Citrus Sinensis ID: 045926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| TAIR|locus:504954878 | 309 | SDH2-3 "succinate dehydrogenas | 0.907 | 0.886 | 0.768 | 1.6e-118 | |
| SGD|S000003964 | 266 | SDH2 "Iron-sulfur protein subu | 0.754 | 0.857 | 0.672 | 1.3e-86 | |
| TAIR|locus:2168818 | 280 | SDH2-2 "succinate dehydrogenas | 0.748 | 0.807 | 0.695 | 3e-85 | |
| UNIPROTKB|F1NNF7 | 290 | SDHB "Succinate dehydrogenase | 0.754 | 0.786 | 0.673 | 1.7e-84 | |
| UNIPROTKB|Q9YHT2 | 290 | SDHB "Succinate dehydrogenase | 0.754 | 0.786 | 0.673 | 1.7e-84 | |
| TAIR|locus:2086716 | 279 | SDH2-1 "succinate dehydrogenas | 0.894 | 0.967 | 0.597 | 2.1e-84 | |
| CGD|CAL0000978 | 263 | SDH2 [Candida albicans (taxid: | 0.824 | 0.946 | 0.604 | 1.5e-83 | |
| UNIPROTKB|Q59QN7 | 263 | SDH2 "Putative uncharacterized | 0.824 | 0.946 | 0.604 | 1.5e-83 | |
| POMBASE|SPAC140.01 | 275 | sdh2 "succinate dehydrogenase | 0.748 | 0.821 | 0.659 | 1.9e-83 | |
| FB|FBgn0014028 | 297 | SdhB "Succinate dehydrogenase | 0.844 | 0.858 | 0.590 | 5e-83 |
| TAIR|locus:504954878 SDH2-3 "succinate dehydrogenase 2-3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1167 (415.9 bits), Expect = 1.6e-118, P = 1.6e-118
Identities = 213/277 (76%), Positives = 240/277 (86%)
Query: 27 DFPVLEGHPAAQESAEVALESRVTVQDNV---KKVMKEFRIYRWNPDRPDSKPFLQSYHV 83
DFP+L GH AAQ+ ++ L+S+ ++ K+V KEF+IYRWNPD+P+SKPFLQS+ V
Sbjct: 31 DFPILNGHKAAQDLSKDTLKSQDITKEKEGQHKEVKKEFKIYRWNPDKPNSKPFLQSFFV 90
Query: 84 DLSECGPMVLDALQKIKAETDSSLSYRRSCREGICGSCAMNIGGTNTVACLKPIDGDTSK 143
DLS CGPMVLD LQKIKAE D+SLSYRRSCREGICGSC+MNI GTNTVACLKPI+ +TSK
Sbjct: 91 DLSSCGPMVLDVLQKIKAEDDASLSYRRSCREGICGSCSMNIDGTNTVACLKPINPNTSK 150
Query: 144 PTIITPLPHMFVIKDLVVDLTNFYQQYKSIEPWLKTNMVPKDGREYRQSPADRKKLDGLY 203
PTIITPLPHM+VIKDLVVDLTNFYQQYKS+EPWLKT PKDGRE+RQSP DRKKLDGLY
Sbjct: 151 PTIITPLPHMYVIKDLVVDLTNFYQQYKSMEPWLKTRKPPKDGREHRQSPKDRKKLDGLY 210
Query: 204 ECILCACCTTSCPSYWWNPEEYLGPAALLHAYRWICDSRDELTEERLQALTEDERKLYRC 263
ECILCACCTTSCPSYWWNPEE+ GPAALL AYRWI DSRDE EERLQA+TE E K+YRC
Sbjct: 211 ECILCACCTTSCPSYWWNPEEFPGPAALLQAYRWISDSRDEYREERLQAITESETKVYRC 270
Query: 264 RAIKNCTATCPKGLDPADAIHKMKTKHMLSQPMEMVE 300
RAIKNCTATCPKGL+PA AI KMK+KH+LS P+ E
Sbjct: 271 RAIKNCTATCPKGLNPASAILKMKSKHLLSDPLVRTE 307
|
|
| SGD|S000003964 SDH2 "Iron-sulfur protein subunit of succinate dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168818 SDH2-2 "succinate dehydrogenase 2-2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNF7 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9YHT2 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086716 SDH2-1 "succinate dehydrogenase 2-1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000978 SDH2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59QN7 SDH2 "Putative uncharacterized protein SDH2" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC140.01 sdh2 "succinate dehydrogenase (ubiquinone) iron-sulfur protein subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0014028 SdhB "Succinate dehydrogenase B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| PLN00129 | 276 | PLN00129, PLN00129, succinate dehydrogenase [ubiqu | 1e-171 | |
| PRK05950 | 232 | PRK05950, sdhB, succinate dehydrogenase iron-sulfu | 1e-139 | |
| COG0479 | 234 | COG0479, FrdB, Succinate dehydrogenase/fumarate re | 1e-104 | |
| TIGR00384 | 220 | TIGR00384, dhsB, succinate dehydrogenase and fumar | 5e-99 | |
| PRK12575 | 235 | PRK12575, PRK12575, succinate dehydrogenase iron-s | 2e-88 | |
| PRK12577 | 329 | PRK12577, PRK12577, succinate dehydrogenase iron-s | 8e-59 | |
| PRK12576 | 279 | PRK12576, PRK12576, succinate dehydrogenase iron-s | 8e-56 | |
| PRK12385 | 244 | PRK12385, PRK12385, fumarate reductase iron-sulfur | 8e-50 | |
| pfam13085 | 107 | pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind | 4e-46 | |
| PRK06259 | 486 | PRK06259, PRK06259, succinate dehydrogenase/fumara | 8e-35 | |
| PRK13552 | 239 | PRK13552, frdB, fumarate reductase iron-sulfur sub | 1e-34 | |
| PRK08640 | 249 | PRK08640, sdhB, succinate dehydrogenase iron-sulfu | 1e-23 | |
| PRK12386 | 251 | PRK12386, PRK12386, fumarate reductase iron-sulfur | 9e-18 | |
| pfam13534 | 61 | pfam13534, Fer4_17, 4Fe-4S dicluster domain | 2e-07 | |
| PRK07570 | 250 | PRK07570, PRK07570, succinate dehydrogenase/fumara | 4e-07 | |
| COG0247 | 388 | COG0247, GlpC, Fe-S oxidoreductase [Energy product | 2e-05 | |
| COG1150 | 195 | COG1150, HdrC, Heterodisulfide reductase, subunit | 0.003 | |
| pfam13183 | 54 | pfam13183, Fer4_8, 4Fe-4S dicluster domain | 0.004 |
| >gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
Score = 474 bits (1221), Expect = e-171
Identities = 184/289 (63%), Positives = 212/289 (73%), Gaps = 18/289 (6%)
Query: 6 FLRRGYNKVAGIFGRAEAKKQDFPVLEGHPAAQESAEVALESRVTVQDNVKKVMKEFRIY 65
LRR AG+ PAA SA + E++ + + + +KEF+IY
Sbjct: 5 LLRRLAGAKAGLLA---------------PAAAASAAASAETKASSKGSKPSNLKEFQIY 49
Query: 66 RWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGICGSCAMNI 125
RWNPD P KP LQSY VDL++CGPMVLD L KIK E D SL++RRSCREGICGSCAMNI
Sbjct: 50 RWNPDNP-GKPHLQSYKVDLNDCGPMVLDVLIKIKNEQDPSLTFRRSCREGICGSCAMNI 108
Query: 126 GGTNTVACLKPIDGDTSKPTIITPLPHMFVIKDLVVDLTNFYQQYKSIEPWLKTNMVPKD 185
G NT+ACL ID D S PT ITPLPHMFVIKDLVVD+TNFYQQYKSIEPWLKT P+D
Sbjct: 109 DGKNTLACLTKIDRDESGPTTITPLPHMFVIKDLVVDMTNFYQQYKSIEPWLKTKKPPED 168
Query: 186 GR-EYRQSPADRKKLDGLYECILCACCTTSCPSYWWNPEEYLGPAALLHAYRWICDSRDE 244
G+ E+ QS DR KLDG+YECILCACC+TSCPSYWWNPE++LGPAALLHAYRWI DSRDE
Sbjct: 169 GQKEHLQSKEDRAKLDGMYECILCACCSTSCPSYWWNPEKFLGPAALLHAYRWISDSRDE 228
Query: 245 LTEERLQALTEDERKLYRCRAIKNCTATCPKGLDPADAIHKMKTKHMLS 293
T+ERL+AL DE KLYRC I+NC+ CPKGL+PA AI K+K L
Sbjct: 229 YTKERLEALD-DEFKLYRCHTIRNCSNACPKGLNPAKAIAKIKQLLGLG 276
|
Length = 276 |
| >gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223325 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224072 COG1150, HdrC, Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 100.0 | |
| PLN00129 | 276 | succinate dehydrogenase [ubiquinone] iron-sulfur s | 100.0 | |
| KOG3049 | 288 | consensus Succinate dehydrogenase, Fe-S protein su | 100.0 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 100.0 | |
