Citrus Sinensis ID: 046312


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MVRFPVPTTNHIFPPKPSNCNSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
ccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHccccccccccHHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHHccccccccHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHccc
ccccccccccccHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccc
mvrfpvpttnhifppkpsncnsdlLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCtlsssknlTYARSILCNyvndsvpipwnnlirgyawsdrpREAVWVFIDmkrrgikpteftYPFVLKACAEISGLNEGMQVQANVtksgldsdvytnnnlVRFYGscrrkrdackvfDDMCERSVVSWNVIITVCVENLWLGEAVGYFVkmkdlgfepdeTTMLVVLSACtelgnlslgkwVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSnmknssispnyVTFLGVLCacnhagmvedgYRYFHEMehvhgikpmriHYHTMADILARAGHLKEAYTFImnmpfqpnpIVLRALLSAssihdakyqdgvgnEVRRRLLeleprgsqnlVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
mvrfpvpttnhifppkpsncnSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKrrgikpteftYPFVLKACAEISGLNEGMQVQANVTksgldsdvytnnNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHdakyqdgvgNEVRRRLLeleprgsqnlviVANKYaevgmwekvsnVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
MVRFPVPTTNHIFPPKPSNCNSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNevrrrllelePRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
***********************LLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVL**
***************************ARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
MVRFPVPTTNHIFPPKPSNCNSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
*****VPTTNHIFPPKPSNCNSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRFPVPTTNHIFPPKPSNCNSDLLSKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q9ZQA1501 Pentatricopeptide repeat- yes no 0.935 0.960 0.577 1e-163
A8MQA3595 Pentatricopeptide repeat- no no 0.933 0.806 0.353 9e-84
Q0WQW5638 Pentatricopeptide repeat- no no 0.978 0.788 0.365 3e-82
Q8LK93603 Pentatricopeptide repeat- no no 0.912 0.777 0.353 4e-81
Q9FI80646 Pentatricopeptide repeat- no no 0.916 0.729 0.347 2e-80
P93011583 Pentatricopeptide repeat- no no 0.883 0.778 0.366 8e-80
Q3E6Q1809 Pentatricopeptide repeat- no no 0.892 0.567 0.367 2e-79
Q9SX45596 Pentatricopeptide repeat- no no 0.951 0.820 0.350 1e-77
Q9FJY7620 Pentatricopeptide repeat- no no 0.928 0.769 0.322 4e-76
Q9ZVF4584 Pentatricopeptide repeat- no no 0.918 0.808 0.352 3e-75
>sp|Q9ZQA1|PP188_ARATH Pentatricopeptide repeat-containing protein At2g36730 OS=Arabidopsis thaliana GN=PCMP-E44 PE=3 SV=1 Back     alignment and function desciption
 Score =  574 bits (1480), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 280/485 (57%), Positives = 352/485 (72%), Gaps = 4/485 (0%)

Query: 26  SKARQCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSIL 85
           S+  QCL FLKLC S KHL QIH QI +S LQND+ I+ ELVR  +LS +K+L +AR++L
Sbjct: 11  SRKHQCLIFLKLCSSIKHLLQIHGQIHLSSLQNDSFIISELVRVSSLSLAKDLAFARTLL 70

Query: 86  CNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGL 145
             + +DS P  WN L RGY+ SD P E++WV+ +MKRRGIKP + T+PF+LKACA   GL
Sbjct: 71  L-HSSDSTPSTWNMLSRGYSSSDSPVESIWVYSEMKRRGIKPNKLTFPFLLKACASFLGL 129

Query: 146 NEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVC 205
             G Q+Q  V K G D DVY  NNL+  YG+C++  DA KVFD+M ER+VVSWN I+T  
Sbjct: 130 TAGRQIQVEVLKHGFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNVVSWNSIMTAL 189

Query: 206 VENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNC 265
           VEN  L      F +M    F PDETTM+V+LSAC   GNLSLGK VH Q++ R   LNC
Sbjct: 190 VENGKLNLVFECFCEMIGKRFCPDETTMVVLLSACG--GNLSLGKLVHSQVMVRELELNC 247

Query: 266 QLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNM-KN 324
           +LGTAL+DMYAK G +  ARL+F RM + NVWTWSAMI+GLAQ+G+AEEAL+LFS M K 
Sbjct: 248 RLGTALVDMYAKSGGLEYARLVFERMVDKNVWTWSAMIVGLAQYGFAEEALQLFSKMMKE 307

Query: 325 SSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLK 384
           SS+ PNYVTFLGVLCAC+H G+V+DGY+YFHEME +H IKPM IHY  M DIL RAG L 
Sbjct: 308 SSVRPNYVTFLGVLCACSHTGLVDDGYKYFHEMEKIHKIKPMMIHYGAMVDILGRAGRLN 367

Query: 385 EAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVAN 444
           EAY FI  MPF+P+ +V R LLSA SIH  +  +G+G +V++RL+ELEP+ S NLVIVAN
Sbjct: 368 EAYDFIKKMPFEPDAVVWRTLLSACSIHHDEDDEGIGEKVKKRLIELEPKRSGNLVIVAN 427

Query: 445 KYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILET 504
           ++AE  MW + + VRR MK   +KK+ G S +ELGGS HRF+SGYD + E   IY++L+ 
Sbjct: 428 RFAEARMWAEAAEVRRVMKETKMKKIAGESCLELGGSFHRFFSGYDPRSEYVSIYELLDL 487

Query: 505 LNLHM 509
               +
Sbjct: 488 FKFQL 492





Arabidopsis thaliana (taxid: 3702)
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q0WQW5|PPR85_ARATH Pentatricopeptide repeat-containing protein At1g59720, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H51 PE=2 SV=2 Back     alignment and function description
>sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protein At2g02980 OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protein At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=3 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVF4|PP140_ARATH Pentatricopeptide repeat-containing protein At2g01510, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H37 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
255582129 1157 Cell division protein ftsH, putative [Ri 0.935 0.415 0.648 0.0
147852347505 hypothetical protein VITISV_032528 [Viti 0.978 0.996 0.590 0.0
224141397505 predicted protein [Populus trichocarpa] 0.976 0.994 0.616 1e-179
359488917 1146 PREDICTED: ATP-dependent zinc metallopro 0.945 0.424 0.585 1e-175
449519932516 PREDICTED: pentatricopeptide repeat-cont 1.0 0.996 0.563 1e-171
357487485498 Pentatricopeptide repeat-containing prot 0.951 0.981 0.577 1e-171
356567046505 PREDICTED: pentatricopeptide repeat-cont 0.949 0.966 0.595 1e-171
449461643516 PREDICTED: pentatricopeptide repeat-cont 1.0 0.996 0.562 1e-170
297827165507 pentatricopeptide repeat-containing prot 0.953 0.966 0.572 1e-162
15228026501 pentatricopeptide repeat-containing prot 0.935 0.960 0.577 1e-161
>gi|255582129|ref|XP_002531859.1| Cell division protein ftsH, putative [Ricinus communis] gi|223528509|gb|EEF30537.1| Cell division protein ftsH, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/483 (64%), Positives = 381/483 (78%), Gaps = 2/483 (0%)

Query: 31   CLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVN 90
            CLS LKLC S KHLYQIH+QIQVSGLQ D  ++ +L++F +LS SK+L+YA+SIL + V+
Sbjct: 667  CLSLLKLCSSIKHLYQIHSQIQVSGLQGDTFLVTQLIKFSSLSPSKDLSYAQSILDHSVH 726

Query: 91   DSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQ 150
              VP+PWN LIRGYA S+ P++A++V+ +M+  GI+P   T+PF+LKACA      EG Q
Sbjct: 727  -PVPLPWNILIRGYADSNTPKDALFVYRNMRNEGIRPNSLTFPFLLKACAACFATKEGKQ 785

Query: 151  VQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLW 210
            V   V K GLD DVY NNNLV FYGSC++  DACKVFD+M ER+VVSWN +IT CVE+L 
Sbjct: 786  VHVEVIKYGLDCDVYVNNNLVNFYGSCKKILDACKVFDEMPERTVVSWNAVITSCVESLK 845

Query: 211  LGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTA 270
            LGEA+ YF+KM+D GFEPD TTM+++L  C E+GNL LG+W+H Q+IERG VLN QLGTA
Sbjct: 846  LGEAIRYFLKMRDFGFEPDGTTMVLMLVICAEMGNLGLGRWIHSQVIERGLVLNYQLGTA 905

Query: 271  LIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSS-ISP 329
            L+DMYAK GAVG A+L+F RM+E NVWTWSAMILGLAQHG+A+E LELF +M  SS I P
Sbjct: 906  LVDMYAKSGAVGYAKLVFDRMKEKNVWTWSAMILGLAQHGFAKEGLELFLDMMRSSLIHP 965

Query: 330  NYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTF 389
            NYVTFLGVLCAC+HAG+V DG+RYFHEM H +GIKPM +HY  M DIL RAG LKEAY F
Sbjct: 966  NYVTFLGVLCACSHAGLVSDGFRYFHEMGHTYGIKPMMVHYGAMVDILGRAGLLKEAYNF 1025

Query: 390  IMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEV 449
            I  MPFQP+PIV R LLSA SIHD K   GV  +VR+RLLELEPR S N V+VAN YA+ 
Sbjct: 1026 ITKMPFQPDPIVWRTLLSACSIHDVKDSTGVAYKVRKRLLELEPRRSGNFVMVANMYADA 1085

Query: 450  GMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHM 509
            GMWEK + VRR M++ GLKK  G S VEL GSIHRF+SGYDSQ +  G+YQ+L+ LNLHM
Sbjct: 1086 GMWEKAAKVRRVMRDGGLKKKAGESCVELSGSIHRFFSGYDSQDDKEGMYQLLDGLNLHM 1145

Query: 510  KVL 512
            +++
Sbjct: 1146 QMM 1148




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147852347|emb|CAN80116.1| hypothetical protein VITISV_032528 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141397|ref|XP_002324059.1| predicted protein [Populus trichocarpa] gi|222867061|gb|EEF04192.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488917|ref|XP_002283393.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 6, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449519932|ref|XP_004166988.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357487485|ref|XP_003614030.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515365|gb|AES96988.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356567046|ref|XP_003551734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Glycine max] Back     alignment and taxonomy information
>gi|449461643|ref|XP_004148551.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297827165|ref|XP_002881465.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327304|gb|EFH57724.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228026|ref|NP_181211.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216191|sp|Q9ZQA1.1|PP188_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g36730 gi|4415918|gb|AAD20149.1| hypothetical protein [Arabidopsis thaliana] gi|330254198|gb|AEC09292.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
TAIR|locus:2040565501 AT2G36730 [Arabidopsis thalian 0.945 0.970 0.563 1.2e-143
TAIR|locus:2154389646 LPA66 "LOW PSII ACCUMULATION 6 0.677 0.538 0.358 4.6e-78
TAIR|locus:2025946638 CRR28 "CHLORORESPIRATORY REDUC 0.982 0.791 0.362 3.4e-77
TAIR|locus:4010713895595 AT4G21065 "AT4G21065" [Arabido 0.931 0.805 0.346 2.4e-76
TAIR|locus:2056740603 OTP85 "ORGANELLE TRANSCRIPT PR 0.918 0.782 0.347 2.2e-73
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.892 0.567 0.359 8.6e-72
TAIR|locus:2011892596 AT1G50270 "AT1G50270" [Arabido 0.896 0.773 0.351 1.1e-71
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.671 0.494 0.358 1.6e-71
TAIR|locus:2057574583 AT2G33760 [Arabidopsis thalian 0.898 0.792 0.354 4.8e-71
TAIR|locus:2049562584 AT2G01510 "AT2G01510" [Arabido 0.912 0.803 0.351 1.8e-69
TAIR|locus:2040565 AT2G36730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1404 (499.3 bits), Expect = 1.2e-143, P = 1.2e-143
 Identities = 277/492 (56%), Positives = 346/492 (70%)

Query:    21 NSDLLSKAR--QCLSFLKLCCSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNL 78
             +SD   K+R  QCL FLKLC S KHL QIH QI +S LQND+ I+ ELVR  +LS +K+L
Sbjct:     4 SSDSCFKSRKHQCLIFLKLCSSIKHLLQIHGQIHLSSLQNDSFIISELVRVSSLSLAKDL 63

Query:    79 TYARSILCNYVNDSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKA 138
              +AR++L  + +DS P  WN L RGY+ SD P E++WV+ +MKRRGIKP + T+PF+LKA
Sbjct:    64 AFARTLLL-HSSDSTPSTWNMLSRGYSSSDSPVESIWVYSEMKRRGIKPNKLTFPFLLKA 122

Query:   139 CAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSW 198
             CA   GL  G Q+Q  V K G D DVY  NNL+  YG+C++  DA KVFD+M ER+VVSW
Sbjct:   123 CASFLGLTAGRQIQVEVLKHGFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNVVSW 182

Query:   199 NVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIE 258
             N I+T  VEN  L      F +M    F PDETTM+V+LSAC   GNLSLGK VH Q++ 
Sbjct:   183 NSIMTALVENGKLNLVFECFCEMIGKRFCPDETTMVVLLSACG--GNLSLGKLVHSQVMV 240

Query:   259 RGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALEL 318
             R   LNC+LGTAL+DMYAK G +  ARL+F RM + NVWTWSAMI+GLAQ+G+AEEAL+L
Sbjct:   241 RELELNCRLGTALVDMYAKSGGLEYARLVFERMVDKNVWTWSAMIVGLAQYGFAEEALQL 300

Query:   319 FSNM-KNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADIL 377
             FS M K SS+ PNYVTFLGVLCAC+H G+V+DGY+YFHEME +H IKPM IHY  M DIL
Sbjct:   301 FSKMMKESSVRPNYVTFLGVLCACSHTGLVDDGYKYFHEMEKIHKIKPMMIHYGAMVDIL 360

Query:   378 ARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGVGNXXXXXXXXXXPRGSQ 437
              RAG L EAY FI  MPF+P+ +V R LLSA SIH  +  +G+G           P+ S 
Sbjct:   361 GRAGRLNEAYDFIKKMPFEPDAVVWRTLLSACSIHHDEDDEGIGEKVKKRLIELEPKRSG 420

Query:   438 NLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAG 497
             NLVIVAN++AE  MW + + VRR MK   +KK+ G S +ELGGS HRF+SGYD + E   
Sbjct:   421 NLVIVANRFAEARMWAEAAEVRRVMKETKMKKIAGESCLELGGSFHRFFSGYDPRSEYVS 480

Query:   498 IYQILETLNLHM 509
             IY++L+     +
Sbjct:   481 IYELLDLFKFQL 492




GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025946 CRR28 "CHLORORESPIRATORY REDUCTION28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056740 OTP85 "ORGANELLE TRANSCRIPT PROCESSING 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011892 AT1G50270 "AT1G50270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057574 AT2G33760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049562 AT2G01510 "AT2G01510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZQA1PP188_ARATHNo assigned EC number0.57730.93570.9600yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-88
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-76
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-45
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-39
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-32
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-31
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-20
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-04
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  287 bits (737), Expect = 6e-88
 Identities = 145/420 (34%), Positives = 224/420 (53%), Gaps = 5/420 (1%)

Query: 95  IPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQAN 154
           + W  +I GY  +  P +A+  +  M++  + P E T   VL ACA +  L+ G+++   
Sbjct: 355 VSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHEL 414

Query: 155 VTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVCVENLWLGEA 214
             + GL S V   N L+  Y  C+    A +VF ++ E+ V+SW  II     N    EA
Sbjct: 415 AERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEA 474

Query: 215 VGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDM 274
           + +F +M  L  +P+  T++  LSAC  +G L  GK +H  ++  G   +  L  AL+D+
Sbjct: 475 LIFFRQML-LTLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDL 533

Query: 275 YAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTF 334
           Y +CG +  A   F+  E+ +V +W+ ++ G   HG    A+ELF+ M  S ++P+ VTF
Sbjct: 534 YVRCGRMNYAWNQFNSHEK-DVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTF 592

Query: 335 LGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMP 394
           + +LCAC+ +GMV  G  YFH ME  + I P   HY  + D+L RAG L EAY FI  MP
Sbjct: 593 ISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMP 652

Query: 395 FQPNPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEK 454
             P+P V  ALL+A  IH       +G    + + EL+P      +++ N YA+ G W++
Sbjct: 653 ITPDPAVWGALLNACRIH---RHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDE 709

Query: 455 VSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQILETLNLHMKVLNF 514
           V+ VR+ M+  GL    G SWVE+ G +H F +  +S  ++  I  +LE     MK    
Sbjct: 710 VARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGL 769


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.71
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.7
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.67
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.66
KOG2003840 consensus TPR repeat-containing protein [General f 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.59
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.54
KOG0547606 consensus Translocase of outer mitochondrial membr 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.51
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.5
KOG1915677 consensus Cell cycle control protein (crooked neck 99.49
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.47
KOG2003 840 consensus TPR repeat-containing protein [General f 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.39
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.33
PF1304150 PPR_2: PPR repeat family 99.31
KOG0547606 consensus Translocase of outer mitochondrial membr 99.31
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.29
PF1304150 PPR_2: PPR repeat family 99.28
PRK12370553 invasion protein regulator; Provisional 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.21
PRK12370553 invasion protein regulator; Provisional 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.19
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.18
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.17
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.17
KOG1129478 consensus TPR repeat-containing protein [General f 99.16
KOG2376652 consensus Signal recognition particle, subunit Srp 99.15
PRK11189296 lipoprotein NlpI; Provisional 99.14
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.09
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.08
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.06
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.06
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.05
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.03
PRK11189296 lipoprotein NlpI; Provisional 99.01
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.0
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.99
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.98
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.98
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.93
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.87
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.86
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.84
PRK04841903 transcriptional regulator MalT; Provisional 98.83
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.83
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.76
PRK04841903 transcriptional regulator MalT; Provisional 98.75
KOG1125579 consensus TPR repeat-containing protein [General f 98.73
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.69
PF1285434 PPR_1: PPR repeat 98.66
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.66
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.63
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
KOG1125579 consensus TPR repeat-containing protein [General f 98.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.59
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.56
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.55
PF1285434 PPR_1: PPR repeat 98.53
KOG1128777 consensus Uncharacterized conserved protein, conta 98.51
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.5
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.47
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.46
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.46
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.46
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.41
PRK15359144 type III secretion system chaperone protein SscB; 98.4
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.39
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.37
PLN02789320 farnesyltranstransferase 98.36
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.36
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.34
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.33
PLN02789320 farnesyltranstransferase 98.31
PRK15359144 type III secretion system chaperone protein SscB; 98.31
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.29
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.26
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.23
PRK10370198 formate-dependent nitrite reductase complex subuni 98.2
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.19
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.17
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.14
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.01
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.98
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.92
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.91
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.91
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.85
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.79
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.78
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.78
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.76
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.71
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.68
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.67
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.63
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.58
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.56
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.56
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.54
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.53
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.51
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.5
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.45
KOG0553304 consensus TPR repeat-containing protein [General f 97.43
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.42
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.42
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.41
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.38
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.37
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.36
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.36
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.35
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.34
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.33
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.33
COG4700251 Uncharacterized protein conserved in bacteria cont 97.32
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.32
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.31
KOG20411189 consensus WD40 repeat protein [General function pr 97.3
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.27
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.24
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 97.22
PRK15331165 chaperone protein SicA; Provisional 97.21
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.2
PF12688120 TPR_5: Tetratrico peptide repeat 97.2
COG4700251 Uncharacterized protein conserved in bacteria cont 97.2
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.19
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.1
KOG0553304 consensus TPR repeat-containing protein [General f 97.09
PF1337173 TPR_9: Tetratricopeptide repeat 97.07
PF12688120 TPR_5: Tetratrico peptide repeat 97.03
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.03
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.03
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.02
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.0
COG3898531 Uncharacterized membrane-bound protein [Function u 96.99
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.95
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.86
PF1343134 TPR_17: Tetratricopeptide repeat 96.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.82
PRK10803263 tol-pal system protein YbgF; Provisional 96.81
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.72
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.72
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.69
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.55
PRK10803263 tol-pal system protein YbgF; Provisional 96.55
COG3898531 Uncharacterized membrane-bound protein [Function u 96.55
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.54
PRK11619 644 lytic murein transglycosylase; Provisional 96.46
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.39
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.35
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.19
PF1337173 TPR_9: Tetratricopeptide repeat 96.05
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.97
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.88
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.86
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.81
KOG3941406 consensus Intermediate in Toll signal transduction 95.73
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.66
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.59
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.54
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.49
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.47
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.4
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.39
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.34
PF1342844 TPR_14: Tetratricopeptide repeat 95.33
KOG20411189 consensus WD40 repeat protein [General function pr 95.29
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.25
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.25
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.22
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.12
KOG1258577 consensus mRNA processing protein [RNA processing 95.11
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.08
PF13512142 TPR_18: Tetratricopeptide repeat 95.06
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.96
PRK11906458 transcriptional regulator; Provisional 94.71
KOG3941 406 consensus Intermediate in Toll signal transduction 94.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.54
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.43
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.42
smart00299140 CLH Clathrin heavy chain repeat homology. 94.32
KOG4555175 consensus TPR repeat-containing protein [Function 94.29
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.28
smart00299140 CLH Clathrin heavy chain repeat homology. 94.23
KOG1941518 consensus Acetylcholine receptor-associated protei 94.02
PRK15331165 chaperone protein SicA; Provisional 93.98
PF13512142 TPR_18: Tetratricopeptide repeat 93.85
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.54
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.46
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.44
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.42
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.41
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.36
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.19
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.19
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.92
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.85
PRK11906458 transcriptional regulator; Provisional 92.84
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.67
KOG1585308 consensus Protein required for fusion of vesicles 92.66
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.62
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.59
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.34
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.02
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.97
PF1342844 TPR_14: Tetratricopeptide repeat 91.9
PRK09687280 putative lyase; Provisional 91.9
KOG1585308 consensus Protein required for fusion of vesicles 91.86
KOG1258577 consensus mRNA processing protein [RNA processing 91.73
COG3629280 DnrI DNA-binding transcriptional activator of the 91.61
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.21
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 91.16
KOG4555175 consensus TPR repeat-containing protein [Function 91.11
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.88
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.87
KOG1586288 consensus Protein required for fusion of vesicles 90.55
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.51
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.38
COG3629280 DnrI DNA-binding transcriptional activator of the 90.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.93
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.64
KOG4234271 consensus TPR repeat-containing protein [General f 89.58
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.54
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.9
PRK09687280 putative lyase; Provisional 88.85
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 88.81
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.64
PRK11619644 lytic murein transglycosylase; Provisional 88.56
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.5
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.19
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.19
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.95
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.84
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.83
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.49
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 87.46
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 87.33
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.27
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.98
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 86.79
PF1343134 TPR_17: Tetratricopeptide repeat 86.57
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.24
PF13929292 mRNA_stabil: mRNA stabilisation 86.13
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.97
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 85.93
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.65
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.47
PF09477116 Type_III_YscG: Bacterial type II secretion system 84.67
PF13762145 MNE1: Mitochondrial splicing apparatus component 84.44
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.59
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.54
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.46
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 82.9
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 82.88
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 82.41
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.38
KOG3364149 consensus Membrane protein involved in organellar 81.78
PRK12798421 chemotaxis protein; Reviewed 81.5
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.45
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.31
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 81.23
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 80.98
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.37
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.2
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-74  Score=597.23  Aligned_cols=484  Identities=29%  Similarity=0.485  Sum_probs=473.1

Q ss_pred             cchhhhHHHHHHHhhc---ChhHHHHHHHHHHHhCCCCChHHHHHHHHhcccCCCCChHHHHHHHcccCCCCCcccHHHH
Q 046312           24 LLSKARQCLSFLKLCC---SKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVNDSVPIPWNNL  100 (514)
Q Consensus        24 ~~~~~~~~~~ll~~~~---~~~~~~~~~~~~~~~g~~~~~~~~~~ll~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l  100 (514)
                      ..|+..||.+++.+|.   +.+.+.++|..|.+.|+.||..+++.++.+|+  +.|++++|.++|++|+ .||.++||.+
T Consensus       119 ~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~--k~g~~~~A~~lf~~m~-~~~~~t~n~l  195 (697)
T PLN03081        119 FTLPASTYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHV--KCGMLIDARRLFDEMP-ERNLASWGTI  195 (697)
T ss_pred             CCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHh--cCCCHHHHHHHHhcCC-CCCeeeHHHH
Confidence            3577889999999985   45667899999999999999999999999999  9999999999999999 8999999999


Q ss_pred             HHHHHhCCCchHHHHHHHHHHHcCCCCCcchHHHHHHHHhccCCchHHHHHHHHHHHhCCCCCcchHHHHHHHHHcCCCH
Q 046312          101 IRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTNNNLVRFYGSCRRK  180 (514)
Q Consensus       101 i~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~  180 (514)
                      |.+|++.|++++|+++|++|.+.|+.||..+|+.++.+|++.|+.+.+.+++..+.+.|+.||..+|++|+++|+++|++
T Consensus       196 i~~~~~~g~~~~A~~lf~~M~~~g~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~  275 (697)
T PLN03081        196 IGGLVDAGNYREAFALFREMWEDGSDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDI  275 (697)
T ss_pred             HHHHHHCcCHHHHHHHHHHHHHhCCCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCChhhHHHHHHHHHhCCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhC
Q 046312          181 RDACKVFDDMCERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERG  260 (514)
Q Consensus       181 ~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~  260 (514)
                      ++|.++|++|.++|+.+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|++++|.+++..|.+.|
T Consensus       276 ~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g  355 (697)
T PLN03081        276 EDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTG  355 (697)
T ss_pred             HHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchhHHHHHHHHHHhcCCHHHHHHHHHhcCcCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 046312          261 TVLNCQLGTALIDMYAKCGAVGCARLLFSRMEEINVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCA  340 (514)
Q Consensus       261 ~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~  340 (514)
                      +.||..+|++|+++|++.|++++|.++|++|.++|..+||+||.+|++.|+.++|.++|++|.+.|+.||..||+.++.+
T Consensus       356 ~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a  435 (697)
T PLN03081        356 FPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSA  435 (697)
T ss_pred             CCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhccCcHHHHHHHHHHHHHhhCCCCchHHHHHHHHHHHhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCCCcchH
Q 046312          341 CNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMNMPFQPNPIVLRALLSASSIHDAKYQDGV  420 (514)
Q Consensus       341 ~~~~~~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~~~~  420 (514)
                      |++.|.+++|.++|+.|.+.+|+.|+..+|+.++++|++.|++++|.+++++|+..|+..+|++|+.+|..+|+   ++.
T Consensus       436 ~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~---~~~  512 (697)
T PLN03081        436 CRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKN---LEL  512 (697)
T ss_pred             HhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCC---cHH
Confidence            99999999999999999987799999999999999999999999999999999999999999999999999999   999


Q ss_pred             HHHHHHHHHhcCCCCCchHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCCceeEEEECCeEEEEEecccCCcChHHHHH
Q 046312          421 GNEVRRRLLELEPRGSQNLVIVANKYAEVGMWEKVSNVRRFMKNVGLKKMKGMSWVELGGSIHRFYSGYDSQVELAGIYQ  500 (514)
Q Consensus       421 a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~  500 (514)
                      |..+.+.+.+++|++...|..|+++|++.|++++|.+++++|+++|+.+.|+++||++.+.++.++.+...|++.+++++
T Consensus       513 a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~  592 (697)
T PLN03081        513 GRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQ  592 (697)
T ss_pred             HHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhcC
Q 046312          501 ILETLNLHMKVLN  513 (514)
Q Consensus       501 ~~~~m~~~~~~~~  513 (514)
                      .++++..+|++.+
T Consensus       593 ~l~~l~~~~~~~g  605 (697)
T PLN03081        593 KLDELMKEISEYG  605 (697)
T ss_pred             HHHHHHHHHHHcC
Confidence            9999999998865



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 59.8 bits (143), Expect = 1e-09
 Identities = 28/188 (14%), Positives = 60/188 (31%), Gaps = 9/188 (4%)

Query: 221 MKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGA 280
            +     P E  +  +L       +L + +    Q  +       Q   A          
Sbjct: 83  TRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQ 142

Query: 281 VGCARLLFSRMEE-------INVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVT 333
           +  A  L             + +  ++A++LG A+ G  +E + +   +K++ ++P+ ++
Sbjct: 143 LPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLS 202

Query: 334 FLGVL-CACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKEAYTFIMN 392
           +   L C            R   +M    G+K   +    +     RA  LK  +     
Sbjct: 203 YAAALQCMGRQDQDAGTIERCLEQMSQ-EGLKLQALFTAVLLSEEDRATVLKAVHKVKPT 261

Query: 393 MPFQPNPI 400
               P   
Sbjct: 262 FSLPPQLP 269


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.62
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
3u4t_A272 TPR repeat-containing protein; structural genomics 99.57
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.53
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.4
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.38
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.36
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.34
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.33
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.1
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.97
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.97
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.96
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.89
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.86
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.83
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.83
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.82
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.78
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.78
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.75
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.66
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.65
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.65
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.6
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.51
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.49
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.49
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.46
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.38
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.37
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.34
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.33
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.33
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.32
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.3
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.28
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.21
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.2
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.2
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.19
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.18
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.08
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.03
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.02
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.0
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.97
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.94
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.94
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.89
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.88
3k9i_A117 BH0479 protein; putative protein binding protein, 97.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.86
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.82
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.82
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.81
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.73
3k9i_A117 BH0479 protein; putative protein binding protein, 97.72
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.64
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.64
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.63
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.62
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.58
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.51
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.51
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.49
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.48
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.48
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.41
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.36
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.04
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.97
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.81
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.79
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.77
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.7
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.59
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.42
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.33
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.31
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.22
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.12
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.94
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.89
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.65
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.2
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.14
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.14
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.42
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.32
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.29
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.24
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.11
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.97
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.76
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.74
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.09
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.09
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.86
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.84
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.67
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.15
2uwj_G115 Type III export protein PSCG; virulence, chaperone 92.07
2p58_C116 Putative type III secretion protein YSCG; type III 91.91
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.61
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.27
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.25
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.21
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.68
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.35
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.46
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 86.51
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.97
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.89
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.21
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.19
2p58_C116 Putative type III secretion protein YSCG; type III 84.74
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 83.55
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 80.72
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.45
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.8e-37  Score=318.33  Aligned_cols=427  Identities=9%  Similarity=-0.016  Sum_probs=372.6

Q ss_pred             hhhHHHHHHHhh---cChhHHHHHHHHHHHhCCCCChHHHHHHHHhcccCCCCChHHHHHHHcccCC-CCCcccHHHHHH
Q 046312           27 KARQCLSFLKLC---CSKKHLYQIHAQIQVSGLQNDAQILKELVRFCTLSSSKNLTYARSILCNYVN-DSVPIPWNNLIR  102 (514)
Q Consensus        27 ~~~~~~~ll~~~---~~~~~~~~~~~~~~~~g~~~~~~~~~~ll~~~~~~~~g~~~~A~~~~~~~~~-~~~~~~~~~li~  102 (514)
                      +...+..+.+.+   ++...+..+++.+..  ..|+..++..++..|.  +.|++++|..+|+++.. .+++.+|+.++.
T Consensus        83 ~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~--~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~  158 (597)
T 2xpi_A           83 REDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYC--CTGDYARAKCLLTKEDLYNRSSACRYLAAF  158 (597)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHH--HTTCHHHHHHHHHHTCGGGTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHH--HcCcHHHHHHHHHHHhccccchhHHHHHHH
Confidence            444455555544   678888999998885  4578889999999999  99999999999999832 678899999999


Q ss_pred             HHHhCCCchHHHHHHHHHHHc---------------CCCCCcchHHHHHHHHhccCCchHHHHHHHHHHHhCCCCCcchH
Q 046312          103 GYAWSDRPREAVWVFIDMKRR---------------GIKPTEFTYPFVLKACAEISGLNEGMQVQANVTKSGLDSDVYTN  167 (514)
Q Consensus       103 ~~~~~g~~~~a~~~~~~m~~~---------------~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~  167 (514)
                      +|.+.|++++|+++|+++...               |.+++..+|+.++.++.+.|++++|.++|+++.+.+ +.+...+
T Consensus       159 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~  237 (597)
T 2xpi_A          159 CLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-AKCYEAF  237 (597)
T ss_dssp             HHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHH
T ss_pred             HHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-chhhHHH
Confidence            999999999999999953221               223356789999999999999999999999999875 2233333


Q ss_pred             HHH--------------------------------------HHHHHcCCCHHHHHHHhhccCC--CChhhHHHHHHHHHh
Q 046312          168 NNL--------------------------------------VRFYGSCRRKRDACKVFDDMCE--RSVVSWNVIITVCVE  207 (514)
Q Consensus       168 ~~l--------------------------------------i~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~li~~~~~  207 (514)
                      ..+                                      +..|.+.|++++|.++|+++.+  ++..+|+.++.+|.+
T Consensus       238 ~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~  317 (597)
T 2xpi_A          238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFV  317 (597)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHH
Confidence            332                                      4556678999999999999976  789999999999999


Q ss_pred             CCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHH
Q 046312          208 NLWLGEAVGYFVKMKDLGFEPDETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLL  287 (514)
Q Consensus       208 ~~~~~~a~~~~~~m~~~~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~  287 (514)
                      .|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|..+++.+.+.. +.+..+++.++.+|.+.|++++|.++
T Consensus       318 ~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~  395 (597)
T 2xpi_A          318 RSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRY  395 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             hcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHH
Confidence            999999999999999875 4477889999999999999999999999999765 45788999999999999999999999


Q ss_pred             HHhcCc---CCHHHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhhCCC
Q 046312          288 FSRMEE---INVWTWSAMILGLAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIK  364 (514)
Q Consensus       288 ~~~~~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~  364 (514)
                      |+++.+   .+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..++..++.+|.+.|++++|.++|+++.+.  .+
T Consensus       396 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~  472 (597)
T 2xpi_A          396 FSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQ  472 (597)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CC
T ss_pred             HHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CC
Confidence            999864   468899999999999999999999999999864 457889999999999999999999999999975  24


Q ss_pred             CchHHHHHHHHHHHhcCCHHHHHHHHHhCC-------CCCC--HHHHHHHHHHHHhcCCCCcchHHHHHHHHHHhcCCCC
Q 046312          365 PMRIHYHTMADILARAGHLKEAYTFIMNMP-------FQPN--PIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRG  435 (514)
Q Consensus       365 p~~~~~~~li~~~~~~g~~~~A~~~~~~~~-------~~p~--~~~~~~l~~~~~~~~~~~~~~~a~~~~~~~~~~~p~~  435 (514)
                      .+..+|..++..|.+.|++++|.++|+++.       ..|+  ..+|..++.+|...|+   +++|.+.++.+.+.+|++
T Consensus       473 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~---~~~A~~~~~~~~~~~p~~  549 (597)
T 2xpi_A          473 YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKM---YDAAIDALNQGLLLSTND  549 (597)
T ss_dssp             CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTC---HHHHHHHHHHHHHHSSCC
T ss_pred             CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcC---HHHHHHHHHHHHHhCCCC
Confidence            468899999999999999999999999983       3677  7899999999999999   999999999999999999


Q ss_pred             CchHHHHHHHHHhcCCHHHHHHHHHHHHhCC
Q 046312          436 SQNLVIVANKYAEVGMWEKVSNVRRFMKNVG  466 (514)
Q Consensus       436 ~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~  466 (514)
                      +.+|..++.+|.+.|++++|.++++++.+..
T Consensus       550 ~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~  580 (597)
T 2xpi_A          550 ANVHTAIALVYLHKKIPGLAITHLHESLAIS  580 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             hHHHHHHHHHHHHhCCHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999998754



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.1
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.01
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.0
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.99
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.79
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.73
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.47
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.32
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.26
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.17
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.14
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.1
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.05
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.02
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.91
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.88
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.86
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.8
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.79
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.75
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.6
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.44
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.42
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.39
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.27
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.2
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.18
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.1
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.03
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.98
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.78
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.58
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.9
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.62
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.96
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.83
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.34
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 89.87
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.6
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 82.74
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=1.5e-21  Score=185.63  Aligned_cols=368  Identities=10%  Similarity=-0.016  Sum_probs=296.5

Q ss_pred             CCCChHHHHHHHcccCC--CCCcccHHHHHHHHHhCCCchHHHHHHHHHHHcCCCCCcchHHHHHHHHhccCCchHHHHH
Q 046312           74 SSKNLTYARSILCNYVN--DSVPIPWNNLIRGYAWSDRPREAVWVFIDMKRRGIKPTEFTYPFVLKACAEISGLNEGMQV  151 (514)
Q Consensus        74 ~~g~~~~A~~~~~~~~~--~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~  151 (514)
                      +.|++++|...++++..  +.++.++..+...+.+.|++++|+..|++..+.. +-+..+|..+..++...|++++|...
T Consensus        11 ~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~A~~~   89 (388)
T d1w3ba_          11 QAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQEAIEH   89 (388)
T ss_dssp             HHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHH
T ss_pred             HcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccccccccc
Confidence            68999999999988742  3456778888889999999999999999988753 33456788888999999999999999


Q ss_pred             HHHHHHhCCCCCcchHHHHHHHHHcCCCHHHHHHHhhcc---CCCChhhHHHHHHHHHhCCChhHHHHHHHHHHHCCCCC
Q 046312          152 QANVTKSGLDSDVYTNNNLVRFYGSCRRKRDACKVFDDM---CERSVVSWNVIITVCVENLWLGEAVGYFVKMKDLGFEP  228 (514)
Q Consensus       152 ~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~---~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p  228 (514)
                      +....+.. +.+..............+....+.......   ..................+....+...+.+..... +-
T Consensus        90 ~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  167 (388)
T d1w3ba_          90 YRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PN  167 (388)
T ss_dssp             HHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TT
T ss_pred             cccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC-cc
Confidence            99988875 334444444444455555554444443333   33455556666677778888888888888877653 34


Q ss_pred             CHHHHHHHHHHHhccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHHhcCc---CCHHHHHHHHHH
Q 046312          229 DETTMLVVLSACTELGNLSLGKWVHLQLIERGTVLNCQLGTALIDMYAKCGAVGCARLLFSRMEE---INVWTWSAMILG  305 (514)
Q Consensus       229 ~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~  305 (514)
                      +...+..+...+...|+++.|...++...+... -+...+..+...+...|++++|...+++..+   .+...+..+...
T Consensus       168 ~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~  246 (388)
T d1w3ba_         168 FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACV  246 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             hhHHHHhhcccccccCcHHHHHHHHHHHHHhCc-ccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHH
Confidence            567778888889999999999999999988763 3577888899999999999999999988764   566788888999


Q ss_pred             HHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhhCCCCchHHHHHHHHHHHhcCCHHH
Q 046312          306 LAQHGYAEEALELFSNMKNSSISPNYVTFLGVLCACNHAGMVEDGYRYFHEMEHVHGIKPMRIHYHTMADILARAGHLKE  385 (514)
Q Consensus       306 ~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~  385 (514)
                      +.+.|++++|...|++..+.. +-+..++..+..++...|++++|...++.....  .+.+...+..+...+.+.|++++
T Consensus       247 ~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~  323 (388)
T d1w3ba_         247 YYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEE  323 (388)
T ss_dssp             HHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHH
Confidence            999999999999999998853 234677888889999999999999999998874  35567788889999999999999


Q ss_pred             HHHHHHhCC-CCC-CHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHhcCCCCCchHHHHHHHHHhcCC
Q 046312          386 AYTFIMNMP-FQP-NPIVLRALLSASSIHDAKYQDGVGNEVRRRLLELEPRGSQNLVIVANKYAEVGM  451 (514)
Q Consensus       386 A~~~~~~~~-~~p-~~~~~~~l~~~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  451 (514)
                      |.+.|++.. ..| +..++..+...+...|+   +++|.+.++++.+++|+++.+|..++.+|.+.|+
T Consensus       324 A~~~~~~al~~~p~~~~~~~~la~~~~~~g~---~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         324 AVRLYRKALEVFPEFAAAHSNLASVLQQQGK---LQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHTTSCTTCHHHHHHHHHHHHTTTC---CHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC---HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999875 555 46788889999999999   9999999999999999999999999999998875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure