Citrus Sinensis ID: 046225
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| 359492067 | 573 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.102 | 0.9 | 4e-23 | |
| 255538406 | 533 | transcription factor, putative [Ricinus | 0.808 | 0.110 | 0.864 | 2e-22 | |
| 388514917 | 189 | unknown [Lotus japonicus] | 0.808 | 0.312 | 0.847 | 2e-22 | |
| 356552174 | 522 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.113 | 0.847 | 2e-22 | |
| 356562303 | 525 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.112 | 0.847 | 3e-22 | |
| 449446973 | 547 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.107 | 0.830 | 4e-22 | |
| 356509716 | 609 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.096 | 0.847 | 7e-22 | |
| 224137374 | 445 | predicted protein [Populus trichocarpa] | 0.808 | 0.132 | 0.813 | 8e-22 | |
| 357437941 | 547 | hypothetical protein MTR_1g021040 [Medic | 0.808 | 0.107 | 0.830 | 1e-21 | |
| 357465441 | 540 | hypothetical protein MTR_3g101340 [Medic | 0.808 | 0.109 | 0.830 | 1e-21 |
| >gi|359492067|ref|XP_002282310.2| PREDICTED: uncharacterized protein LOC100266128 [Vitis vinifera] gi|302142367|emb|CBI19570.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 112 bits (279), Expect = 4e-23, Method: Composition-based stats.
Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 1/60 (1%)
Query: 3 VRVYTASEVESELEVAKREYLQAAVGISSEKL-AIPKLLDWYLLDFAKDFESLLDWICLQ 61
VRVYTAS+VE+ELEVAKREYLQAAVGIS+ KL AIPKLLDWYLLDFAKDFES LDWICLQ
Sbjct: 473 VRVYTASQVENELEVAKREYLQAAVGISTTKLFAIPKLLDWYLLDFAKDFESFLDWICLQ 532
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255538406|ref|XP_002510268.1| transcription factor, putative [Ricinus communis] gi|223550969|gb|EEF52455.1| transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388514917|gb|AFK45520.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356552174|ref|XP_003544444.1| PREDICTED: uncharacterized protein LOC100817917 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356562303|ref|XP_003549411.1| PREDICTED: uncharacterized protein LOC100801978 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449446973|ref|XP_004141244.1| PREDICTED: uncharacterized protein LOC101211254 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356509716|ref|XP_003523592.1| PREDICTED: uncharacterized protein LOC100807554 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224137374|ref|XP_002327110.1| predicted protein [Populus trichocarpa] gi|222835425|gb|EEE73860.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357437941|ref|XP_003589246.1| hypothetical protein MTR_1g021040 [Medicago truncatula] gi|355478294|gb|AES59497.1| hypothetical protein MTR_1g021040 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357465441|ref|XP_003603005.1| hypothetical protein MTR_3g101340 [Medicago truncatula] gi|355492053|gb|AES73256.1| hypothetical protein MTR_3g101340 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| TAIR|locus:2115164 | 610 | AT4G37080 "AT4G37080" [Arabido | 0.808 | 0.096 | 0.766 | 1.8e-19 | |
| TAIR|locus:2165487 | 540 | AT5G42690 [Arabidopsis thalian | 0.808 | 0.109 | 0.779 | 1.3e-18 | |
| TAIR|locus:2043235 | 498 | AT2G39690 "AT2G39690" [Arabido | 0.808 | 0.118 | 0.55 | 7.3e-12 | |
| TAIR|locus:2101242 | 505 | AT3G12540 [Arabidopsis thalian | 0.808 | 0.116 | 0.5 | 1.4e-09 | |
| TAIR|locus:2089220 | 582 | AT3G13000 [Arabidopsis thalian | 0.753 | 0.094 | 0.421 | 3.5e-05 | |
| TAIR|locus:2171499 | 618 | AT5G47380 "AT5G47380" [Arabido | 0.767 | 0.090 | 0.333 | 0.0001 | |
| TAIR|locus:2015666 | 529 | AT1G16750 "AT1G16750" [Arabido | 0.753 | 0.103 | 0.403 | 0.0001 | |
| TAIR|locus:2011661 | 527 | AT1G76620 "AT1G76620" [Arabido | 0.739 | 0.102 | 0.345 | 0.00059 | |
| TAIR|locus:2049008 | 707 | AT2G23700 "AT2G23700" [Arabido | 0.794 | 0.082 | 0.344 | 0.00067 |
| TAIR|locus:2115164 AT4G37080 "AT4G37080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 241 (89.9 bits), Expect = 1.8e-19, P = 1.8e-19
Identities = 46/60 (76%), Positives = 53/60 (88%)
Query: 3 VRVYTASEVESELEVAKREYLQAAVGIS-SEKLAIPKLLDWYLLDFAKDFESLLDWICLQ 61
VRVYTA+ VE ELE AKR+YLQA+VGIS + KL +PK+LDWYLLDFAKD ESLLDW+CLQ
Sbjct: 511 VRVYTAANVEEELEAAKRDYLQASVGISKNNKLMLPKVLDWYLLDFAKDLESLLDWVCLQ 570
|
|
| TAIR|locus:2165487 AT5G42690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043235 AT2G39690 "AT2G39690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101242 AT3G12540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089220 AT3G13000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171499 AT5G47380 "AT5G47380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015666 AT1G16750 "AT1G16750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011661 AT1G76620 "AT1G76620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049008 AT2G23700 "AT2G23700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| pfam04784 | 112 | pfam04784, DUF547, Protein of unknown function, DU | 0.003 |
| >gnl|CDD|218263 pfam04784, DUF547, Protein of unknown function, DUF547 | Back alignment and domain information |
|---|
Score = 32.9 bits (76), Expect = 0.003
Identities = 8/23 (34%), Positives = 15/23 (65%)
Query: 1 MKVRVYTASEVESELEVAKREYL 23
++ YTA ++ +LE A RE++
Sbjct: 90 LRPEAYTAENLDEQLEEAAREFI 112
|
Family of uncharacterized proteins from C. elegans and A. thaliana. Length = 112 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00