| PRK12575 | 235 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 100.0 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 100.0 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 100.0 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 100.0 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 100.0 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 100.0 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 100.0 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 100.0 | |
| PF13085 | 110 | Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; | 100.0 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 99.88 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 99.86 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 99.83 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 99.8 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 99.78 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 99.77 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 99.76 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 99.75 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 99.75 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 99.67 | |
| PRK11274 | 407 | glcF glycolate oxidase iron-sulfur subunit; Provis | 99.39 | |
| COG1150 | 195 | HdrC Heterodisulfide reductase, subunit C [Energy | 99.34 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 99.29 | |
| TIGR03290 | 144 | CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s | 99.28 | |
| COG1139 | 459 | Uncharacterized conserved protein containing a fer | 99.26 | |
| TIGR03193 | 148 | 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm | 99.24 | |
| PRK09908 | 159 | xanthine dehydrogenase subunit XdhC; Provisional | 99.21 | |
| TIGR00273 | 432 | iron-sulfur cluster-binding protein. Members of th | 99.17 | |
| COG2080 | 156 | CoxS Aerobic-type carbon monoxide dehydrogenase, s | 99.16 | |
| PRK11168 | 396 | glpC sn-glycerol-3-phosphate dehydrogenase subunit | 99.13 | |
| PRK11433 | 217 | aldehyde oxidoreductase 2Fe-2S subunit; Provisiona | 99.11 | |
| TIGR03198 | 151 | pucE xanthine dehydrogenase E subunit. This gene h | 99.05 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 99.04 | |
| TIGR03379 | 397 | glycerol3P_GlpC glycerol-3-phosphate dehydrogenase | 98.94 | |
| COG0247 | 388 | GlpC Fe-S oxidoreductase [Energy production and co | 98.89 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 98.87 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 98.79 | |
| PRK15055 | 344 | anaerobic sulfite reductase subunit A; Provisional | 98.77 | |
| PRK09800 | 956 | putative hypoxanthine oxidase; Provisional | 98.65 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 98.6 | |
| TIGR02963 | 467 | xanthine_xdhA xanthine dehydrogenase, small subuni | 98.54 | |
| TIGR03313 | 951 | Se_sel_red_Mo probable selenate reductase, molybde | 98.49 | |
| TIGR03311 | 848 | Se_dep_Molyb_1 selenium-dependent molybdenum hydro | 98.48 | |
| TIGR02910 | 334 | sulfite_red_A sulfite reductase, subunit A. Member | 98.44 | |
| PRK00941 | 781 | acetyl-CoA decarbonylase/synthase complex subunit | 98.43 | |
| cd00207 | 84 | fer2 2Fe-2S iron-sulfur cluster binding domain. Ir | 98.42 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 98.41 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 98.38 | |
| cd01916 | 731 | ACS_1 Acetyl-CoA synthase (ACS), also known as ace | 98.38 | |
| KOG2282 | 708 | consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 | 98.37 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 98.35 | |
| TIGR00314 | 784 | cdhA CO dehydrogenase/acetyl-CoA synthase complex, | 98.34 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 98.32 | |
| CHL00134 | 99 | petF ferredoxin; Validated | 98.19 | |
| PLN00192 | 1344 | aldehyde oxidase | 98.17 | |
| PF00111 | 78 | Fer2: 2Fe-2S iron-sulfur cluster binding domain; I | 98.17 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 98.17 | |
| PRK10713 | 84 | 2Fe-2S ferredoxin YfaE; Provisional | 98.16 | |
| TIGR02969 | 1330 | mam_aldehyde_ox aldehyde oxidase. Members of this | 98.12 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 98.11 | |
| TIGR02484 | 372 | CitB CitB domain protein. CobZ is essential for co | 98.1 | |
| TIGR02007 | 110 | fdx_isc ferredoxin, 2Fe-2S type, ISC system. This | 98.1 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 98.07 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 98.07 | |
| TIGR02008 | 97 | fdx_plant ferredoxin [2Fe-2S]. This model represen | 98.05 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 98.03 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 98.01 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 97.98 | |
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 97.9 | |
| PRK15033 | 389 | tricarballylate utilization protein B; Provisional | 97.83 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 97.72 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.7 | |
| PLN03136 | 148 | Ferredoxin; Provisional | 97.63 | |
| PLN02593 | 117 | adrenodoxin-like ferredoxin protein | 97.63 | |
| PTZ00038 | 191 | ferredoxin; Provisional | 97.61 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 97.6 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 97.58 | |
| PTZ00490 | 143 | Ferredoxin superfamily; Provisional | 97.52 | |
| COG0633 | 102 | Fdx Ferredoxin [Energy production and conversion] | 97.52 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 97.48 | |
| PLN02906 | 1319 | xanthine dehydrogenase | 97.43 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 97.42 | |
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 97.41 | |
| PRK14028 | 312 | pyruvate ferredoxin oxidoreductase subunit gamma/d | 97.39 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 97.38 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 97.38 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 97.37 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 97.36 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 97.34 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 97.34 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 97.31 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 97.3 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 97.29 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 97.26 | |
| PRK06273 | 165 | ferredoxin; Provisional | 97.26 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 97.26 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 97.25 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 97.23 | |
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 97.2 | |
| PRK09625 | 133 | porD pyruvate flavodoxin oxidoreductase subunit de | 97.2 | |
| TIGR02512 | 374 | Fe_only_hydrog hydrogenases, Fe-only. This model d | 97.2 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 97.18 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 97.15 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 97.13 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 97.13 | |
| TIGR02494 | 295 | PFLE_PFLC glycyl-radical enzyme activating protein | 97.12 | |
| PRK06991 | 270 | ferredoxin; Provisional | 97.06 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 97.05 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 97.05 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 97.04 | |
| PRK09624 | 105 | porD pyuvate ferredoxin oxidoreductase subunit del | 97.02 | |
| PRK08764 | 135 | ferredoxin; Provisional | 96.97 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 96.96 | |
| PRK09623 | 105 | vorD 2-ketoisovalerate ferredoxin oxidoreductase s | 96.92 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 96.9 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 96.89 | |
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 96.89 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 96.85 | |
| TIGR02179 | 78 | PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta | 96.81 | |
| TIGR00402 | 101 | napF ferredoxin-type protein NapF. The gene codes | 96.78 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 96.75 | |
| TIGR02912 | 314 | sulfite_red_C sulfite reductase, subunit C. Member | 96.74 | |
| COG4630 | 493 | XdhA Xanthine dehydrogenase, iron-sulfur cluster a | 96.73 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 96.69 | |
| PRK09326 | 341 | F420H2 dehydrogenase subunit F; Provisional | 96.57 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 96.5 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 96.47 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 96.42 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 96.25 | |
| KOG0430 | 1257 | consensus Xanthine dehydrogenase [Nucleotide trans | 96.1 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 96.02 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 95.99 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 95.97 | |
| TIGR02060 | 132 | aprB adenosine phosphosulphate reductase, beta sub | 95.94 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 95.92 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 95.89 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 95.87 | |
| TIGR02700 | 234 | flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T | 95.86 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 95.76 | |
| COG1144 | 91 | Pyruvate:ferredoxin oxidoreductase and related 2-o | 95.7 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 95.69 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 95.62 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 95.56 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 95.53 | |
| TIGR00276 | 282 | iron-sulfur cluster binding protein, putative. Thi | 95.51 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 95.49 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 95.37 | |
| TIGR03287 | 391 | methan_mark_16 putative methanogenesis marker 16 m | 95.34 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 95.31 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 95.26 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 95.24 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 95.22 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 95.13 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 95.11 | |
| COG2878 | 198 | Predicted NADH:ubiquinone oxidoreductase, subunit | 95.1 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 95.09 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 95.08 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 95.07 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 95.0 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 94.92 | |
| PRK13795 | 636 | hypothetical protein; Provisional | 94.92 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 94.87 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 94.83 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 94.82 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 94.79 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 94.76 | |
| PRK07118 | 280 | ferredoxin; Validated | 94.73 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 94.64 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 94.61 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 94.58 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 94.51 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 94.49 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 94.45 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 94.39 | |
| TIGR03294 | 228 | FrhG coenzyme F420 hydrogenase, subunit gamma. Thi | 94.33 | |
| PRK07118 | 280 | ferredoxin; Validated | 94.28 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 94.27 | |
| TIGR02486 | 314 | RDH reductive dehalogenase. This model represents | 94.24 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 94.24 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 94.12 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 94.08 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 94.01 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 93.9 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 93.79 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 93.71 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 93.53 | |
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 93.41 | |
| cd07030 | 259 | RNAP_D D subunit of Archaeal RNA polymerase. The D | 93.11 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 93.03 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 92.98 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 92.85 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 92.81 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 92.69 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 92.64 | |
| PRK00783 | 263 | DNA-directed RNA polymerase subunit D; Provisional | 92.44 | |
| COG2221 | 317 | DsrA Dissimilatory sulfite reductase (desulfovirid | 92.34 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 92.27 | |
| COG3894 | 614 | Uncharacterized metal-binding protein [General fun | 91.61 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 91.57 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 91.36 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 90.96 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 90.9 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 90.36 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 90.2 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 90.17 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 89.97 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 89.81 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 89.79 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 89.51 | |
| COG1600 | 337 | Uncharacterized Fe-S protein [Energy production an | 89.4 | |
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 89.27 | |
| PRK15449 | 95 | ferredoxin-like protein FixX; Provisional | 88.91 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 88.44 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 88.39 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 88.05 | |
| PRK01777 | 95 | hypothetical protein; Validated | 88.04 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 88.0 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 87.63 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 87.5 | |
| COG1150 | 195 | HdrC Heterodisulfide reductase, subunit C [Energy | 87.36 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 86.9 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 86.21 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 85.86 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 85.64 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 85.63 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 85.58 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 85.13 | |
| PF10418 | 40 | DHODB_Fe-S_bind: Iron-sulfur cluster binding domai | 84.77 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 84.65 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 84.41 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 84.25 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 83.82 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 83.66 | |
| COG1941 | 247 | FrhG Coenzyme F420-reducing hydrogenase, gamma sub | 83.54 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 83.39 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 82.6 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 82.49 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 82.24 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 82.22 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 82.21 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 81.86 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 81.84 | |
| PF14691 | 111 | Fer4_20: Dihydroprymidine dehydrogenase domain II, | 81.69 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 81.68 | |
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 81.46 | |
| TIGR03290 | 144 | CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s | 81.42 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 80.43 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 80.42 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 80.18 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 80.02 |
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-64 Score=454.04 Aligned_cols=231 Identities=52% Similarity=0.970 Sum_probs=214.0
Q ss_pred eEEEEEEecCCCCCCCCCceeEEEEecCCCchhHHHHHHHcccccCCCcccccCCCCCccCccEEEECCEEecccccccc
Q 045926 59 MKEFRIYRWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGICGSCAMNIGGTNTVACLKPID 138 (302)
Q Consensus 59 ~~~~~I~r~~p~~~~~~~~~~~y~v~~~~~g~tvLdal~~i~~~~dptL~~~~~C~~g~CG~C~V~VnG~~~laC~t~v~ 138 (302)
+++|+|+||||+. + +|||++|+|++++ |+||||||.+|+.++||+|+||.+||+|+||||+|+|||+++|||+|.+.
T Consensus 2 ~~~~~i~R~~p~~-~-~p~~~~yev~~~~-~~~vLdaL~~Ik~e~d~~Lsfr~sCR~gICGSCam~ING~prLAC~t~~~ 78 (234)
T COG0479 2 TLKFKIYRYNPDD-D-KPYWQTYEVPYDE-GMTVLDALLYIKEEQDPTLSFRRSCREGICGSCAMNINGKPRLACKTLMK 78 (234)
T ss_pred cEEEEEEEECCCC-C-CcceEEEEecCCC-CCcHHHHHHHHHHhcCCccchhhhccCCcCCcceeEECCccccchhchhh
Confidence 6899999999998 4 9999999999997 99999999999999999999999999999999999999999999999999
Q ss_pred CCCCCceEEccCCCchhhhhhhhccchhhhhccccccccccCCCCCCCccccCChhHHhhccccccCcccCcccCCCCCc
Q 045926 139 GDTSKPTIITPLPHMFVIKDLVVDLTNFYQQYKSIEPWLKTNMVPKDGREYRQSPADRKKLDGLYECILCACCTTSCPSY 218 (302)
Q Consensus 139 ~~~~~~~~Iepl~~~~vikDLvvD~~~~~~~~~~~~~~l~~~~~~~~~~e~~~s~~~~~~~~~~~~CI~CG~C~~aCP~~ 218 (302)
+.....++|+||++||+|||||||+++||+++++++||+.......+++ ++|++++++.++++..||.||.|+++||++
T Consensus 79 ~~~~~~i~iePL~~fpVIkDLVVD~~~f~~~~~~ikp~~~~~~~~~~~~-~~q~pe~~~~~~~~~~CI~Cg~C~s~CP~~ 157 (234)
T COG0479 79 DLEEGVITIEPLPNFPVIRDLVVDMEEFYEKLRKIKPYLIRDDEPDPGE-RLQSPEEREKLDELSECILCGCCTAACPSI 157 (234)
T ss_pred hccCCceEEEECCCCCceeeeeeccHHHHHhhhccccceecCCcCCCcc-ccCCHHHHHHHHhhhhccccchhhhhCCcc
Confidence 8654589999999999999999999999999999999998853333334 899999999999999999999999999999
Q ss_pred ccCCCCcccHHHHHHHHHHhccCcchhHHHHHHHhhhcccccccCcccccccccCCCCCCHHHHHHHHHHHHhhcCC
Q 045926 219 WWNPEEYLGPAALLHAYRWICDSRDELTEERLQALTEDERKLYRCRAIKNCTATCPKGLDPADAIHKMKTKHMLSQP 295 (302)
Q Consensus 219 ~~~~~~~lgP~~l~~a~r~~~d~rd~~~~~rl~~~~~~~~~~~~C~~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~~~ 295 (302)
++++ +|+||+++.+++||+.|+||+.+.+|+..+.++. ++|.|++|++|+++||+||++..+|..||+.+++++.
T Consensus 158 ~~~~-~f~GPa~l~~a~R~~~D~rd~~~~~R~~~~~~~~-gv~~C~~~~~C~~vCPK~i~p~~aI~~lk~~~~~~~~ 232 (234)
T COG0479 158 WWNP-DFLGPAALRQAYRFLADSRDEGTAERLKILEDPD-GVWRCTTCGNCTEVCPKGIPPAKAIAELKRRLAKRGL 232 (234)
T ss_pred cccc-CCcCHHHHHHHHHHhcCCcccchHHHHHhccCCC-CEecccccccccccCCCCCCHHHHHHHHHHHHHHHhc
Confidence 9765 8999999999999999999998888998777666 8999999999999999999999999999998877653
|
|
| >PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
| >KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C | Back alignment and domain information |
|---|
| >COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit | Back alignment and domain information |
|---|
| >PRK09908 xanthine dehydrogenase subunit XdhC; Provisional | Back alignment and domain information |
|---|
| >TIGR00273 iron-sulfur cluster-binding protein | Back alignment and domain information |
|---|
| >COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03198 pucE xanthine dehydrogenase E subunit | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit | Back alignment and domain information |
|---|
| >COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >PRK15055 anaerobic sulfite reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK09800 putative hypoxanthine oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit | Back alignment and domain information |
|---|
| >TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit | Back alignment and domain information |
|---|
| >TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 | Back alignment and domain information |
|---|
| >TIGR02910 sulfite_red_A sulfite reductase, subunit A | Back alignment and domain information |
|---|
| >PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA | Back alignment and domain information |
|---|
| >KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >CHL00134 petF ferredoxin; Validated | Back alignment and domain information |
|---|
| >PLN00192 aldehyde oxidase | Back alignment and domain information |
|---|
| >PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10713 2Fe-2S ferredoxin YfaE; Provisional | Back alignment and domain information |
|---|
| >TIGR02969 mam_aldehyde_ox aldehyde oxidase | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >TIGR02484 CitB CitB domain protein | Back alignment and domain information |
|---|
| >TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >TIGR02008 fdx_plant ferredoxin [2Fe-2S] | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK15033 tricarballylate utilization protein B; Provisional | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN03136 Ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PLN02593 adrenodoxin-like ferredoxin protein | Back alignment and domain information |
|---|
| >PTZ00038 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >PTZ00490 Ferredoxin superfamily; Provisional | Back alignment and domain information |
|---|
| >COG0633 Fdx Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >PLN02906 xanthine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >TIGR02512 Fe_only_hydrog hydrogenases, Fe-only | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >TIGR00402 napF ferredoxin-type protein NapF | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02912 sulfite_red_C sulfite reductase, subunit C | Back alignment and domain information |
|---|
| >COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >PRK09326 F420H2 dehydrogenase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >KOG0430 consensus Xanthine dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >TIGR00276 iron-sulfur cluster binding protein, putative | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK13795 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02486 RDH reductive dehalogenase | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07030 RNAP_D D subunit of Archaeal RNA polymerase | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >PRK00783 DNA-directed RNA polymerase subunit D; Provisional | Back alignment and domain information |
|---|
| >COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >COG3894 Uncharacterized metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1600 Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK15449 ferredoxin-like protein FixX; Provisional | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 302 | ||||
| 1yq3_B | 252 | Avian Respiratory Complex Ii With Oxaloacetate And | 9e-90 | ||
| 3abv_B | 252 | Crystal Structure Of Porcine Heart Mitochondrial Co | 2e-86 | ||
| 1zoy_B | 252 | Crystal Structure Of Mitochondrial Respiratory Comp | 2e-86 | ||
| 3vr8_B | 282 | Mitochondrial Rhodoquinol-Fumarate Reductase From T | 7e-79 | ||
| 1nek_B | 238 | Complex Ii (Succinate Dehydrogenase) From E. Coli W | 2e-64 | ||
| 2wp9_B | 238 | Crystal Structure Of The E. Coli Succinate:quinone | 3e-64 | ||
| 1kf6_B | 243 | E. Coli Quinol-Fumarate Reductase With Bound Inhibi | 4e-31 | ||
| 2bs2_B | 241 | Quinol:fumarate Reductase From Wolinella Succinogen | 3e-24 | ||
| 1qlb_B | 239 | Respiratory Complex Ii-Like Fumarate Reductase From | 4e-24 |
| >pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 | Back alignment and structure |
|
| >pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 | Back alignment and structure |
| >pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 | Back alignment and structure |
| >pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 | Back alignment and structure |
| >pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 | Back alignment and structure |
| >pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 | Back alignment and structure |
| >pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 | Back alignment and structure |
| >pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 | Back alignment and structure |
| >pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 1e-139 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 1e-139 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 1e-138 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 1e-133 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 1e-129 | |
| 3kwl_A | 514 | Uncharacterized protein; putative oxidoreductase, | 2e-57 |
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 | Back alignment and structure |
|---|
Score = 391 bits (1006), Expect = e-139
Identities = 66/233 (28%), Positives = 103/233 (44%), Gaps = 4/233 (1%)
Query: 59 MKEFRIYRWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGIC 118
M R+++++P SKP Q Y ++ + L I+ D L++ CR GIC
Sbjct: 4 MLTIRVFKYDPQSAVSKPHFQEYKIEE-APSMTIFIVLNMIRETYDPDLNFDFVCRAGIC 62
Query: 119 GSCAMNIGGTNTVACLKPIDGDTSKPTIITPLPHMFVIKDLVVDLTNFY-QQYKSIEPWL 177
GSC M I G ++AC + PLP +IKDL VD N++ + +E W+
Sbjct: 63 GSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWI 122
Query: 178 KTNMVPKDG-REYRQSPADRKKLDGLYECILCACCTTSCPSYWWNPEEYLGPAALLHAYR 236
E R P +++ L CI C CC +C + +++G A L R
Sbjct: 123 HAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMRE-DFVGAAGLNRVVR 181
Query: 237 WICDSRDELTEERLQALTEDERKLYRCRAIKNCTATCPKGLDPADAIHKMKTK 289
++ D DE T+E L D+ ++ C + C CPK L I ++ K
Sbjct: 182 FMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRK 234
|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 | Back alignment and structure |
|---|
| >3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 100.0 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 100.0 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 100.0 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 100.0 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 100.0 | |
| 3kwl_A | 514 | Uncharacterized protein; putative oxidoreductase, | 100.0 | |
| 1rm6_C | 161 | 4-hydroxybenzoyl-COA reductase gamma subunit; xant | 99.83 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 99.79 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 99.77 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 99.72 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 99.64 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 99.62 | |
| 3hrd_D | 160 | Nicotinate dehydrogenase small FES subunit; seleni | 99.41 | |
| 2w3s_A | 462 | Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 | 99.11 | |
| 1vlb_A | 907 | Aldehyde oxidoreductase; iron-sulphur cluster; HET | 99.1 | |
| 3nvw_A | 164 | Xanthine dehydrogenase/oxidase; hydroxylase, homod | 99.08 | |
| 1dgj_A | 907 | Aldehyde oxidoreductase; beta half-barrel, four-he | 99.03 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 98.58 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 98.54 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 98.51 | |
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 98.49 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 98.44 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 98.41 | |
| 1wri_A | 93 | Ferredoxin II, ferredoxin; electron transport; 1.2 | 98.4 | |
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 98.38 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 98.29 | |
| 3unc_A | 1332 | Xanthine dehydrogenase/oxidase; oxidoreductase; HE | 98.27 | |
| 3ah7_A | 113 | [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur | 98.18 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 98.18 | |
| 1l5p_A | 93 | Ferredoxin; [2Fe-2S] cluster, electron transfer, i | 98.17 | |
| 1i7h_A | 111 | Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch | 98.14 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 98.08 | |
| 2wlb_A | 103 | ETP1-FD, electron transfer protein 1, mitochondria | 98.03 | |
| 2y5c_A | 109 | Adrenodoxin-like protein, mitochondrial; electron | 97.85 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 97.84 | |
| 2bt6_A | 108 | Adrenodoxin 1; ruthenium(II) bipyridyl complex, in | 97.8 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 97.66 | |
| 1b9r_A | 105 | Protein (terpredoxin); structure from molmol, ferr | 97.56 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 97.55 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 97.52 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 97.5 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 97.48 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 97.48 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 97.46 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 97.45 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 97.39 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 97.39 | |
| 3lxf_A | 104 | Ferredoxin; iron, iron-sulfur, metal-binding, meta | 97.39 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 97.36 | |
| 3hui_A | 126 | Ferredoxin; cytochrome P450, electron transfer, ir | 97.35 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 97.32 | |
| 3zyv_A | 1335 | AOH1; oxidoreductase, molybdenum cofactor; HET: MT | 97.32 | |
| 1xlq_A | 106 | Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored | 97.28 | |
| 1uwm_A | 106 | Ferredoxin VI, FDVI; electron transport, metal-bin | 97.24 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 97.18 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 97.17 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 97.17 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 97.07 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 97.03 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 96.85 | |
| 3n9z_C | 123 | Adrenodoxin; cytochrome P450, 22-hydroxycholestero | 96.81 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 96.76 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.69 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 96.68 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.64 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 96.6 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 96.2 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 96.11 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 95.95 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 95.87 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 95.84 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 95.68 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 95.61 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 95.21 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 95.18 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 95.07 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 94.83 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 94.75 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 94.63 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 94.62 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 91.94 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 90.09 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 89.96 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 89.66 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 89.61 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 89.5 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 89.39 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 88.72 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 87.63 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 87.56 | |
| 3mm5_A | 418 | Sulfite reductase, dissimilatory-type subunit ALP; | 86.99 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 86.95 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 86.77 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 86.18 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 85.26 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 83.41 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 83.35 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 82.45 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 82.33 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 81.66 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 81.49 |
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.4e-62 Score=449.27 Aligned_cols=241 Identities=57% Similarity=1.057 Sum_probs=217.3
Q ss_pred ccceeEEEEEEecCCCCCCCCCceeEEEEecCCCchhHHHHHHHcccccCCCcccccCCCCCccCccEEEECCEEecccc
Q 045926 55 VKKVMKEFRIYRWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGICGSCAMNIGGTNTVACL 134 (302)
Q Consensus 55 ~~~~~~~~~I~r~~p~~~~~~~~~~~y~v~~~~~g~tvLdal~~i~~~~dptL~~~~~C~~g~CG~C~V~VnG~~~laC~ 134 (302)
..+++++|+||||||+.++++|||++|+|+++++|+||||||++|+.++||+|+|+.+|+.|+||+|+|+|||++++||.
T Consensus 31 ~~~~~~~~~I~R~~p~~~~~~p~~~~~~v~v~~~~~tlLdaL~~i~~~~~ptl~~~~~C~~G~CGsC~V~InG~~~laC~ 110 (282)
T 3vr8_B 31 TGKRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACI 110 (282)
T ss_pred CCCeeEEEEEEEeCCCCCCCCCCcEEEEEEeCCCCCcHHHHHHhcCcccCCceeecCCCCCCCCCCCEEEECCEEecchh
Confidence 45678999999999997788999999999997658999999999997789999999999999999999999999999999
Q ss_pred ccccCCCCCceEEccCCCchhhhhhhhccchhhhhccccccccccCCCCC-CCccccCChhHHhhccccccCcccCcccC
Q 045926 135 KPIDGDTSKPTIITPLPHMFVIKDLVVDLTNFYQQYKSIEPWLKTNMVPK-DGREYRQSPADRKKLDGLYECILCACCTT 213 (302)
Q Consensus 135 t~v~~~~~~~~~Iepl~~~~vikDLvvD~~~~~~~~~~~~~~l~~~~~~~-~~~e~~~s~~~~~~~~~~~~CI~CG~C~~ 213 (302)
|++.+..++.++||||++||+|||||||+++||++|++++||+......+ ...+++|++++++.++++..||+||+|++
T Consensus 111 t~v~~~~~~~~tIepL~~~pVikDLvvD~~~f~~~~~~v~p~l~~~~~~~~~~~~~~qs~~~~~~~~~~~~CI~CG~C~~ 190 (282)
T 3vr8_B 111 CNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSA 190 (282)
T ss_pred hhHhHhcCCcEEeccCCCCceeeccccccHHHHHHHHHHhhhcCCCCCCCCCchhcccCHHHHHHHHhhhhCcccCcCcc
Confidence 99986556789999999999999999999999999999999998765432 24578899999999999999999999999
Q ss_pred CCCCcccCCCCcccHHHHHHHHHHhccCcchhHHHHHHHhhhcccccccCcccccccccCCCCCCHHHHHHHHHHHHhhc
Q 045926 214 SCPSYWWNPEEYLGPAALLHAYRWICDSRDELTEERLQALTEDERKLYRCRAIKNCTATCPKGLDPADAIHKMKTKHMLS 293 (302)
Q Consensus 214 aCP~~~~~~~~~lgP~~l~~a~r~~~d~rd~~~~~rl~~~~~~~~~~~~C~~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~ 293 (302)
+||++++++++|+||+++++++|++.++++....++++.+.+.. ++|.|++||+|+++||+||++.++|..+|+.+++.
T Consensus 191 aCP~~~~~~~~~lGP~~li~a~r~~~d~rd~~~~erl~~l~~~~-~l~~C~~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~ 269 (282)
T 3vr8_B 191 SCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGF-SAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKM 269 (282)
T ss_pred cCCceeccCCcCCCHHHHHHHHHHHhCCcccchHHHHHHHhhcC-CcccChhhCCccccCcCCCCHHHHHHHHHHHHHHh
Confidence 99999988788999999999999988988866667776654444 89999999999999999999999999999999876
Q ss_pred CCc
Q 045926 294 QPM 296 (302)
Q Consensus 294 ~~~ 296 (302)
+.+
T Consensus 270 ~~k 272 (282)
T 3vr8_B 270 KTK 272 (282)
T ss_pred ccC
Confidence 544
|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* | Back alignment and structure |
|---|
| >1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* | Back alignment and structure |
|---|
| >3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* | Back alignment and structure |
|---|
| >1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A | Back alignment and structure |
|---|
| >1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* | Back alignment and structure |
|---|
| >3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A | Back alignment and structure |
|---|
| >2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} | Back alignment and structure |
|---|
| >1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A | Back alignment and structure |
|---|
| >1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 302 | ||||
| d2bs2b2 | 106 | d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur | 8e-37 | |
| d1kf6b2 | 105 | d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur | 8e-35 | |
| d1nekb1 | 132 | a.1.2.1 (B:107-238) Succinate dehydogenase {Escher | 2e-34 | |
| d1kf6b1 | 138 | a.1.2.1 (B:106-243) Fumarate reductase {Escherichi | 2e-34 | |
| d2bs2b1 | 133 | a.1.2.1 (B:107-239) Fumarate reductase {Wolinella | 5e-34 | |
| d1nekb2 | 106 | d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul | 1e-31 |
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin domains from multidomain proteins domain: Fumarate reductase iron-sulfur protein, N-terminal domain species: Wolinella succinogenes [TaxId: 844]
Score = 125 bits (315), Expect = 8e-37
Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
Query: 59 MKEFRIYRWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGIC 118
M R+++++P SKP Q Y ++ + + L I+ D L++ CR GIC
Sbjct: 4 MLTIRVFKYDPQSAVSKPHFQEYKIEEA-PSMTIFIVLNMIRETYDPDLNFDFVCRAGIC 62
Query: 119 GSCAMNIGGTNTVACLKPIDGDTSKPTIITPLPHMFVIKDLVVD 162
GSC M I G ++AC + PLP +IKDL VD
Sbjct: 63 GSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVD 106
|
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| d2bs2b2 | 106 | Fumarate reductase iron-sulfur protein, N-terminal | 100.0 | |
| d1kf6b2 | 105 | Fumarate reductase iron-sulfur protein, N-terminal | 100.0 | |
| d1nekb2 | 106 | Succinate dehydogenase iron-sulfur protein, N-term | 100.0 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 99.94 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 99.93 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 99.88 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 99.41 | |
| d1rm6c2 | 81 | 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, | 99.39 | |
| d1t3qa2 | 81 | Quinoline 2-oxidoreductase small subunit QorS, N-d | 99.39 | |
| d1ffva2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 99.38 | |
| d1vlba2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 99.35 | |
| d1dgja2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 99.33 | |
| d1n62a2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 99.31 | |
| d1jroa2 | 84 | Xanthine dehydrogenase chain A, N-terminal domain | 99.09 | |
| d2fug33 | 95 | Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi | 98.95 | |
| d1v97a2 | 90 | Xanthine oxidase, N-terminal domain {Cow (Bos taur | 98.88 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 98.43 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 98.31 | |
| d1czpa_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 98.28 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 98.27 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 98.26 | |
| d1a70a_ | 97 | 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta | 98.11 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 98.09 | |
| d1krha3 | 104 | Benzoate dioxygenase reductase, N-terminal domain | 98.04 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 98.01 | |
| d1awda_ | 94 | 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | 98.0 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 97.98 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 97.98 | |
| d1frra_ | 95 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 97.96 | |
| d1iuea_ | 98 | 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa | 97.94 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 97.93 | |
| d1frda_ | 98 | 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), | 97.92 | |
| d2piaa3 | 98 | Phthalate dioxygenase reductase, C-terminal domain | 97.89 | |
| d1jq4a_ | 98 | Methane monooxygenase reductase N-terminal domain | 97.87 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 97.74 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 97.74 | |
| d1wria_ | 93 | 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] | 97.72 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 97.72 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 97.55 | |
| d1l5pa_ | 93 | 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 | 97.53 | |
| d1doia_ | 128 | 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui | 97.48 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 97.48 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 97.42 | |
| d1e9ma_ | 106 | 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo | 97.4 | |
| d1i7ha_ | 109 | Adrenodoxin-like ferredoxin {Escherichia coli [Tax | 97.37 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 97.35 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 97.26 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 97.26 | |
| d2bt6a1 | 104 | Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | 97.17 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 97.0 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 96.97 | |
| d1xlqa1 | 106 | 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox | 96.52 | |
| d1b9ra_ | 105 | 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T | 96.47 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 96.28 | |
| d1vlfn2 | 195 | Transhydroxylase beta subunit, BthL, N-terminal do | 96.07 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 95.78 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 95.7 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 95.58 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 94.24 | |
| d1h0hb_ | 214 | Tungsten containing formate dehydrogenase, small s | 94.2 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 92.82 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 92.64 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 92.17 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 91.7 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 91.41 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 91.35 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 91.22 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 91.13 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 90.41 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 89.92 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 89.78 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 88.82 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 88.82 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 88.47 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 88.17 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 87.29 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 86.67 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 86.02 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 85.89 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 85.31 | |
| d1gtea1 | 182 | Dihydropyrimidine dehydrogenase, N-terminal domain | 84.71 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 82.6 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 82.41 | |
| d2v4jb1 | 69 | DsrB insert domain {Desulfovibrio vulgaris [TaxId: | 81.87 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 81.41 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 81.19 |
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: 2Fe-2S ferredoxin-like family: 2Fe-2S ferredoxin domains from multidomain proteins domain: Fumarate reductase iron-sulfur protein, N-terminal domain species: Wolinella succinogenes [TaxId: 844]
Probab=100.00 E-value=3.3e-37 Score=243.44 Aligned_cols=105 Identities=32% Similarity=0.616 Sum_probs=100.0
Q ss_pred ceeEEEEEEecCCCCCCCCCceeEEEEecCCCchhHHHHHHHcccccCCCcccccCCCCCccCccEEEECCEEecccccc
Q 045926 57 KVMKEFRIYRWNPDRPDSKPFLQSYHVDLSECGPMVLDALQKIKAETDSSLSYRRSCREGICGSCAMNIGGTNTVACLKP 136 (302)
Q Consensus 57 ~~~~~~~I~r~~p~~~~~~~~~~~y~v~~~~~g~tvLdal~~i~~~~dptL~~~~~C~~g~CG~C~V~VnG~~~laC~t~ 136 (302)
+++++|+||||||+++..+|||++|+|++.+ ++||||||.+|+.++||+|+||.+||+|+||+|+|+|||+++|||+|.
T Consensus 2 ~~~i~l~I~R~~p~~~~~~~~~~~y~v~~~~-~~tvld~L~~Ik~~~D~sl~fr~sCr~giCGsCam~ING~~~lAC~t~ 80 (106)
T d2bs2b2 2 GRMLTIRVFKYDPQSAVSKPHFQEYKIEEAP-SMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTL 80 (106)
T ss_dssp CCEEEEEEEECCTTCTTCCCEEEEEEEECCT-TCBHHHHHHHHHHHTCTTCCCCCSSSSSSSCTTEEEETTEEEEGGGCB
T ss_pred CcEEEEEEEEECCCCCCCCceEEEEEecCCC-CCcHHHHHHHHHHhcCCcEEEEeCcCCCCCCcceEEECCccccceeee
Confidence 4789999999999997789999999999987 899999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCceEEccCCCchhhhhhhhc
Q 045926 137 IDGDTSKPTIITPLPHMFVIKDLVVD 162 (302)
Q Consensus 137 v~~~~~~~~~Iepl~~~~vikDLvvD 162 (302)
+.+..++.++||||++||+|||||||
T Consensus 81 v~~~~~~~i~iePl~~~pVIkDLvVD 106 (106)
T d2bs2b2 81 TKDFEDGVITLLPLPAFKLIKDLSVD 106 (106)
T ss_dssp GGGCTTSEEEEECCTTSEEEETTEEE
T ss_pred eeccCCCeEEEEECCCCCccccCCcC
Confidence 99876778999999999999999998
|
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} | Back information, alignment and structure |
|---|
| >d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} | Back information, alignment and structure |
|---|
| >d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|