), Expect = 3.7e-55, P = 3.7e-55
 Identities = 107/132 (81%), Positives = 112/132 (84%)

Query:     1 VGEIISRFEXXXXXXXXXXXXQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
             VGEIISRFE            QCPK+LAEEHYKDL++K FFP LIEYITSGPVVCMAWEG
Sbjct:   100 VGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEG 159

Query:    61 AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
              GVVASARKLIG TDPLQAEPGTIRGDLAVQTGRN+VHGSDSPENGKREIGLWFKEGELC
Sbjct:   160 VGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELC 219

Query:   121 QWTPAQAQWLRE 132
             +W  A A WLRE
Sbjct:   220 KWDSALATWLRE 231
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA;ISS;IDA;TAS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009585 "red, far-red light phototransduction" evidence=IMP
GO:0042542 "response to hydrogen peroxide" evidence=IEP;IMP
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009411 "response to UV" evidence=TAS
GO:0009734 "auxin mediated signaling pathway" evidence=IMP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
FB|FBgn0000150 awd "abnormal wing discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6XI71 awd "Nucleoside diphosphate kinase" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
TAIR|locus:2123421 NDPK3 "nucleoside diphosphate kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1930182 Nme3 "NME/NM23 nucleoside diphosphate kinase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619879 Nme3 "NME/NM23 nucleoside diphosphate kinase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0215 CHY_0215 "nucleoside diphosphate kinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|G3V816 Nme3 "Nucleoside diphosphate kinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0Q4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A5PK70 NME3 "Nucleoside diphosphate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3M7K5NDK_ANAVT2, ., 7, ., 4, ., 60.60601.00.8859yesno
P93554NDK1_SACOF2, ., 7, ., 4, ., 60.60600.99240.8791N/Ano
Q7VEG3NDK_PROMA2, ., 7, ., 4, ., 60.59841.00.8741yesno
Q116S1NDK_TRIEI2, ., 7, ., 4, ., 60.59841.00.8859yesno
P27950NDK_GINCI2, ., 7, ., 4, ., 60.55301.00.8741N/Ano
Q0I6J3NDK_SYNS32, ., 7, ., 4, ., 60.60601.00.8684yesno
Q8YRP2NDK_NOSS12, ., 7, ., 4, ., 60.60601.00.8859yesno
Q7V3M8NDK_PROMP2, ., 7, ., 4, ., 60.58331.00.8684yesno
P47921NDK_SOLLC2, ., 7, ., 4, ., 60.58330.99240.9097N/Ano
A5GPE9NDK_SYNPW2, ., 7, ., 4, ., 60.61361.00.8684yesno
Q46I11NDK_PROMT2, ., 7, ., 4, ., 60.59091.00.8741yesno
Q02254NDK1_SPIOL2, ., 7, ., 4, ., 60.58330.99240.8851N/Ano
A2BZG4NDK_PROM12, ., 7, ., 4, ., 60.59841.00.8741yesno
Q9WV85NDK3_MOUSE2, ., 7, ., 4, ., 60.55301.00.7810yesno
Q5KXU2NDK_GEOKA2, ., 7, ., 4, ., 60.53840.98480.8724yesno
Q31DD7NDK_PROM92, ., 7, ., 4, ., 60.59841.00.8684yesno
A2CDK0NDK_PROM32, ., 7, ., 4, ., 60.61361.00.8684yesno
B1WQB7NDK_CYAA52, ., 7, ., 4, ., 60.62121.00.8859yesno
Q96559NDK_HELAN2, ., 7, ., 4, ., 60.58330.99240.8851N/Ano
P50590NDK_SYNE72, ., 7, ., 4, ., 60.58331.00.8859yesno
Q2JVI1NDK_SYNJA2, ., 7, ., 4, ., 60.59841.00.8859yesno
A8G244NDK_PROM22, ., 7, ., 4, ., 60.60601.00.8684yesno
O81372NDK1_MESCR2, ., 7, ., 4, ., 60.58330.99240.8851N/Ano
Q7U3S1NDK_SYNPX2, ., 7, ., 4, ., 60.62871.00.8741yesno
Q3AVV5NDK_SYNS92, ., 7, ., 4, ., 60.62121.00.8741yesno
Q8DM56NDK_THEEB2, ., 7, ., 4, ., 60.62871.00.88yesno
B1XIE7NDK_SYNP22, ., 7, ., 4, ., 60.57571.00.8859yesno
A2BNH4NDK_PROMS2, ., 7, ., 4, ., 60.58331.00.8684yesno
B0C4I0NDK_ACAM12, ., 7, ., 4, ., 60.59091.00.8859yesno
Q56E62NDK1_TOBAC2, ., 7, ., 4, ., 60.57570.99240.8851N/Ano
Q6XI71NDKA_DROYA2, ., 7, ., 4, ., 60.54541.00.88N/Ano
Q5N1M1NDK_SYNP62, ., 7, ., 4, ., 60.58331.00.8859yesno
A3PA97NDK_PROM02, ., 7, ., 4, ., 60.59841.00.8684yesno
B2IX22NDK_NOSP72, ., 7, ., 4, ., 60.59841.00.8859yesno
Q3AGP0NDK_SYNSC2, ., 7, ., 4, ., 60.61361.00.8741yesno
O64903NDK2_ARATH2, ., 7, ., 4, ., 60.89391.00.5714yesno
Q7V425NDK_PROMM2, ., 7, ., 4, ., 60.62010.97720.8486yesno
A9B9E7NDK_PROM42, ., 7, ., 4, ., 60.60460.97720.8543yesno
A2BU01NDK_PROM52, ., 7, ., 4, ., 60.56811.00.8684yesno
A6N0M9NDK1_ORYSI2, ., 7, ., 4, ., 60.58330.99240.8791N/Ano
Q2JPL4NDK_SYNJB2, ., 7, ., 4, ., 60.56811.00.8859yesno
B8HUM7NDK_CYAP42, ., 7, ., 4, ., 60.62871.00.8859yesno
B0JHT4NDK_MICAN2, ., 7, ., 4, ., 60.57571.00.8859yesno
Q3AFJ7NDK_CARHZ2, ., 7, ., 4, ., 60.58331.00.8859yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.963
4th Layer2.7.4.60.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 6e-74
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 1e-72
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 1e-70
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 1e-69
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 1e-68
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 5e-63
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 1e-58
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 2e-45
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 7e-44
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 6e-35
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 1e-30
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 9e-30
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 6e-27
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 8e-27
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 1e-24
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-23
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-21
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 2e-20
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 8e-20
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 6e-19
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information 
 Score =  215 bits (551), Expect = 6e-74
 Identities = 68/114 (59%), Positives = 88/114 (77%)

Query: 1   VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           +GEIISRFE+KG K++ LK+ Q  ++LAEEHY +   KPFFP+L+E++TSGPVV M  EG
Sbjct: 17  IGEIISRFERKGLKIVALKMLQLTEELAEEHYAEHKGKPFFPELVEFMTSGPVVAMVLEG 76

Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWF 114
              V + RKL+G+T+P  A PGTIRGD A+  GRN+VHGSDS E+ +REI LWF
Sbjct: 77  ENAVKTVRKLMGATNPADAAPGTIRGDFALSIGRNIVHGSDSVESAEREIALWF 130

The mammalian nm23/NDP kinase gene family can be divided into two distinct groups. The group I genes encode proteins that generally have highly homologous counterparts in other organisms and possess the classic enzymatic activity of a kinase. This group includes vertebrate NDP kinases A-D (Nm23- H1 to -H4), and its counterparts in bacteria, archea and other eukaryotes. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. They possess the NDP kinase active site motif (NXXH[G/A]SD) and the nine residues that are most essential for catalysis. Length = 130
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
KOG0888156 consensus Nucleoside diphosphate kinase [Nucleotid 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-46  Score=268.96  Aligned_cols=131  Identities=61%  Similarity=1.147  Sum_probs=126.1

Q ss_pred             ChHHHHHHHHcCCeEEeeEeecCCHHHHHHHHHHhcCCCChHHHHHHhcCCceEEEEEecCchHHHHHHhhCCCCCCCCC
Q 045706            1 VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAE   80 (132)
Q Consensus         1 ~G~Ii~~i~~~Gf~I~~~km~~ls~e~a~~~y~~~~~~~~~~~l~~~~~sGpvv~l~l~g~nav~~~r~l~G~~~p~~a~   80 (132)
                      +|+||++|+++||.|+++||++||+++|++||.+|.+++||+.|+++|+|||+++|+++|+|||++||+++||+||..|.
T Consensus        19 ~g~Ii~~i~~~Gf~I~~~k~~~lt~~~a~~fY~~~~gk~ff~~Lv~~m~sGp~val~l~g~nav~~~R~l~Gpt~p~~a~   98 (149)
T PTZ00093         19 VGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKGKPFFPGLVKYISSGPVVCMVWEGKNVVKQGRKLLGATNPLESA   98 (149)
T ss_pred             hHHHHHHHHHCCCEEEEeEeecCCHHHHHHHHHHhcCCchHHHHHHHHhcCCEEEEEEeCCCHHHHHHHHhCCCCccccC
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhcccccCCceEEcCCChhHHHHHHhhcCCCCcccccccchhhhhc
Q 045706           81 PGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLR  131 (132)
Q Consensus        81 p~slR~~~g~~~~~N~vh~Sd~~~~a~~e~~~fF~~~~~~~~~~~~~~~~~  131 (132)
                      |+|||+.||++.++|+|||||++++|.+|++|||++.++.+|......++|
T Consensus        99 p~siR~~fg~~~~~NavH~Sds~e~A~~Ei~~fF~~~~~~~~~~~~~~~~~  149 (149)
T PTZ00093         99 PGTIRGDFCVDVGRNVIHGSDSVESAKREIALWFKPEELVSWTSHSSKWIY  149 (149)
T ss_pred             CCcchhhhccccccceeecCCCHHHHHHHHHHhCChhhccCccccchhhhC
Confidence            999999999999999999999999999999999999999999876666543

>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>KOG0888 consensus Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-59
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-37
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 6e-37
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 1e-36
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 7e-36
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 7e-35
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 9e-35
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 1e-34
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 2e-34
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 3e-34
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 5e-34
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 6e-34
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-34
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 9e-34
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 2e-33
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 2e-33
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 2e-33
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 6e-33
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 7e-33
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 8e-33
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 9e-33
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 1e-32
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 2e-32
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 2e-32
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 2e-32
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 5e-32
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 6e-32
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 9e-32
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 9e-32
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 9e-32
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 9e-32
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 1e-31
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 1e-31
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 1e-31
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-31
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 2e-31
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 2e-30
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-30
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-30
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 6e-30
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 7e-28
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 7e-28
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 8e-28
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 2e-27
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 1e-25
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 2e-25
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-24
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 6e-24
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 2e-23
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-23
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 2e-22
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-22
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 2e-21
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 2e-21
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 7e-21
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 7e-21
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 1e-20
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 2e-18
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 2e-17
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 2e-17
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 1e-16
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 1e-16
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 2e-15
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 6e-15
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 9e-15
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure 
Iteration: 1

 Score =  223 bits (567), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 112/132 (84%)
Query: 1   VGEIISRFEXXXXXXXXXXXXQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           VGEIISRFE            QCPK+LAEEHYKDL++K FFP LIEYITSGPVVCMAWEG
Sbjct: 22  VGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEG 81
Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
            GVVASARKLIG TDPLQAEPGTIRGDLAVQTGRN+VHGSDSPENGKREIGLWFKEGELC
Sbjct: 82  VGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELC 141
Query: 121 QWTPAQAQWLRE 132
           +W  A A WLRE
Sbjct: 142 KWDSALATWLRE 153
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 2e-87
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 9e-87
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 1e-86
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 2e-86
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 3e-86
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 3e-86
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 3e-86
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 4e-86
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 5e-86
3js9_A156 Nucleoside diphosphate kinase family protein; niai 7e-86
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 7e-86
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 1e-85
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 1e-85
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 7e-85
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 1e-84
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 1e-84
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 3e-84
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 8e-84
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 2e-83
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 2e-83
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 2e-82
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 5e-81
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 2e-80
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 4e-80
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 2e-79
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 2e-79
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 2e-76
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 3e-76
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 5e-65
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
 Score =  250 bits (640), Expect = 2e-87
 Identities = 118/132 (89%), Positives = 124/132 (93%)

Query: 1   VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           VGEIISRFEKKGFKLIGLK+FQCPK+LAEEHYKDL++K FFP LIEYITSGPVVCMAWEG
Sbjct: 22  VGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEG 81

Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
            GVVASARKLIG TDPLQAEPGTIRGDLAVQTGRN+VHGSDSPENGKREIGLWFKEGELC
Sbjct: 82  VGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELC 141

Query: 121 QWTPAQAQWLRE 132
           +W  A A WLRE
Sbjct: 142 KWDSALATWLRE 153
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.96
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-51  Score=292.78  Aligned_cols=132  Identities=52%  Similarity=0.947  Sum_probs=130.0

Q ss_pred             ChHHHHHHHHcCCeEEeeEeecCCHHHHHHHHHHhcCCCChHHHHHHhcCCceEEEEEecCchHHHHHHhhCCCCCCCCC
Q 045706            1 VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAE   80 (132)
Q Consensus         1 ~G~Ii~~i~~~Gf~I~~~km~~ls~e~a~~~y~~~~~~~~~~~l~~~~~sGpvv~l~l~g~nav~~~r~l~G~~~p~~a~   80 (132)
                      +|+||++|+++||+|+++||++||+++|++||.+++++|||+.|+++|+||||++|+|+|+|||+.||+++|||||..|.
T Consensus        18 ~G~Ii~~ie~~Gf~Iv~~K~~~ls~e~a~~~Y~~h~~kpff~~Lv~~mtSGPvvamvleg~naV~~~R~l~GpTdp~~A~   97 (157)
T 3q8u_A           18 IGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEAS   97 (157)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSTTTSC
T ss_pred             HHHHHHHHHHCCCEEEEEEEecCCHHHHHHHHHHHCCCccHHHHHHHhcCCCEEEEEEeCCCHHHHHHHHcCCCChhhcC
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhcccccCCceEEcCCChhHHHHHHhhcCCCCcccccccchhhhhcC
Q 045706           81 PGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE  132 (132)
Q Consensus        81 p~slR~~~g~~~~~N~vh~Sd~~~~a~~e~~~fF~~~~~~~~~~~~~~~~~~  132 (132)
                      |+|||++||.+..+|+||||||+++|.+|+.+|||+.++++|+.....|+|+
T Consensus        98 PgtIR~~fg~~~~~N~vHgSDs~esA~rEi~~fF~~~e~~~~~~~~~~~~~~  149 (157)
T 3q8u_A           98 PGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLYE  149 (157)
T ss_dssp             TTSHHHHHCCBTTBCSEEECSSHHHHHHHHHHHCCGGGCCCCCCTTHHHHCC
T ss_pred             CCChHHHhCCCCCCeeEEeCCCHHHHHHHHHHcCChHhhcccccchHHHHHH
Confidence            9999999999999999999999999999999999999999999999999985
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-55
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 2e-53
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 1e-51
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-50
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 7e-49
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 8e-48
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 4e-47
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 9e-47
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 9e-47
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 3e-46
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-45
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-45
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 4e-45
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-42
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 6e-41
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 2e-37
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]

 Score =  168 bits (426), Expect = 2e-55
 Identities = 118/132 (89%), Positives = 124/132 (93%)

Query: 1   VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEG 60
           VGEIISRFEKKGFKLIGLK+FQCPK+LAEEHYKDL++K FFP LIEYITSGPVVCMAWEG
Sbjct: 22  VGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEG 81

Query: 61  AGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELC 120
            GVVASARKLIG TDPLQAEPGTIRGDLAVQTGRN+VHGSDSPENGKREIGLWFKEGELC
Sbjct: 82  VGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELC 141

Query: 121 QWTPAQAQWLRE 132
           +W  A A WLRE
Sbjct: 142 KWDSALATWLRE 153
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]

Probab=100.00  E-value=1.2e-50  Score=287.89  Aligned_cols=132  Identities=89%  Similarity=1.496  Sum_probs=130.2

Q ss_pred             ChHHHHHHHHcCCeEEeeEeecCCHHHHHHHHHHhcCCCChHHHHHHhcCCceEEEEEecCchHHHHHHhhCCCCCCCCC
Q 045706            1 VGEIISRFEKKGFKLIGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAE   80 (132)
Q Consensus         1 ~G~Ii~~i~~~Gf~I~~~km~~ls~e~a~~~y~~~~~~~~~~~l~~~~~sGpvv~l~l~g~nav~~~r~l~G~~~p~~a~   80 (132)
                      +|+||++|+++||.|+++||++||+++|++||..|+++|||+.|+++|+|||+++|+|+|+|||++||+++||+||.+|.
T Consensus        22 ~g~Ii~~i~~~Gf~I~~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~mtSGPv~amvl~g~nav~~~r~l~Gpt~p~~A~  101 (153)
T d1s57a_          22 VGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAE  101 (153)
T ss_dssp             HHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTGGGTTSSSHHHHHHHHTSSCEEEEEEEETTHHHHHHHHHCCSSTTTSC
T ss_pred             HHHHHHHHHHCCCEEEEEEeecCCHHHHHHHHHHHhcchhHHHHHhhccCCCeeeeeecccchhhhHHHhccCCCccccC
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhcccccCCceEEcCCChhHHHHHHhhcCCCCcccccccchhhhhcC
Q 045706           81 PGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE  132 (132)
Q Consensus        81 p~slR~~~g~~~~~N~vh~Sd~~~~a~~e~~~fF~~~~~~~~~~~~~~~~~~  132 (132)
                      |+|||++||.+..+|++|||||+++|.||+.||||+.++++|++.+++|.|+
T Consensus       102 p~tiR~~yg~~~~~N~vHgSds~esA~rEi~~fFp~~ei~~~~~~~~~~~~~  153 (153)
T d1s57a_         102 PGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE  153 (153)
T ss_dssp             TTSHHHHHCCBTTBCCEEECSSHHHHHHHHHHHSCTTCCCCCCCTTHHHHCC
T ss_pred             CCCchhhheeeccCceeECCCCHHHHHHHHHHccChhhcccCcccccccccC
Confidence            9999999999999999999999999999999999999999999999999985
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure