Citrus Sinensis ID: 046223
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 408 | ||||||
| 148927338 | 677 | terminal ear1-like 2 protein [Populus tr | 0.850 | 0.512 | 0.472 | 4e-90 | |
| 255547976 | 622 | arginine/serine-rich splicing factor, pu | 0.811 | 0.532 | 0.501 | 2e-87 | |
| 225424576 | 658 | PREDICTED: protein terminal ear1-like [V | 0.879 | 0.545 | 0.471 | 1e-86 | |
| 224100115 | 590 | predicted protein [Populus trichocarpa] | 0.825 | 0.571 | 0.496 | 4e-86 | |
| 224107727 | 557 | predicted protein [Populus trichocarpa] | 0.681 | 0.499 | 0.584 | 1e-83 | |
| 449500381 | 644 | PREDICTED: protein terminal ear1-like [C | 0.669 | 0.423 | 0.521 | 2e-81 | |
| 449517014 | 750 | PREDICTED: LOW QUALITY PROTEIN: protein | 0.705 | 0.384 | 0.515 | 2e-77 | |
| 449435442 | 659 | PREDICTED: protein terminal ear1-like [C | 0.705 | 0.437 | 0.512 | 1e-74 | |
| 449450610 | 637 | PREDICTED: protein terminal ear1-like [C | 0.651 | 0.417 | 0.490 | 3e-73 | |
| 297814854 | 603 | hypothetical protein ARALYDRAFT_322753 [ | 0.637 | 0.431 | 0.464 | 2e-65 |
| >gi|148927338|gb|ABR19818.1| terminal ear1-like 2 protein [Populus tremula x Populus alba] | Back alignment and taxonomy information |
|---|
Score = 338 bits (866), Expect = 4e-90, Method: Compositional matrix adjust.
Identities = 210/444 (47%), Positives = 260/444 (58%), Gaps = 97/444 (21%)
Query: 1 MGETGISRFQGNLDPRAQEFRPTTL----FRPP-----------------------QVYY 33
M E G +F GNLDPRAQEFRP F P QVYY
Sbjct: 1 MEENGSVQFPGNLDPRAQEFRPRRDNLHNFSPKFLPFGPPTPPLPPPPPPPSQLPHQVYY 60
Query: 34 PYGAASPPTLPPYPSNDVQVVPFGG-VGYAQYPTH-PQLGV-----PLPPPSTGPTRTLV 86
PY QV+PF VG+AQY H P V P PP+ PTRTLV
Sbjct: 61 PYTP--------------QVLPFSDFVGFAQYDHHIPPAYVRVEPSPPLPPTGAPTRTLV 106
Query: 87 LSYVPGDVSETIVRRDLEVFGEVRGVQMERLMEGIVTVHFYDLRHAEMAFKEIREQHMQL 146
LS VP +V+E++++R+LEVFGEVRGVQMER+ G VTVHFYDLRHAE A +EIREQHM
Sbjct: 107 LSSVPSEVNESLIKRELEVFGEVRGVQMERVGYGTVTVHFYDLRHAERALREIREQHMLH 166
Query: 147 QQQSYGLKNPYSSGLMLMNNDNNNNNLATGCYDNQVVAESLMIMNSYAPVLPPPARGLVA 206
Q + L+N + N+++ + N+A P PPPARG++A
Sbjct: 167 QAR---LRN-----FFIQNSESISFNIA--------------------PTPPPPARGVIA 198
Query: 207 GRPVWAQFIVPTCNAVPDGNNQGTIVVFNLDSGVSSSTLKEIFQAFGPVKELRETPLKKH 266
G VWAQFI+P+CN VPDG NQGT+VVFNLD VS+ +LKEIFQAFG VKE+RETPLK+H
Sbjct: 199 GCVVWAQFIIPSCNEVPDGQNQGTLVVFNLDPNVSTRSLKEIFQAFGAVKEVRETPLKRH 258
Query: 267 QRFIEFYDVRDAAKALKEMNGQEIYGKHVVIEFSRPGGHSKKFFYANSSSCASSLNYSTI 326
QRF+EFYDVRDAAKAL+EMNG+EIYGK V IEFSRPGGH K+FF A + + + + +
Sbjct: 259 QRFVEFYDVRDAAKALREMNGKEIYGKQVDIEFSRPGGHGKRFFNARPRTTSKNSFTTPV 318
Query: 327 YQT----RNSDCP------PPPL------SADPPSYSPRSFASQAPHFRKKSPSNSFKGN 370
+ + R+S PPPL PP+ SPRSF S+ K PS G+
Sbjct: 319 FDSTTNLRHSKVAAFVSPQPPPLLHRFSSGCSPPNVSPRSFLSETQSSAGKKPS----GD 374
Query: 371 PNNVN-VTCSIEPSVASLSLANAI 393
P+ N + SIE S+ LS+ +
Sbjct: 375 PSEGNPIEASIEASLGCLSMGGDV 398
|
Source: Populus tremula x Populus alba Species: Populus tremula x Populus alba Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255547976|ref|XP_002515045.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223546096|gb|EEF47599.1| arginine/serine-rich splicing factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225424576|ref|XP_002282117.1| PREDICTED: protein terminal ear1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224100115|ref|XP_002311749.1| predicted protein [Populus trichocarpa] gi|222851569|gb|EEE89116.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224107727|ref|XP_002314579.1| predicted protein [Populus trichocarpa] gi|222863619|gb|EEF00750.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449500381|ref|XP_004161082.1| PREDICTED: protein terminal ear1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449517014|ref|XP_004165541.1| PREDICTED: LOW QUALITY PROTEIN: protein terminal ear1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449435442|ref|XP_004135504.1| PREDICTED: protein terminal ear1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449450610|ref|XP_004143055.1| PREDICTED: protein terminal ear1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297814854|ref|XP_002875310.1| hypothetical protein ARALYDRAFT_322753 [Arabidopsis lyrata subsp. lyrata] gi|297321148|gb|EFH51569.1| hypothetical protein ARALYDRAFT_322753 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 408 | ||||||
| TAIR|locus:2090350 | 615 | TEL1 "terminal EAR1-like 1" [A | 0.267 | 0.177 | 0.715 | 4e-64 | |
| TAIR|locus:2008530 | 527 | TEL2 "terminal EAR1-like 2" [A | 0.269 | 0.208 | 0.636 | 2.6e-59 | |
| TAIR|locus:2013583 | 800 | ML5 "MEI2-like protein 5" [Ara | 0.223 | 0.113 | 0.538 | 6.9e-23 | |
| TAIR|locus:2045605 | 843 | ML2 "MEI2-like 2" [Arabidopsis | 0.247 | 0.119 | 0.475 | 2e-22 | |
| TAIR|locus:2117706 | 759 | ML3 "MEI2-like 3" [Arabidopsis | 0.247 | 0.133 | 0.485 | 1.4e-20 | |
| TAIR|locus:2156166 | 915 | ML1 "MEI2-like protein 1" [Ara | 0.460 | 0.205 | 0.242 | 4.8e-11 | |
| TAIR|locus:2182885 | 907 | ML4 "MEI2-like 4" [Arabidopsis | 0.458 | 0.206 | 0.247 | 8.2e-11 | |
| UNIPROTKB|E7ETC0 | 135 | TIAL1 "Nucleolysin TIAR" [Homo | 0.205 | 0.622 | 0.352 | 6.8e-07 | |
| DICTYBASE|DDB_G0279255 | 1698 | DDB_G0279255 [Dictyostelium di | 0.218 | 0.052 | 0.298 | 2.6e-06 | |
| GENEDB_PFALCIPARUM|PF13_0122 | 125 | PF13_0122 "cyclophilin, putati | 0.188 | 0.616 | 0.321 | 3.9e-06 |
| TAIR|locus:2090350 TEL1 "terminal EAR1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 421 (153.3 bits), Expect = 4.0e-64, Sum P(2) = 4.0e-64
Identities = 78/109 (71%), Positives = 91/109 (83%)
Query: 201 ARGLVAGRPVWAQFIVPTCNAVPDGNNQGTIVVFNLDSGVSSSTLKEIFQAFGPVKELRE 260
ARG V+GRPVWAQF+VP +AVP G NQGT+V+FNLD VSS TL++IFQ +GP+KELRE
Sbjct: 185 ARGFVSGRPVWAQFVVPATSAVPGGCNQGTLVIFNLDPEVSSITLRQIFQVYGPIKELRE 244
Query: 261 TPLKKHQRFIEFYDVRDAAKALKEMNGQEIYGKHVVIEFSRPGGHSKKF 309
TP KKHQRF+EFYDVRDAA+A MNG+EI GK VVIEFSRPGG +F
Sbjct: 245 TPYKKHQRFVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSRPGGIKNRF 293
|
|
| TAIR|locus:2008530 TEL2 "terminal EAR1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013583 ML5 "MEI2-like protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045605 ML2 "MEI2-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117706 ML3 "MEI2-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156166 ML1 "MEI2-like protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182885 ML4 "MEI2-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ETC0 TIAL1 "Nucleolysin TIAR" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279255 DDB_G0279255 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF13_0122 PF13_0122 "cyclophilin, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 408 | |||
| cd12527 | 71 | cd12527, RRM2_EAR1_like, RNA recognition motif 2 i | 2e-36 | |
| cd12526 | 71 | cd12526, RRM1_EAR1_like, RNA recognition motif 1 i | 2e-30 | |
| cd12529 | 71 | cd12529, RRM2_MEI2_like, RNA recognition motif 2 i | 3e-29 | |
| cd12276 | 71 | cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti | 3e-29 | |
| cd12275 | 71 | cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti | 4e-21 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 4e-15 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 7e-14 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 6e-13 | |
| cd12524 | 77 | cd12524, RRM1_MEI2_like, RNA recognition motif 1 i | 5e-12 | |
| cd12352 | 72 | cd12352, RRM1_TIA1_like, RNA recognition motif 1 i | 6e-11 | |
| COG0724 | 306 | COG0724, COG0724, RNA-binding proteins (RRM domain | 2e-10 | |
| cd12365 | 73 | cd12365, RRM_RNPS1, RNA recognition motif in RNA-b | 2e-10 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 9e-10 | |
| cd12373 | 73 | cd12373, RRM_SRSF3_like, RNA recognition motif in | 1e-09 | |
| cd12382 | 80 | cd12382, RRM_RBMX_like, RNA recognition motif in h | 2e-09 | |
| pfam13893 | 56 | pfam13893, RRM_5, RNA recognition motif | 2e-09 | |
| cd12337 | 70 | cd12337, RRM1_SRSF4_like, RNA recognition motif 1 | 2e-09 | |
| cd12246 | 78 | cd12246, RRM1_U1A_like, RNA recognition motif 1 in | 3e-09 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 5e-09 | |
| cd12495 | 72 | cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v | 8e-09 | |
| cd12596 | 70 | cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve | 1e-08 | |
| cd12320 | 76 | cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot | 1e-08 | |
| cd12251 | 72 | cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 | 2e-08 | |
| cd12354 | 73 | cd12354, RRM3_TIA1_like, RNA recognition motif 2 i | 4e-08 | |
| cd12299 | 71 | cd12299, RRM4_Prp24, RNA recognition motif 4 in fu | 5e-08 | |
| cd12614 | 74 | cd12614, RRM1_PUB1, RNA recognition motif 1 in yea | 1e-07 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 1e-07 | |
| cd12233 | 70 | cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m | 1e-07 | |
| cd12236 | 91 | cd12236, RRM_snRNP70, RNA recognition motif in U1 | 1e-07 | |
| cd12347 | 73 | cd12347, RRM_PPIE, RNA recognition motif in cyclop | 2e-07 | |
| cd12525 | 72 | cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 | 2e-07 | |
| cd12422 | 85 | cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m | 2e-07 | |
| cd12237 | 93 | cd12237, RRM_snRNP35, RNA recognition motif found | 2e-07 | |
| cd12616 | 81 | cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc | 2e-07 | |
| cd12413 | 79 | cd12413, RRM1_RBM28_like, RNA recognition motif 1 | 2e-07 | |
| cd12494 | 72 | cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v | 3e-07 | |
| cd12355 | 80 | cd12355, RRM_RBM18, RNA recognition motif in eukar | 4e-07 | |
| cd12524 | 77 | cd12524, RRM1_MEI2_like, RNA recognition motif 1 i | 5e-07 | |
| cd12260 | 85 | cd12260, RRM2_SREK1, RNA recognition motif 2 in sp | 5e-07 | |
| cd12408 | 77 | cd12408, RRM_eIF3G_like, RNA recognition motif in | 7e-07 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 1e-06 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 1e-06 | |
| cd12615 | 74 | cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc | 1e-06 | |
| cd12392 | 81 | cd12392, RRM2_SART3, RNA recognition motif 2 in sq | 1e-06 | |
| cd12608 | 69 | cd12608, RRM1_CoAA, RNA recognition motif 1 in ver | 1e-06 | |
| cd12350 | 74 | cd12350, RRM3_SHARP, RNA recognition motif 3 in SM | 1e-06 | |
| cd12275 | 71 | cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti | 2e-06 | |
| cd12609 | 68 | cd12609, RRM2_CoAA, RNA recognition motif 2 in ver | 2e-06 | |
| cd12528 | 81 | cd12528, RRM2_MEI2_fungi, RNA recognition motif 2 | 2e-06 | |
| cd12239 | 82 | cd12239, RRM2_RBM40_like, RNA recognition motif 2 | 3e-06 | |
| cd12346 | 72 | cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti | 3e-06 | |
| cd12318 | 82 | cd12318, RRM5_RBM19_like, RNA recognition motif 5 | 3e-06 | |
| cd12312 | 84 | cd12312, RRM_SRSF10_SRSF12, RNA recognition motif | 3e-06 | |
| cd12570 | 76 | cd12570, RRM5_MRD1, RNA recognition motif 5 in yea | 4e-06 | |
| cd12340 | 67 | cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in | 4e-06 | |
| cd12297 | 78 | cd12297, RRM2_Prp24, RNA recognition motif 2 in fu | 4e-06 | |
| cd12334 | 74 | cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp | 7e-06 | |
| cd12447 | 76 | cd12447, RRM1_gar2, RNA recognition motif 1 in yea | 8e-06 | |
| cd12595 | 70 | cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve | 8e-06 | |
| cd12680 | 75 | cd12680, RRM_THOC4, RNA recognition motif in THO c | 1e-05 | |
| cd12311 | 73 | cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in | 1e-05 | |
| cd12238 | 73 | cd12238, RRM1_RBM40_like, RNA recognition motif 1 | 1e-05 | |
| cd12363 | 78 | cd12363, RRM_TRA2, RNA recognition motif in transf | 1e-05 | |
| cd12405 | 72 | cd12405, RRM3_NCL, RNA recognition motif 3 in vert | 2e-05 | |
| cd12393 | 78 | cd12393, RRM_ZCRB1, RNA recognition motif in Zinc | 2e-05 | |
| cd12273 | 71 | cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve | 2e-05 | |
| cd12343 | 66 | cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 | 2e-05 | |
| cd12649 | 81 | cd12649, RRM1_SXL, RNA recognition motif 1 in Dros | 2e-05 | |
| cd12247 | 72 | cd12247, RRM2_U1A_like, RNA recognition motif 2 in | 3e-05 | |
| cd12315 | 77 | cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 | 3e-05 | |
| cd12645 | 81 | cd12645, RRM_SRSF3, RNA recognition motif in verte | 3e-05 | |
| cd12594 | 74 | cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve | 3e-05 | |
| cd12404 | 77 | cd12404, RRM2_NCL, RNA recognition motif 2 in vert | 4e-05 | |
| cd12353 | 75 | cd12353, RRM2_TIA1_like, RNA recognition motif 2 i | 4e-05 | |
| cd12276 | 71 | cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti | 5e-05 | |
| cd12313 | 84 | cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti | 5e-05 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 5e-05 | |
| cd12223 | 84 | cd12223, RRM_SR140, RNA recognition motif (RRM) in | 7e-05 | |
| cd12351 | 77 | cd12351, RRM4_SHARP, RNA recognition motif 4 in SM | 8e-05 | |
| cd12418 | 75 | cd12418, RRM_Aly_REF_like, RNA recognition motif i | 8e-05 | |
| cd12450 | 77 | cd12450, RRM1_NUCLs, RNA recognition motif 1 found | 8e-05 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 9e-05 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 9e-05 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 1e-04 | |
| cd12694 | 86 | cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 | 1e-04 | |
| cd12378 | 80 | cd12378, RRM1_I_PABPs, RNA recognition motif 1 in | 1e-04 | |
| cd12564 | 76 | cd12564, RRM1_RBM19, RNA recognition motif 1 in RN | 1e-04 | |
| cd12552 | 77 | cd12552, RRM_Nop15p, RNA recognition motif in yeas | 1e-04 | |
| TIGR01648 | 578 | TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu | 1e-04 | |
| PLN03134 | 144 | PLN03134, PLN03134, glycine-rich RNA-binding prote | 1e-04 | |
| cd12525 | 72 | cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 | 2e-04 | |
| cd12324 | 88 | cd12324, RRM_RBM8, RNA recognition motif in RNA-bi | 2e-04 | |
| cd12225 | 77 | cd12225, RRM1_2_CID8_like, RNA recognition motif 1 | 2e-04 | |
| cd12599 | 72 | cd12599, RRM1_SF2_plant_like, RNA recognition moti | 2e-04 | |
| cd12336 | 75 | cd12336, RRM_RBM7_like, RNA recognition motif in R | 2e-04 | |
| cd12241 | 77 | cd12241, RRM_SF3B14, RNA recognition motif found i | 2e-04 | |
| cd12421 | 74 | cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m | 2e-04 | |
| cd12381 | 79 | cd12381, RRM4_I_PABPs, RNA recognition motif 4 in | 2e-04 | |
| cd12476 | 78 | cd12476, RRM1_SNF, RNA recognition motif 1 found i | 2e-04 | |
| cd12283 | 73 | cd12283, RRM1_RBM39_like, RNA recognition motif 1 | 2e-04 | |
| cd12341 | 68 | cd12341, RRM_hnRNPC_like, RNA recognition motif in | 2e-04 | |
| cd12338 | 72 | cd12338, RRM1_SRSF1_like, RNA recognition motif 1 | 2e-04 | |
| cd12671 | 75 | cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i | 2e-04 | |
| cd12371 | 77 | cd12371, RRM2_PUF60, RNA recognition motif 2 in (U | 2e-04 | |
| cd12379 | 77 | cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou | 3e-04 | |
| TIGR01649 | 481 | TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl | 3e-04 | |
| cd12620 | 73 | cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc | 3e-04 | |
| cd12361 | 77 | cd12361, RRM1_2_CELF1-6_like, RNA recognition moti | 4e-04 | |
| cd12571 | 79 | cd12571, RRM6_RBM19, RNA recognition motif 6 in RN | 4e-04 | |
| cd12641 | 89 | cd12641, RRM_TRA2B, RNA recognition motif in Trans | 4e-04 | |
| cd12394 | 91 | cd12394, RRM1_RBM34, RNA recognition motif 1 in RN | 5e-04 | |
| TIGR01659 | 346 | TIGR01659, sex-lethal, sex-lethal family splicing | 5e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 5e-04 | |
| cd12646 | 77 | cd12646, RRM_SRSF7, RNA recognition motif in verte | 5e-04 | |
| cd12362 | 73 | cd12362, RRM3_CELF1-6, RNA recognition motif 3 in | 6e-04 | |
| cd12375 | 77 | cd12375, RRM1_Hu_like, RNA recognition motif 1 in | 6e-04 | |
| cd12449 | 80 | cd12449, RRM_CIRBP_RBM3, RNA recognition motif in | 6e-04 | |
| cd12497 | 74 | cd12497, RRM3_RBM47, RNA recognition motif 3 in ve | 6e-04 | |
| cd12406 | 78 | cd12406, RRM4_NCL, RNA recognition motif 4 in vert | 6e-04 | |
| cd12309 | 79 | cd12309, RRM2_Spen, RNA recognition motif 2 in the | 7e-04 | |
| cd12370 | 76 | cd12370, RRM1_PUF60, RNA recognition motif 1 in (U | 8e-04 | |
| cd12696 | 107 | cd12696, RRM3_PTBP2, RNA recognition motif 3 in ve | 8e-04 | |
| cd12559 | 84 | cd12559, RRM_SRSF10, RNA recognition motif in seri | 8e-04 | |
| cd12415 | 82 | cd12415, RRM3_RBM28_like, RNA recognition motif 3 | 9e-04 | |
| cd12383 | 83 | cd12383, RRM_RBM42, RNA recognition motif in RNA-b | 0.001 | |
| cd12335 | 83 | cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp | 0.001 | |
| cd12425 | 76 | cd12425, RRM4_PTBP1_like, RNA recognition motif 4 | 0.001 | |
| cd12245 | 79 | cd12245, RRM_scw1_like, RNA recognition motif in y | 0.001 | |
| cd12454 | 80 | cd12454, RRM2_RIM4_like, RNA recognition motif 2 i | 0.001 | |
| cd12302 | 110 | cd12302, RRM_scSet1p_like, RNA recognition motif i | 0.001 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.002 | |
| cd12674 | 79 | cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye | 0.002 | |
| cd12279 | 74 | cd12279, RRM_TUT1, RNA recognition motif in speckl | 0.002 | |
| cd12764 | 72 | cd12764, RRM2_SRSF4, RNA recognition motif 2 in ve | 0.002 | |
| cd12567 | 79 | cd12567, RRM3_RBM19, RNA recognition motif 3 in RN | 0.002 | |
| cd12496 | 74 | cd12496, RRM3_RBM46, RNA recognition motif 3 in ve | 0.002 | |
| cd12621 | 74 | cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc | 0.002 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 0.003 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.004 | |
| cd12642 | 79 | cd12642, RRM_TRA2A, RNA recognition motif in trans | 0.004 |
| >gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins | Back alignment and domain information |
|---|
Score = 127 bits (320), Expect = 2e-36
Identities = 51/71 (71%), Positives = 60/71 (84%)
Query: 228 QGTIVVFNLDSGVSSSTLKEIFQAFGPVKELRETPLKKHQRFIEFYDVRDAAKALKEMNG 287
QGT+V+FNLD VSS TL+ IFQ +G VKELRETP K+ QRF+EF+DVRDAAKAL+ MNG
Sbjct: 1 QGTLVIFNLDPTVSSETLRSIFQVYGDVKELRETPCKREQRFVEFFDVRDAAKALRAMNG 60
Query: 288 QEIYGKHVVIE 298
+EI GK VVIE
Sbjct: 61 KEISGKPVVIE 71
|
This subgroup corresponds to the RRM2 of terminal EAR1-like proteins, including terminal EAR1-like protein 1 and 2 (TEL1 and TEL2) found in land plants. They may play a role in the regulation of leaf initiation. The terminal EAR1-like proteins are putative RNA-binding proteins carrying three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and TEL characteristic motifs that allow sequence and putative functional discrimination between the terminal EAR1-like proteins and Mei2-like proteins. . Length = 71 |
| >gnl|CDD|240970 cd12526, RRM1_EAR1_like, RNA recognition motif 1 in terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) | Back alignment and domain information |
|---|
| >gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) | Back alignment and domain information |
|---|
| >gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 | Back alignment and domain information |
|---|
| >gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) | Back alignment and domain information |
|---|
| >gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240972 cd12528, RRM2_MEI2_fungi, RNA recognition motif 2 in fungal Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) | Back alignment and domain information |
|---|
| >gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp | Back alignment and domain information |
|---|
| >gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) | Back alignment and domain information |
|---|
| >gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) | Back alignment and domain information |
|---|
| >gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family | Back alignment and domain information |
|---|
| >gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241138 cd12694, RRM2_hnRNPL_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA | Back alignment and domain information |
|---|
| >gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) | Back alignment and domain information |
|---|
| >gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) | Back alignment and domain information |
|---|
| >gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241140 cd12696, RRM3_PTBP2, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241208 cd12764, RRM2_SRSF4, RNA recognition motif 2 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) | Back alignment and domain information |
|---|
| >gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) | Back alignment and domain information |
|---|
| >gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.97 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.97 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.96 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.96 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.96 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.95 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 99.94 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.94 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.94 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.94 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.94 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.93 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.93 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 99.92 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.91 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.91 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 99.9 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.9 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.89 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.88 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.87 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 99.83 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 99.82 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 99.82 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 99.82 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 99.8 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.8 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 99.8 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 99.77 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.77 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 99.76 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 99.75 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 99.74 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.74 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 99.71 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 99.7 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 99.68 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 99.68 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.67 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 99.64 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 99.63 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 99.6 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.58 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.57 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 99.54 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.52 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.52 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.52 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.5 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 99.49 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.49 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.48 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.48 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.48 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 99.46 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.45 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.43 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 99.42 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.42 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 99.42 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.41 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.41 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.4 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.4 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.39 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.39 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.38 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 99.38 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.37 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.36 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.33 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 99.33 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.33 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.32 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.32 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.32 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.31 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.3 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.3 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.3 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.29 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.28 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 99.28 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.26 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 99.25 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.25 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 99.21 | |
| smart00360 | 71 | RRM RNA recognition motif. | 99.2 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.19 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.19 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.18 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 99.17 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.17 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 99.17 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.16 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 99.15 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.13 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.13 | |
| smart00360 | 71 | RRM RNA recognition motif. | 99.12 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 99.12 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.12 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 99.08 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 99.08 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 99.05 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 99.04 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 99.03 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 99.03 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 99.01 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.0 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.89 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 98.89 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.88 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 98.86 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 98.83 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 98.83 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 98.82 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 98.8 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 98.73 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 98.7 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 98.7 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 98.66 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 98.61 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 98.6 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.56 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.55 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 98.52 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 98.51 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 98.44 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 98.39 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.38 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.34 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 98.34 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 98.34 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 98.3 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 98.3 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 98.28 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 98.28 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 98.23 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 98.22 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 98.18 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 98.17 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.17 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 98.1 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.07 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 98.04 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 97.94 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 97.94 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.87 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.8 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 97.58 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.56 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.54 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.43 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 97.24 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.15 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 97.13 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.13 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.12 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.07 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 96.99 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 96.97 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 96.92 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 96.89 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 96.86 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 96.85 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 96.84 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 96.68 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 96.67 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 96.57 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 96.5 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 96.47 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 96.4 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 96.28 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 96.12 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 96.06 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 96.04 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 96.0 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 95.9 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 95.87 | |
| KOG2253 | 668 | consensus U1 snRNP complex, subunit SNU71 and rela | 95.62 | |
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 95.57 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 95.54 | |
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 95.39 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 95.36 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 95.25 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 95.0 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 94.92 | |
| KOG4574 | 1007 | consensus RNA-binding protein (contains RRM and Pu | 94.46 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 94.42 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 94.41 | |
| PF07145 | 18 | PAM2: Ataxin-2 C-terminal region; InterPro: IPR009 | 94.34 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 93.98 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 93.75 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 93.71 | |
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 93.62 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 93.4 | |
| KOG2135 | 526 | consensus Proteins containing the RNA recognition | 92.84 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 92.72 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 92.59 | |
| KOG2253 | 668 | consensus U1 snRNP complex, subunit SNU71 and rela | 92.41 | |
| PF11767 | 66 | SET_assoc: Histone lysine methyltransferase SET as | 91.01 | |
| KOG4574 | 1007 | consensus RNA-binding protein (contains RRM and Pu | 90.99 | |
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 90.91 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 90.83 | |
| PF11767 | 66 | SET_assoc: Histone lysine methyltransferase SET as | 90.82 | |
| PF03880 | 74 | DbpA: DbpA RNA binding domain ; InterPro: IPR00558 | 90.09 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 89.49 | |
| PF10567 | 309 | Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP | 89.07 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 88.39 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 87.78 | |
| KOG2318 | 650 | consensus Uncharacterized conserved protein [Funct | 87.36 | |
| PF07292 | 88 | NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 | 87.19 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 85.28 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 81.97 |
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.3e-29 Score=242.40 Aligned_cols=163 Identities=18% Similarity=0.318 Sum_probs=136.8
Q ss_pred CCCCCCEEEEcCCCCCCCHHHHHHHhhccCCeEEEEEee-----cCccEEEEEECCHHHHHHHHHHhcCccccccccccc
Q 046223 78 STGPTRTLVLSYVPGDVSETIVRRDLEVFGEVRGVQMER-----LMEGIVTVHFYDLRHAEMAFKEIREQHMQLQQQSYG 152 (408)
Q Consensus 78 ~~~~~rtlfV~nLp~~vte~~L~~~F~~~G~V~~v~~~~-----~~kG~afV~F~~~~~A~~Ai~~lng~~i~~~gr~l~ 152 (408)
.....++|||+|||+++||++|+++|+.||+|++|+|++ +++|||||+|.++++|++|++.|||..|. ++ .
T Consensus 103 ~~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~--gr--~ 178 (346)
T TIGR01659 103 TNNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVR--NK--R 178 (346)
T ss_pred CCCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccC--Cc--e
Confidence 445678999999999999999999999999999999875 45899999999999999999999998875 55 3
Q ss_pred eeccccCccccccCCCCCCCcccCCCChhHHHHHHhhhhccCCCCCCCcCCCCCCCCccccccCCcCCCCCCCCCCceEE
Q 046223 153 LKNPYSSGLMLMNNDNNNNNLATGCYDNQVVAESLMIMNSYAPVLPPPARGLVAGRPVWAQFIVPTCNAVPDGNNQGTIV 232 (408)
Q Consensus 153 ~~~~~s~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~p~~~~~~~~~~~~~l~ 232 (408)
|++.|+... .......+||
T Consensus 179 i~V~~a~p~-------------------------------------------------------------~~~~~~~~lf 197 (346)
T TIGR01659 179 LKVSYARPG-------------------------------------------------------------GESIKDTNLY 197 (346)
T ss_pred eeeeccccc-------------------------------------------------------------ccccccceeE
Confidence 444332200 0001136899
Q ss_pred EcCCCCCCcHHHHHHHHhcCCCceeec-----cCCCCccEEEEEECCHHHHHHHHHHhCCceeCC--eEEEEEEecCCCC
Q 046223 233 VFNLDSGVSSSTLKEIFQAFGPVKELR-----ETPLKKHQRFIEFYDVRDAAKALKEMNGQEIYG--KHVVIEFSRPGGH 305 (408)
Q Consensus 233 V~nLp~~~t~~~L~~~F~~~G~v~~v~-----~~~~~~g~afV~F~~~~~A~~A~~~l~g~~~~g--~~l~v~~a~~~~~ 305 (408)
|+||+..+|+++|+++|++||+|+.++ .+++.+|||||+|.+.++|++|++.||+..+.| +.|+|.+++....
T Consensus 198 V~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~~~g~~~~l~V~~a~~~~~ 277 (346)
T TIGR01659 198 VTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNNVIPEGGSQPLTVRLAEEHGK 277 (346)
T ss_pred EeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHHHHHHhCCCccCCCceeEEEEECCcccc
Confidence 999999999999999999999998872 367778999999999999999999999998876 7899999987643
|
This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661). |
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF07145 PAM2: Ataxin-2 C-terminal region; InterPro: IPR009818 This entry represents a conserved region approximately 250 residues long located towards the C terminus of eukaryotic ataxin-2 | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes | Back alignment and domain information |
|---|
| >KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes | Back alignment and domain information |
|---|
| >PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2318 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 408 | ||||
| 2dgu_A | 103 | Solution Structure Of The Rna Binding Domain In Het | 5e-05 | ||
| 2lea_A | 135 | Solution Structure Of Human Srsf2 (Sc35) Rrm Length | 6e-05 | ||
| 2dnm_A | 103 | Solution Structure Of Rna Binding Domain In Srp46 S | 1e-04 | ||
| 1b7f_A | 168 | Sxl-Lethal ProteinRNA COMPLEX Length = 168 | 5e-04 | ||
| 2hvz_A | 101 | Solution Structure Of The Rrm Domain Of Sr Rich Fac | 5e-04 | ||
| 3md3_A | 166 | Crystal Structure Of The First Two Rrm Domains Of Y | 6e-04 | ||
| 2kn4_A | 158 | The Structure Of The Rrm Domain Of Sc35 Length = 15 | 6e-04 | ||
| 2kxn_B | 129 | Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit | 6e-04 | ||
| 2rrb_A | 96 | Refinement Of Rna Binding Domain In Human Tra2 Beta | 7e-04 | ||
| 2rra_A | 99 | Solution Structure Of Rna Binding Domain In Human T | 7e-04 | ||
| 2sxl_A | 88 | Sex-Lethal Rbd1, Nmr, Minimized Average Structure L | 8e-04 |
| >pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 | Back alignment and structure |
|
| >pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 | Back alignment and structure |
| >pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 | Back alignment and structure |
| >pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 | Back alignment and structure |
| >pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 | Back alignment and structure |
| >pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 | Back alignment and structure |
| >pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 | Back alignment and structure |
| >pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 | Back alignment and structure |
| >pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 | Back alignment and structure |
| >pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 | Back alignment and structure |
| >pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 408 | |||
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 4e-18 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 3e-17 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 6e-16 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 1e-15 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 2e-15 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 4e-15 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 4e-15 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 5e-15 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 5e-15 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 9e-15 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 3e-11 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 1e-14 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 1e-14 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 5e-11 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 1e-14 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 2e-14 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 1e-10 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 4e-08 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 3e-14 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 3e-14 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 3e-14 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 5e-14 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 6e-14 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 6e-14 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 7e-14 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 7e-14 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 5e-13 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 8e-14 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 1e-13 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 4e-11 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 1e-13 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 2e-13 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 2e-13 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 3e-13 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 5e-13 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 5e-13 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 5e-13 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 7e-13 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 8e-13 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 9e-13 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 8e-09 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 9e-13 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 1e-12 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 1e-12 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 1e-12 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 1e-12 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 1e-12 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 2e-12 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 2e-12 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 2e-09 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 2e-12 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 9e-09 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 3e-12 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 3e-12 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 3e-07 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 4e-12 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 4e-12 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 2e-05 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 5e-12 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 5e-12 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 8e-12 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 6e-05 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 1e-11 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 5e-09 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 1e-11 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 2e-11 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 2e-11 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 2e-11 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 3e-05 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 2e-11 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 2e-11 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 2e-11 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 3e-11 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 3e-11 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 3e-11 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 4e-11 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 5e-11 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 6e-11 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 6e-11 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 6e-11 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 6e-11 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 7e-11 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 9e-11 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 8e-10 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 8e-11 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 8e-11 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 8e-11 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-11 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-10 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 1e-10 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} Len | 1e-10 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 1e-10 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 1e-10 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 1e-10 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 3e-10 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 3e-10 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 3e-10 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 3e-10 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 3e-10 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 3e-10 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 4e-10 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 4e-10 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 4e-10 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 4e-10 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 5e-10 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 5e-10 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 1e-09 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 7e-10 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 7e-10 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 7e-10 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 9e-10 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 1e-09 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 1e-09 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 1e-09 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 1e-09 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 1e-09 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 1e-09 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 1e-09 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 2e-09 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 2e-09 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 2e-09 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 2e-09 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 2e-09 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 3e-09 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 3e-09 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 4e-09 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 5e-09 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 5e-09 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 5e-09 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 6e-09 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 1e-08 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 1e-08 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 2e-08 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 2e-08 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 5e-08 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 9e-08 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 1e-07 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 1e-07 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 2e-07 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 2e-07 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 2e-07 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 2e-07 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 3e-07 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 3e-07 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 3e-07 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 4e-07 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 7e-07 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 9e-07 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 1e-04 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 1e-06 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 2e-06 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 2e-06 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 3e-06 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 4e-06 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 4e-06 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 5e-06 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 6e-06 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 7e-06 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 9e-06 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 1e-05 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 2e-05 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 2e-05 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 2e-05 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 3e-05 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 5e-04 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 4e-05 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 4e-05 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 6e-05 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 6e-05 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 1e-04 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 1e-04 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 3e-04 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 4e-04 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 4e-04 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 5e-04 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 5e-04 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 5e-04 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 6e-04 |
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
Score = 78.8 bits (194), Expect = 4e-18
Identities = 14/89 (15%), Positives = 32/89 (35%), Gaps = 6/89 (6%)
Query: 220 NAVPDGNNQGTIVVFNLDSGVSSSTLKE----IFQAFGPVKELR--ETPLKKHQRFIEFY 273
+ P +++ N++ V L+ + + G + ++ + + +I F
Sbjct: 21 STPPHTEPSQVVLITNINPEVPKEKLQALLYALASSQGDILDIVVDLSDDNSGKAYIVFA 80
Query: 274 DVRDAAKALKEMNGQEIYGKHVVIEFSRP 302
A ++ G G +VI FS
Sbjct: 81 TQESAQAFVEAFQGYPFQGNPLVITFSET 109
|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 100.0 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.98 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.97 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.97 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.97 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.97 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.97 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.97 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.97 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.97 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.97 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.97 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.97 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.97 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.97 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.96 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.96 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.95 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.95 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.95 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.86 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.83 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.82 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.79 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.76 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.76 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.75 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.74 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.74 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.73 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.73 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.73 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.72 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.72 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.72 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.72 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.72 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.72 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.72 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.72 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.72 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.71 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.71 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.71 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.71 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.71 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.71 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.71 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.71 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.71 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.71 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.71 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.71 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.7 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.7 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.7 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.7 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.7 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.7 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.7 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.7 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.7 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.7 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.7 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.7 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.7 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.7 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.7 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.7 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.7 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.7 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.7 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.7 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.69 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.69 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.69 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.69 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.69 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.69 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.69 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.69 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.69 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.69 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.69 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.69 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.69 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.69 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.69 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.69 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.69 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.69 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.69 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.68 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.68 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.68 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.68 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.68 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.68 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.68 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.68 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.68 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.68 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.68 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.68 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.68 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.68 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.68 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.67 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.67 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.67 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.67 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.67 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.67 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.67 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.67 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.67 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.67 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.67 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.67 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.67 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.67 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.67 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.67 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.67 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.67 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.67 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.67 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.67 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.66 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.66 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.66 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.66 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.66 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.66 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.66 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.66 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.66 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.66 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.66 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.66 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.66 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.66 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.66 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.66 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.66 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.66 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.66 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.66 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.66 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.65 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.65 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.65 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.65 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.65 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.65 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.65 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.65 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.65 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.65 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.65 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.65 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.65 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.65 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.65 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.65 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.65 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.65 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.65 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.65 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.65 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.65 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.65 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.65 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.64 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.64 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.64 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.64 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.64 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.64 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.64 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.64 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.64 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.64 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.64 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.64 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.64 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.64 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.64 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.64 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.64 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.64 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.64 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.64 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.64 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.64 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.64 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.64 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.64 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.63 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.63 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.63 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.63 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.63 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.63 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.63 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.63 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.63 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.63 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.63 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.63 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.63 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.63 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.63 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.63 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.63 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.62 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.62 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.62 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.62 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.62 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.62 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.62 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.62 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.62 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.62 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.62 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.62 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.62 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.62 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.62 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.62 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.62 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.61 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.61 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.61 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.61 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.61 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.61 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.61 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.61 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.61 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.61 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.61 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.61 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.6 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.6 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.6 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.6 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.6 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.6 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.6 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.6 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.6 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.6 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.6 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.6 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.6 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.6 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.59 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.59 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.59 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.59 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.59 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.59 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.59 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.59 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.59 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.59 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.58 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.58 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.58 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.58 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.58 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.58 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.58 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.58 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.58 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.57 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.57 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.35 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.57 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.57 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.57 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.56 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.56 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.56 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.56 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.56 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.56 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.56 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.56 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.56 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.56 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.56 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.56 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.56 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.56 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.55 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.55 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.55 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.55 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.55 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.55 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.55 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.55 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.55 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.54 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.54 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.54 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.54 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.54 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.54 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.54 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.53 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.53 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.53 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.53 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.53 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.53 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.53 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.53 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.52 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.52 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.52 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.52 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.52 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.52 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.51 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.5 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.5 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.5 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.49 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.49 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.49 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.49 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.49 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.49 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.48 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.48 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.48 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.48 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.22 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.47 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.47 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.47 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.46 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.44 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.44 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.44 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.43 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.43 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.43 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.41 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.41 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.4 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.4 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.38 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.37 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.37 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.36 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.35 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.35 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.35 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.34 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.33 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.32 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.31 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.29 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.26 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.21 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.21 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.16 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 99.03 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 99.0 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 98.99 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.81 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 98.79 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.72 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.63 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.46 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 98.45 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 98.2 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 97.87 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 97.72 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 97.43 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 97.32 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 97.18 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 97.18 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 97.02 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 96.98 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 96.92 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 96.75 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 96.72 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 96.43 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 96.41 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 95.91 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 95.68 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 95.6 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 95.22 | |
| 3d45_A | 507 | Poly(A)-specific ribonuclease PARN; CAP analogue, | 89.18 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 89.13 | |
| 3d45_A | 507 | Poly(A)-specific ribonuclease PARN; CAP analogue, | 84.37 | |
| 1jgn_B | 26 | PAIP2, polyadenylate-binding protein-interacting p | 82.75 |
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-33 Score=252.58 Aligned_cols=163 Identities=20% Similarity=0.305 Sum_probs=135.1
Q ss_pred CCCCCEEEEcCCCCCCCHHHHHHHhhccCCeEEEEEee-----cCccEEEEEECCHHHHHHHHHHhcCccccccccccce
Q 046223 79 TGPTRTLVLSYVPGDVSETIVRRDLEVFGEVRGVQMER-----LMEGIVTVHFYDLRHAEMAFKEIREQHMQLQQQSYGL 153 (408)
Q Consensus 79 ~~~~rtlfV~nLp~~vte~~L~~~F~~~G~V~~v~~~~-----~~kG~afV~F~~~~~A~~Ai~~lng~~i~~~gr~l~~ 153 (408)
..+.++|||+|||+++||++|+++|++||+|.+|++++ +++|||||+|.+.++|++|++.+++..+. |+. +
T Consensus 12 ~~p~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~~--g~~--i 87 (213)
T 4f02_A 12 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIK--GKP--V 87 (213)
T ss_dssp ---CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEET--TEE--C
T ss_pred CCCCcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHhhhhhcC--Ccc--c
Confidence 44678999999999999999999999999999999876 45899999999999999999999998765 563 3
Q ss_pred eccccCccccccCCCCCCCcccCCCChhHHHHHHhhhhccCCCCCCCcCCCCCCCCccccccCCcCCCCCCCCCCceEEE
Q 046223 154 KNPYSSGLMLMNNDNNNNNLATGCYDNQVVAESLMIMNSYAPVLPPPARGLVAGRPVWAQFIVPTCNAVPDGNNQGTIVV 233 (408)
Q Consensus 154 ~~~~s~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~p~~~~~~~~~~~~~l~V 233 (408)
++.++... . . .......+|||
T Consensus 88 ~~~~~~~~-----------------~-~-----------------------------------------~~~~~~~~l~v 108 (213)
T 4f02_A 88 RIMWSQRD-----------------P-S-----------------------------------------LRKSGVGNIFI 108 (213)
T ss_dssp EEEECCCC-----------------T-H-----------------------------------------HHHHCTTEEEE
T ss_pred cccccccc-----------------c-c-----------------------------------------ccccccccceE
Confidence 33222100 0 0 00011378999
Q ss_pred cCCCCCCcHHHHHHHHhcCCCceeec---cCCCCccEEEEEECCHHHHHHHHHHhCCceeCCeEEEEEEecCCC
Q 046223 234 FNLDSGVSSSTLKEIFQAFGPVKELR---ETPLKKHQRFIEFYDVRDAAKALKEMNGQEIYGKHVVIEFSRPGG 304 (408)
Q Consensus 234 ~nLp~~~t~~~L~~~F~~~G~v~~v~---~~~~~~g~afV~F~~~~~A~~A~~~l~g~~~~g~~l~v~~a~~~~ 304 (408)
+||+..+|+++|+++|++||.|..++ ..+.++|||||+|.+.++|++|++.|||..|+|+.|+|.+++++.
T Consensus 109 ~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~~~g~~i~V~~a~~~~ 182 (213)
T 4f02_A 109 KNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRK 182 (213)
T ss_dssp ESCCTTCCHHHHHHHHGGGSCEEEEEEEEETTEEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCCHH
T ss_pred CCcccccHHHHHHHHHhhcCCeEEEEeeccCCCCceEEEEEeCCHHHHHHHHHHhCCCEECCEEEEEEEcCCCc
Confidence 99999999999999999999999883 344578999999999999999999999999999999999998754
|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1jgn_B PAIP2, polyadenylate-binding protein-interacting protein 2; all-helical domain, protein-peptide complex, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 408 | ||||
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 1e-15 | |
| d1no8a_ | 78 | d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu | 8e-15 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 1e-14 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 0.004 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 1e-14 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 2e-14 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 5e-14 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 5e-14 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 1e-13 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 2e-13 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 4e-13 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 5e-13 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 8e-13 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 9e-13 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 1e-12 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 2e-12 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 2e-12 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 2e-12 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 3e-12 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 3e-12 | |
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 5e-12 | |
| d2adba1 | 108 | d.58.7.1 (A:177-284) Polypyrimidine tract-binding | 6e-12 | |
| d2cpda1 | 86 | d.58.7.1 (A:223-308) APOBEC1 stimulating protein { | 8e-12 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 9e-12 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 9e-12 | |
| d2cq3a1 | 93 | d.58.7.1 (A:110-202) RNA-binding protein 9 {Human | 2e-11 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 2e-11 | |
| d2cq4a1 | 101 | d.58.7.1 (A:132-232) RNA binding protein 23 {Human | 2e-11 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 2e-11 | |
| d1x5ta1 | 83 | d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu | 3e-11 | |
| d1wf0a_ | 88 | d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { | 5e-11 | |
| d2cpea1 | 101 | d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma | 6e-11 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 7e-11 | |
| d2cpza1 | 102 | d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin | 7e-11 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 1e-10 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 1e-09 | |
| d2cqga1 | 90 | d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD | 1e-09 | |
| d1x4ba1 | 103 | d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle | 2e-09 | |
| d2msta_ | 75 | d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 | 6e-09 | |
| d2cqha1 | 80 | d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is | 9e-09 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 9e-09 | |
| d1wg1a_ | 88 | d.58.7.1 (A:) Probable RNA-binding protein KIAA157 | 1e-08 | |
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 2e-08 | |
| d2cq2a1 | 101 | d.58.7.1 (A:25-125) Alkylation repair AlkB homolog | 2e-08 | |
| d1x0fa1 | 75 | d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 | 3e-08 | |
| d1x5sa1 | 90 | d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote | 3e-08 | |
| d1u6fa1 | 139 | d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa | 4e-08 | |
| d1hd0a_ | 75 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 5e-08 | |
| d2adca1 | 109 | d.58.7.1 (A:335-443) Polypyrimidine tract-binding | 6e-08 | |
| d2adca2 | 88 | d.58.7.1 (A:444-531) Polypyrimidine tract-binding | 7e-08 | |
| d1x4ea1 | 72 | d.58.7.1 (A:8-79) RNA-binding motif, single-strand | 8e-08 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 1e-07 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 1e-07 | |
| d2cpxa1 | 102 | d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 | 2e-07 | |
| d1whya_ | 97 | d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb | 2e-07 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | d.58.7.3 (A:) 2e-07 | ||
| d1x5oa1 | 101 | d.58.7.1 (A:8-108) RNA-binding motif, single-stran | 3e-07 | |
| d1o0pa_ | 104 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 3e-07 | |
| d1x4ha1 | 98 | d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( | 3e-07 | |
| d1l3ka1 | 84 | d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN | 3e-07 | |
| d2ghpa3 | 86 | d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici | 5e-07 | |
| d1wi8a_ | 104 | d.58.7.1 (A:) Eukaryotic translation initiation fa | 2e-06 | |
| d1whxa_ | 111 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 2e-06 | |
| d1owxa_ | 113 | d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien | 4e-06 | |
| d2cqda1 | 103 | d.58.7.1 (A:1-103) RNA-binding region containing p | 4e-06 | |
| d1fjeb1 | 91 | d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc | 5e-06 | |
| d1x4da1 | 89 | d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ | 5e-06 | |
| d1weya_ | 104 | d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) | 7e-06 | |
| d1l3ka2 | 79 | d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 | 1e-05 | |
| d1wg4a_ | 98 | d.58.7.1 (A:) Splicing factor, arginine/serine-ric | 1e-05 | |
| d3begb1 | 87 | d.58.7.1 (B:121-207) Splicing factor, arginine/ser | 1e-05 | |
| d1wexa_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-05 | |
| d1u2fa_ | 90 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 2e-05 | |
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 4e-05 | |
| d2cq1a1 | 88 | d.58.7.1 (A:51-138) Polypyrimidine tract-binding p | 1e-04 | |
| d2cqpa1 | 86 | d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous | 2e-04 | |
| d1wg5a_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 4e-04 | |
| d2cpia1 | 89 | d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C | 0.001 | |
| d1wi6a1 | 75 | d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding | 0.004 |
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: CBP20, 20KDa nuclear cap-binding protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.0 bits (171), Expect = 1e-15
Identities = 17/85 (20%), Positives = 38/85 (44%), Gaps = 5/85 (5%)
Query: 230 TIVVFNLDSGVSSSTLKEIFQAFGPVKELRETPLKKHQR-----FIEFYDVRDAAKALKE 284
T+ V NL + + E+F G +K++ K + F+E+Y DA A++
Sbjct: 9 TLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRY 68
Query: 285 MNGQEIYGKHVVIEFSRPGGHSKKF 309
+NG + + + ++ +++
Sbjct: 69 INGTRLDDRIIRTDWDAGFKEGRQY 93
|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 408 | |||
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.96 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.79 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.78 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.78 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.77 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.77 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.77 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.77 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.77 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.77 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.76 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.76 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.76 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.76 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.76 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.75 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.75 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.75 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.75 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.75 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.75 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.75 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.75 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.74 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.74 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.74 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.73 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.73 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.73 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.73 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.73 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.73 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.73 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.73 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.73 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.73 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.73 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.73 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.72 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.72 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.72 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.72 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.72 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.72 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.72 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.72 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.72 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.72 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.71 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.71 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.71 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.71 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.71 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.71 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.71 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.71 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.71 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.71 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.71 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.71 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.71 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.71 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.71 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.71 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.7 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.7 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.7 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.7 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.7 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.7 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.7 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.7 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.7 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.7 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.69 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.69 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.69 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.69 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.69 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.69 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.69 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.69 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.69 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.69 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.69 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.68 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.68 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.68 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.68 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.68 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.68 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.68 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.68 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.67 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.67 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.67 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.67 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.67 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.67 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.67 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.67 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.67 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.67 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.67 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.66 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.66 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.66 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.66 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.66 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.66 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.66 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.66 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.66 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.66 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.66 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.65 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.65 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.65 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.65 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.65 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.65 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.65 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.64 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.64 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.64 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.64 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.64 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.63 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.63 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.63 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.63 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.63 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.63 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.62 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.62 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.62 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.62 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.62 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.61 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.61 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.61 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.61 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.61 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.61 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.61 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.6 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.6 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.56 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.56 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.53 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.53 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.52 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.52 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.52 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.51 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.49 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.46 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.44 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.44 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.44 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.42 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.37 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.35 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.32 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.32 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.31 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.27 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.27 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.18 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 97.61 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.4 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 97.1 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.05 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 96.62 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 95.81 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 94.03 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 93.32 |
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=1.3e-28 Score=213.93 Aligned_cols=162 Identities=14% Similarity=0.215 Sum_probs=128.4
Q ss_pred CCCEEEEcCCCCCCCHHHHHHHhhccCCeEEEEEee-----cCccEEEEEECCHHHHHHHHHHhcCccccccccccceec
Q 046223 81 PTRTLVLSYVPGDVSETIVRRDLEVFGEVRGVQMER-----LMEGIVTVHFYDLRHAEMAFKEIREQHMQLQQQSYGLKN 155 (408)
Q Consensus 81 ~~rtlfV~nLp~~vte~~L~~~F~~~G~V~~v~~~~-----~~kG~afV~F~~~~~A~~Ai~~lng~~i~~~gr~l~~~~ 155 (408)
..|+|||+|||+++||++|+++|++||+|.++.+.+ .++|||||+|.+.++|++|++.+++ .+. .+.+....
T Consensus 5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~-~~~--~~~~~~~~ 81 (183)
T d1u1qa_ 5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPH-KVD--GRVVEPKR 81 (183)
T ss_dssp HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSC-EET--TEECEEEE
T ss_pred CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCC-ccc--ccchhhhh
Confidence 348999999999999999999999999999998875 5589999999999999999985543 332 22111111
Q ss_pred cccCccccccCCCCCCCcccCCCChhHHHHHHhhhhccCCCCCCCcCCCCCCCCccccccCCcCCCCCCCCCCceEEEcC
Q 046223 156 PYSSGLMLMNNDNNNNNLATGCYDNQVVAESLMIMNSYAPVLPPPARGLVAGRPVWAQFIVPTCNAVPDGNNQGTIVVFN 235 (408)
Q Consensus 156 ~~s~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~p~~~~~~~~~~~~~l~V~n 235 (408)
.... ............++|||+|
T Consensus 82 ~~~~---------------------------------------------------------~~~~~~~~~~~~~~i~V~~ 104 (183)
T d1u1qa_ 82 AVSR---------------------------------------------------------EDSQRPGAHLTVKKIFVGG 104 (183)
T ss_dssp CCCT---------------------------------------------------------TGGGSTTTTCCCSEEEEEC
T ss_pred hhhc---------------------------------------------------------ccccccccccccceeEEcc
Confidence 0000 0000011123358999999
Q ss_pred CCCCCcHHHHHHHHhcCCCceee-----ccCCCCccEEEEEECCHHHHHHHHHHhCCceeCCeEEEEEEecCC
Q 046223 236 LDSGVSSSTLKEIFQAFGPVKEL-----RETPLKKHQRFIEFYDVRDAAKALKEMNGQEIYGKHVVIEFSRPG 303 (408)
Q Consensus 236 Lp~~~t~~~L~~~F~~~G~v~~v-----~~~~~~~g~afV~F~~~~~A~~A~~~l~g~~~~g~~l~v~~a~~~ 303 (408)
||..+|+++|+++|+.||.|..+ ..++.++|||||+|.+.++|.+|++ +++..++|+.|+|.+|.++
T Consensus 105 lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~A~~k 176 (183)
T d1u1qa_ 105 IKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKALSK 176 (183)
T ss_dssp CCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEETTEEEEEEECCCH
T ss_pred CCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeECCEEEEEEecCCc
Confidence 99999999999999999999988 2457889999999999999999997 7999999999999998764
|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|