Citrus Sinensis ID: 046694


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKAR
ccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccc
ccHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccc
mieprldfytrtgriDLANKIfdrlpvkdsaSWITLILGYGMLGELDVAINLFEAMRedgveyypvsHIGVLTacslgglvekGKKFFDEMqarnvkptetHYACMVYLLIKYNQKAR
mieprldfytrtgridlankifdrlpvkdSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQArnvkptethyACMVYLLIKYNQKAR
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKAR
*****LDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKY*****
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQK**
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKAR
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q9STF3 657 Pentatricopeptide repeat- yes no 0.974 0.175 0.405 5e-19
Q3ECB8467 Pentatricopeptide repeat- no no 0.974 0.246 0.387 2e-18
Q3E9N1775 Pentatricopeptide repeat- no no 0.898 0.136 0.392 4e-18
Q9LUS3654 Pentatricopeptide repeat- no no 0.906 0.163 0.394 5e-18
Q9SN39 871 Pentatricopeptide repeat- no no 0.906 0.122 0.416 7e-18
Q9ZVF4 584 Pentatricopeptide repeat- no no 0.898 0.181 0.394 8e-18
Q9LW32 659 Pentatricopeptide repeat- no no 0.889 0.159 0.424 9e-18
Q9LFI1 768 Pentatricopeptide repeat- no no 0.906 0.139 0.416 9e-18
Q9FI80 646 Pentatricopeptide repeat- no no 0.889 0.162 0.405 1e-17
Q0WN60 970 Pentatricopeptide repeat- no no 0.932 0.113 0.378 3e-17
>sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 1   MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDG 60
           +I   +  Y R G++++  ++FDR+  +D  SW +LI  YG+ G    AI +FE M  +G
Sbjct: 322 VISALVTMYGRCGKLEVGQRVFDRMHDRDVVSWNSLISSYGVHGYGKKAIQIFEEMLANG 381

Query: 61  VEYYPVSHIGVLTACSLGGLVEKGKKFFDEM-QARNVKPTETHYACMVYLLIKYNQ 115
               PV+ + VL ACS  GLVE+GK+ F+ M +   +KP   HYACMV LL + N+
Sbjct: 382 ASPTPVTFVSVLGACSHEGLVEEGKRLFETMWRDHGIKPQIEHYACMVDLLGRANR 437




Required for the intergenic processing between chloroplast rsp7 and ndhB transcripts.
Arabidopsis thaliana (taxid: 3702)
>sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protein At1g77170 OS=Arabidopsis thaliana GN=PCMP-E21 PE=2 SV=1 Back     alignment and function description
>sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protein At4g39952, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E98 PE=2 SV=2 Back     alignment and function description
>sp|Q9LUS3|PP237_ARATH Pentatricopeptide repeat-containing protein At3g16610 OS=Arabidopsis thaliana GN=PCMP-E91 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVF4|PP140_ARATH Pentatricopeptide repeat-containing protein At2g01510, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H37 PE=3 SV=1 Back     alignment and function description
>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein At3g26782, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H34 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
224103989 680 predicted protein [Populus trichocarpa] 0.881 0.152 0.685 8e-38
297742828 638 unnamed protein product [Vitis vinifera] 0.881 0.163 0.685 2e-35
356519887 813 PREDICTED: pentatricopeptide repeat-cont 0.881 0.127 0.676 1e-33
449445027 833 PREDICTED: pentatricopeptide repeat-cont 0.881 0.124 0.609 1e-31
449524410 684 PREDICTED: pentatricopeptide repeat-cont 0.881 0.152 0.609 1e-31
413946224 778 hypothetical protein ZEAMMB73_227843 [Ze 0.923 0.140 0.572 4e-31
242091211 771 hypothetical protein SORBIDRAFT_09g02670 0.906 0.138 0.572 1e-30
125579001 601 hypothetical protein OsJ_35746 [Oryza sa 0.949 0.186 0.539 2e-29
77554180 780 pentatricopeptide, putative, expressed [ 0.949 0.143 0.539 3e-29
357154827 735 PREDICTED: pentatricopeptide repeat-cont 0.923 0.148 0.527 1e-27
>gi|224103989|ref|XP_002313273.1| predicted protein [Populus trichocarpa] gi|222849681|gb|EEE87228.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 72/105 (68%), Positives = 90/105 (85%)

Query: 6   LDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYP 65
           LDFY + GRIDLA K+F ++P +D+ASW ++ILGYGMLGEL +AINLFEAM+EDGVEY  
Sbjct: 453 LDFYIKCGRIDLAGKVFRQIPSRDTASWNSMILGYGMLGELTIAINLFEAMKEDGVEYDS 512

Query: 66  VSHIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLL 110
           VS+I VL+ACS GGLVE+GKK+F+ MQ +N+KPT+ HYACMV LL
Sbjct: 513 VSYIAVLSACSHGGLVEEGKKYFEHMQVQNIKPTQMHYACMVDLL 557




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742828|emb|CBI35582.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519887|ref|XP_003528600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449445027|ref|XP_004140275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524410|ref|XP_004169216.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|413946224|gb|AFW78873.1| hypothetical protein ZEAMMB73_227843 [Zea mays] Back     alignment and taxonomy information
>gi|242091211|ref|XP_002441438.1| hypothetical protein SORBIDRAFT_09g026705 [Sorghum bicolor] gi|241946723|gb|EES19868.1| hypothetical protein SORBIDRAFT_09g026705 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|125579001|gb|EAZ20147.1| hypothetical protein OsJ_35746 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|77554180|gb|ABA96976.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357154827|ref|XP_003576915.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like, partial [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2195980467 AT1G77170 "AT1G77170" [Arabido 0.974 0.246 0.387 2.3e-17
TAIR|locus:2102852 657 CRR2 "AT3G46790" [Arabidopsis 0.974 0.175 0.405 2.4e-17
TAIR|locus:2089333654 AT3G16610 "AT3G16610" [Arabido 0.906 0.163 0.394 6.3e-17
TAIR|locus:2049562 584 AT2G01510 "AT2G01510" [Arabido 0.898 0.181 0.403 6.5e-17
TAIR|locus:2124137 871 DOT4 "DEFECTIVELY ORGANIZED TR 0.906 0.122 0.416 1e-16
TAIR|locus:2083961 768 AT3G53360 "AT3G53360" [Arabido 0.906 0.139 0.416 1.1e-16
TAIR|locus:4010713776 659 AT3G26782 [Arabidopsis thalian 0.949 0.169 0.417 1.3e-16
TAIR|locus:2018668520 AT1G28690 [Arabidopsis thalian 0.889 0.201 0.415 2.3e-16
TAIR|locus:505006130 970 AT1G18485 [Arabidopsis thalian 0.932 0.113 0.378 3.2e-16
TAIR|locus:2154389 646 LPA66 "LOW PSII ACCUMULATION 6 0.889 0.162 0.405 3.5e-16
TAIR|locus:2195980 AT1G77170 "AT1G77170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 2.3e-17, P = 2.3e-17
 Identities = 45/116 (38%), Positives = 71/116 (61%)

Query:     1 MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDG 60
             M+   +D Y + GR+DLA+ IF+ +  ++  SW ++I+GY   G    A+  F  MRE G
Sbjct:   257 MLNSLIDMYGKCGRMDLASHIFEEMRQRNVVSWSSMIVGYAANGNTLEALECFRQMREFG 316

Query:    61 VEYYPVSHIGVLTACSLGGLVEKGKKFFDEMQAR-NVKPTETHYACMVYLLIKYNQ 115
             V    ++ +GVL+AC  GGLVE+GK +F  M++   ++P  +HY C+V LL +  Q
Sbjct:   317 VRPNKITFVGVLSACVHGGLVEEGKTYFAMMKSEFELEPGLSHYGCIVDLLSRDGQ 372


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2102852 CRR2 "AT3G46790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089333 AT3G16610 "AT3G16610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049562 AT2G01510 "AT2G01510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083961 AT3G53360 "AT3G53360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713776 AT3G26782 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018668 AT1G28690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00090980
hypothetical protein (680 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-25
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score = 99.6 bits (248), Expect = 1e-25
 Identities = 44/106 (41%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 6   LDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYP 65
           +D Y++ GR++ A  +FDR+P K+  SW  LI GYG  G    A+ +FE M  +GV    
Sbjct: 367 VDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNH 426

Query: 66  VSHIGVLTACSLGGLVEKGKKFFDEM-QARNVKPTETHYACMVYLL 110
           V+ + VL+AC   GL E+G + F  M +   +KP   HYACM+ LL
Sbjct: 427 VTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELL 472


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03077 857 Protein ECB2; Provisional 99.95
PLN03077 857 Protein ECB2; Provisional 99.95
PLN03218 1060 maturation of RBCL 1; Provisional 99.95
PLN03218 1060 maturation of RBCL 1; Provisional 99.95
PF1304150 PPR_2: PPR repeat family 99.79
PF1304150 PPR_2: PPR repeat family 99.77
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.45
PF1285434 PPR_1: PPR repeat 99.35
PF1285434 PPR_1: PPR repeat 99.21
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.17
PRK11788389 tetratricopeptide repeat protein; Provisional 99.13
PF1381234 PPR_3: Pentatricopeptide repeat domain 99.09
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.08
PF06239228 ECSIT: Evolutionarily conserved signalling interme 99.07
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.04
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.02
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.97
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.97
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.92
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.81
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.8
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.8
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.73
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.59
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.56
KOG3941 406 consensus Intermediate in Toll signal transduction 98.49
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.46
PRK12370553 invasion protein regulator; Provisional 98.41
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.4
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.36
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.33
PRK15359144 type III secretion system chaperone protein SscB; 98.31
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.29
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.28
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.25
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.24
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.2
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.17
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.13
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 98.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.1
PRK12370553 invasion protein regulator; Provisional 98.03
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.01
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.99
PRK15359144 type III secretion system chaperone protein SscB; 97.97
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.96
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.96
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.95
PRK10370198 formate-dependent nitrite reductase complex subuni 97.94
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.93
PRK11189 296 lipoprotein NlpI; Provisional 97.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.91
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.91
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.91
KOG1126638 consensus DNA-binding cell division cycle control 97.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.89
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.88
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.85
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.78
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.72
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.7
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 97.67
PRK14574 822 hmsH outer membrane protein; Provisional 97.67
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.67
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.65
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.65
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.63
KOG1129 478 consensus TPR repeat-containing protein [General f 97.62
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.59
PRK14574 822 hmsH outer membrane protein; Provisional 97.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PRK10370198 formate-dependent nitrite reductase complex subuni 97.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.49
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.48
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.47
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.44
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.42
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.41
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.41
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.38
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.35
PRK11189296 lipoprotein NlpI; Provisional 97.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.31
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.26
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.24
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.23
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.21
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.18
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.18
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.17
KOG0553 304 consensus TPR repeat-containing protein [General f 97.15
KOG1126638 consensus DNA-binding cell division cycle control 97.11
PRK10803263 tol-pal system protein YbgF; Provisional 97.11
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.06
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.05
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.05
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.99
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.98
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.97
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.96
COG3629280 DnrI DNA-binding transcriptional activator of the 96.93
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.85
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.84
PF1337173 TPR_9: Tetratricopeptide repeat 96.82
KOG2003 840 consensus TPR repeat-containing protein [General f 96.82
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.79
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.78
PF1337173 TPR_9: Tetratricopeptide repeat 96.76
KOG2076 895 consensus RNA polymerase III transcription factor 96.72
COG3629280 DnrI DNA-binding transcriptional activator of the 96.7
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.69
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.66
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 96.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.58
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.51
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.49
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.45
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.39
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.37
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.22
KOG1125579 consensus TPR repeat-containing protein [General f 96.13
PF13512142 TPR_18: Tetratricopeptide repeat 96.13
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.12
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.07
KOG2003 840 consensus TPR repeat-containing protein [General f 96.03
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.03
PRK15331165 chaperone protein SicA; Provisional 96.02
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.01
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.99
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.92
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.83
PF13762145 MNE1: Mitochondrial splicing apparatus component 95.82
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.79
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.74
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.74
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.71
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.7
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 95.69
PF12688120 TPR_5: Tetratrico peptide repeat 95.59
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.51
PF12688120 TPR_5: Tetratrico peptide repeat 95.51
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.45
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.29
PF13929292 mRNA_stabil: mRNA stabilisation 95.07
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.06
KOG0547606 consensus Translocase of outer mitochondrial membr 94.9
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 94.84
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.82
PRK10803263 tol-pal system protein YbgF; Provisional 94.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.73
PLN02789 320 farnesyltranstransferase 94.7
smart00299140 CLH Clathrin heavy chain repeat homology. 94.67
KOG3941 406 consensus Intermediate in Toll signal transduction 94.66
KOG2796 366 consensus Uncharacterized conserved protein [Funct 94.63
KOG1128 777 consensus Uncharacterized conserved protein, conta 94.4
KOG1129478 consensus TPR repeat-containing protein [General f 94.36
KOG1125579 consensus TPR repeat-containing protein [General f 94.28
KOG4570 418 consensus Uncharacterized conserved protein [Funct 94.21
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 94.13
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.07
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.05
PLN02789 320 farnesyltranstransferase 94.04
KOG2376 652 consensus Signal recognition particle, subunit Srp 93.99
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.98
PF1342844 TPR_14: Tetratricopeptide repeat 93.95
KOG3616 1636 consensus Selective LIM binding factor [Transcript 93.91
KOG3060289 consensus Uncharacterized conserved protein [Funct 93.9
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 93.7
PF1342844 TPR_14: Tetratricopeptide repeat 93.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.66
KOG0547 606 consensus Translocase of outer mitochondrial membr 93.66
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.63
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 93.63
KOG1128 777 consensus Uncharacterized conserved protein, conta 93.54
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.47
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 93.35
PF13512142 TPR_18: Tetratricopeptide repeat 93.23
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.13
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 93.13
PRK14720 906 transcript cleavage factor/unknown domain fusion p 93.13
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 92.97
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 92.97
PRK04841 903 transcriptional regulator MalT; Provisional 92.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.9
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.73
PF13929292 mRNA_stabil: mRNA stabilisation 92.71
KOG3060 289 consensus Uncharacterized conserved protein [Funct 92.68
KOG2076 895 consensus RNA polymerase III transcription factor 92.6
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.26
KOG3785557 consensus Uncharacterized conserved protein [Funct 92.04
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 92.03
PRK10564303 maltose regulon periplasmic protein; Provisional 92.0
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.99
KOG2376 652 consensus Signal recognition particle, subunit Srp 91.99
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 91.58
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.38
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 91.37
KOG4555175 consensus TPR repeat-containing protein [Function 91.32
COG4455 273 ImpE Protein of avirulence locus involved in tempe 91.25
PF14669233 Asp_Glu_race_2: Putative aspartate racemase 91.23
KOG0495 913 consensus HAT repeat protein [RNA processing and m 91.15
KOG4162799 consensus Predicted calmodulin-binding protein [Si 91.11
smart00299140 CLH Clathrin heavy chain repeat homology. 91.1
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 90.82
PF13762145 MNE1: Mitochondrial splicing apparatus component 90.76
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 90.68
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 90.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.29
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.21
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.06
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.91
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 89.87
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.78
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.74
COG2178204 Predicted RNA-binding protein of the translin fami 89.7
COG4700251 Uncharacterized protein conserved in bacteria cont 89.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.56
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.43
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.38
PRK11639169 zinc uptake transcriptional repressor; Provisional 89.16
COG4105 254 ComL DNA uptake lipoprotein [General function pred 89.16
KOG0495 913 consensus HAT repeat protein [RNA processing and m 89.12
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 88.99
PF02847113 MA3: MA3 domain; InterPro: IPR003891 This entry re 88.97
PRK04841 903 transcriptional regulator MalT; Provisional 88.87
COG3947361 Response regulator containing CheY-like receiver a 88.85
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 88.83
PRK10564303 maltose regulon periplasmic protein; Provisional 88.41
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.34
KOG4570 418 consensus Uncharacterized conserved protein [Funct 88.33
COG4235287 Cytochrome c biogenesis factor [Posttranslational 88.32
PF13170 297 DUF4003: Protein of unknown function (DUF4003) 88.04
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 87.91
PF02847113 MA3: MA3 domain; InterPro: IPR003891 This entry re 87.83
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 87.77
KOG2796366 consensus Uncharacterized conserved protein [Funct 87.74
COG4455 273 ImpE Protein of avirulence locus involved in tempe 87.69
KOG1915 677 consensus Cell cycle control protein (crooked neck 87.56
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.51
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.43
COG4105254 ComL DNA uptake lipoprotein [General function pred 86.81
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 86.5
PF0945465 Vps23_core: Vps23 core domain; InterPro: IPR017916 86.29
smart00544113 MA3 Domain in DAP-5, eIF4G, MA-3 and other protein 86.03
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 85.84
PF1343134 TPR_17: Tetratricopeptide repeat 85.77
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 85.65
COG1729262 Uncharacterized protein conserved in bacteria [Fun 85.63
PF0945465 Vps23_core: Vps23 core domain; InterPro: IPR017916 85.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.55
KOG0553304 consensus TPR repeat-containing protein [General f 85.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 85.35
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 85.14
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.09
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.82
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 84.57
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 84.53
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.52
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 84.49
KOG2047 835 consensus mRNA splicing factor [RNA processing and 84.38
PRK11639169 zinc uptake transcriptional repressor; Provisional 84.26
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 84.11
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.74
KOG4162799 consensus Predicted calmodulin-binding protein [Si 83.52
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 83.32
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 82.7
COG3947361 Response regulator containing CheY-like receiver a 82.57
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 81.82
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 81.76
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 81.65
KOG2047 835 consensus mRNA splicing factor [RNA processing and 81.58
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 81.53
PRK09462148 fur ferric uptake regulator; Provisional 81.48
PF0260779 B12-binding_2: B12 binding domain; InterPro: IPR00 81.44
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 80.91
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 80.87
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 80.08
KOG4567370 consensus GTPase-activating protein [General funct 80.02
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=99.96  E-value=2.2e-29  Score=182.82  Aligned_cols=118  Identities=37%  Similarity=0.664  Sum_probs=114.3

Q ss_pred             CchHHHHHHHhcCCHHHHHHHhhhCCCCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCccHHHHHHHHHHHhcCCC
Q 046694            1 MIEPRLDFYTRTGRIDLANKIFDRLPVKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGL   80 (118)
Q Consensus         1 t~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~   80 (118)
                      +||+||.+|+++|++++|.++|++|..||+.+||+||.+|++.|+.++|+++|++|.+.|+.||..||+++|.+|++.|.
T Consensus       362 ~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~  441 (697)
T PLN03081        362 ANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGL  441 (697)
T ss_pred             ehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCc
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHh-hcCCCccHHHHHHHHHHHHHcccccC
Q 046694           81 VEKGKKFFDEMQ-ARNVKPTETHYACMVYLLIKYNQKAR  118 (118)
Q Consensus        81 ~~~a~~~~~~m~-~~g~~~~~~t~~~li~~~~~~g~~~~  118 (118)
                      +++|.++|+.|. +.|+.|+..+|++|+++|++.|++++
T Consensus       442 ~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~e  480 (697)
T PLN03081        442 SEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDE  480 (697)
T ss_pred             HHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHH
Confidence            999999999996 47999999999999999999998864



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF14669 Asp_Glu_race_2: Putative aspartate racemase Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2178 Predicted RNA-binding protein of the translin family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>PF09454 Vps23_core: Vps23 core domain; InterPro: IPR017916 The Endosomal Sorting Complex Required for Transport (ESCRT) complexes form the machinery driving protein sorting from endosomes to lysosomes Back     alignment and domain information
>smart00544 MA3 Domain in DAP-5, eIF4G, MA-3 and other proteins Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09454 Vps23_core: Vps23 core domain; InterPro: IPR017916 The Endosomal Sorting Complex Required for Transport (ESCRT) complexes form the machinery driving protein sorting from endosomes to lysosomes Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>PF02607 B12-binding_2: B12 binding domain; InterPro: IPR003759 Cobalamin-dependent methionine synthase (2 Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>KOG4567 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 46.7 bits (109), Expect = 3e-07
 Identities = 10/93 (10%), Positives = 27/93 (29%), Gaps = 3/93 (3%)

Query: 29  DSASWITLILGYGMLGELDVAINLFEAMRE---DGVEYYPVSHIGVLTACSLGGLVEKGK 85
                +       +  +L +A +L                  +  V+   +  G  ++  
Sbjct: 126 QQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELV 185

Query: 86  KFFDEMQARNVKPTETHYACMVYLLIKYNQKAR 118
                ++   + P    YA  +  + + +Q A 
Sbjct: 186 YVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAG 218


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.88
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.56
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.03
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.02
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.01
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.0
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.0
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.0
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.99
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.98
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.96
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.94
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 98.93
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.93
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.92
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.9
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.85
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.85
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.83
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.82
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.78
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.76
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.76
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.73
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.73
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.72
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.68
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.68
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.68
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.67
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.66
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.65
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.63
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.62
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.61
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.6
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.6
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.58
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.57
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.57
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.55
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.54
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.54
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.51
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.5
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.5
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.49
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.49
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.49
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.49
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.43
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.41
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.39
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.39
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.36
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.28
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.27
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.25
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.24
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.19
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.18
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.16
3k9i_A117 BH0479 protein; putative protein binding protein, 98.16
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.16
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.15
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.15
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.14
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 98.13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.13
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.12
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.12
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.1
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.1
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.07
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 98.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.07
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.03
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.03
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.02
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.01
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.99
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.99
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.99
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.97
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.93
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.91
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.91
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.91
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.9
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.88
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.85
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.85
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.84
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.84
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.84
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.8
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.8
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.8
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.79
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.78
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.78
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.76
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.73
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.7
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.69
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.67
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.66
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.65
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.64
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.64
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.61
3k9i_A117 BH0479 protein; putative protein binding protein, 97.5
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.49
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.48
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.37
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.37
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.32
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.26
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.26
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.26
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.13
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.12
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.11
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.1
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.0
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.9
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 96.88
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.75
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.75
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.7
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.66
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.56
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 96.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.36
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.33
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.26
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.25
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.25
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.24
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 95.95
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.94
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.67
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.57
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.54
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 95.47
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.19
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.11
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 95.03
1ug3_A 339 EIF4GI, eukaryotic protein synthesis initiation fa 94.7
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.51
2uwj_G115 Type III export protein PSCG; virulence, chaperone 94.42
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.41
2p58_C116 Putative type III secretion protein YSCG; type III 94.24
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 94.22
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 93.87
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.86
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.74
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.69
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.51
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 93.35
2zu6_B307 Programmed cell death protein 4; protein-protein c 93.08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.07
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 92.76
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 92.21
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 92.11
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.09
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.87
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.79
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.25
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 91.07
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 90.67
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.51
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 89.49
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 89.34
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.92
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 88.48
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.4
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 87.83
3eiq_C358 Programmed cell death protein 4; PDCD4, anti-oncog 86.35
3l6a_A 364 Eukaryotic translation initiation factor 4 gamma; 85.93
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 85.71
2fe3_A145 Peroxide operon regulator; oxidative stress regula 85.46
2rg8_A165 Programmed cell death protein 4; MA3 domain, heat 85.29
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 85.08
2zu6_B307 Programmed cell death protein 4; protein-protein c 84.9
3ygs_P97 Procaspase 9; apoptosis, caspase activation, caspa 84.66
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.35
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.07
2w57_A150 Ferric uptake regulation protein; gene regulation, 84.07
4ets_A162 Ferric uptake regulation protein; metal binding pr 83.87
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.84
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 83.32
3l6a_A 364 Eukaryotic translation initiation factor 4 gamma; 83.06
2yru_A118 Steroid receptor RNA activator 1; SRAP, structural 82.49
2fe3_A145 Peroxide operon regulator; oxidative stress regula 82.4
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.02
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 82.02
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 81.17
1pc2_A152 Mitochondria fission protein; unknown function; NM 80.76
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 80.65
1ug3_A 339 EIF4GI, eukaryotic protein synthesis initiation fa 80.61
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 80.44
4ets_A162 Ferric uptake regulation protein; metal binding pr 80.4
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.97  E-value=1.2e-30  Score=182.67  Aligned_cols=117  Identities=15%  Similarity=0.110  Sum_probs=99.1

Q ss_pred             CchHHHHHHHhcCC---------HHHHHHHhhhCC----CCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCccHHH
Q 046694            1 MIEPRLDFYTRTGR---------IDLANKIFDRLP----VKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVS   67 (118)
Q Consensus         1 t~~~ll~~~~~~~~---------~~~a~~~~~~m~----~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~   67 (118)
                      |||+||.+|++.+.         +++|.++|++|.    .||..|||++|.+|++.|++++|.++|++|++.|+.||..|
T Consensus        63 tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~t  142 (501)
T 4g26_A           63 HYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRS  142 (501)
T ss_dssp             HHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHH
T ss_pred             HHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccce
Confidence            58888888887654         678888888885    57888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHhcCCChhhHHHHHHHHhhcCCCccHHHHHHHHHHHHHccccc
Q 046694           68 HIGVLTACSLGGLVEKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQKA  117 (118)
Q Consensus        68 ~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~t~~~li~~~~~~g~~~  117 (118)
                      |+++|.+|++.|++++|.++|++|.+.|+.||..||++||++|++.|+++
T Consensus       143 yn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d  192 (501)
T 4g26_A          143 YGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNAD  192 (501)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHH
T ss_pred             ehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHH
Confidence            88888888888888888888888888888888888888888888888765



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3eiq_C Programmed cell death protein 4; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Mus musculus} Back     alignment and structure
>3l6a_A Eukaryotic translation initiation factor 4 gamma; C-terminal region, MA2 domain, W2 domain, EIF4G2, EIF family translation; HET: MES PG4; 2.00A {Homo sapiens} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>2rg8_A Programmed cell death protein 4; MA3 domain, heat repeats, anti-oncogene, apoptosis, cell cycle, cytoplasm, nucleus, phosphorylation, polymorphism; 1.80A {Homo sapiens} PDB: 2kzt_A Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2zu6_B Programmed cell death protein 4; protein-protein complex, ATP-binding, helicase, hydrolase, initiation factor, nucleotide-binding; 2.80A {Homo sapiens} PDB: 3eij_A Back     alignment and structure
>3ygs_P Procaspase 9; apoptosis, caspase activation, caspase recruitment, recognition complex; 2.50A {Homo sapiens} SCOP: a.77.1.3 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3l6a_A Eukaryotic translation initiation factor 4 gamma; C-terminal region, MA2 domain, W2 domain, EIF4G2, EIF family translation; HET: MES PG4; 2.00A {Homo sapiens} Back     alignment and structure
>2yru_A Steroid receptor RNA activator 1; SRAP, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1ug3_A EIF4GI, eukaryotic protein synthesis initiation factor 4G; heat repeat, translation; 2.24A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.72
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.67
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.67
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.63
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.52
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.43
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.43
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.3
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.27
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.16
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.14
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 98.13
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.1
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.01
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.01
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.99
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.93
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.91
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.8
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.72
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.56
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.21
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.12
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.06
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.06
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.06
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.98
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.9
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.73
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 96.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.42
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.26
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.17
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.97
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.88
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.61
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 95.42
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.13
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.15
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 94.02
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.38
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.72
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 92.38
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 92.35
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 89.81
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.14
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.71
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 88.5
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 88.1
d1u9pa136 Arc repressor {Salmonella bacteriophage P22 [TaxId 83.05
d2fnaa173 Hypothetical protein SSO1545, C-terminal domain {S 80.46
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.72  E-value=2.2e-07  Score=59.57  Aligned_cols=110  Identities=13%  Similarity=0.061  Sum_probs=51.7

Q ss_pred             HHHHHHhcCCHHHHHHHhhhCC---CCCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCccHHHHHHHHHHHhcCCCh
Q 046694            5 RLDFYTRTGRIDLANKIFDRLP---VKDSASWITLILGYGMLGELDVAINLFEAMREDGVEYYPVSHIGVLTACSLGGLV   81 (118)
Q Consensus         5 ll~~~~~~~~~~~a~~~~~~m~---~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~   81 (118)
                      +...+.+.|++++|+..|++..   ..+..+|..+...+...|++++|.+.++..... .+.+...+..+...+.+.|++
T Consensus       243 l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~  321 (388)
T d1w3ba_         243 LACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNI  321 (388)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCH
Confidence            3444555555555555555432   224444555555555555555555555544332 122344444444555555555


Q ss_pred             hhHHHHHHHHhhcCCCccHHHHHHHHHHHHHcccc
Q 046694           82 EKGKKFFDEMQARNVKPTETHYACMVYLLIKYNQK  116 (118)
Q Consensus        82 ~~a~~~~~~m~~~g~~~~~~t~~~li~~~~~~g~~  116 (118)
                      ++|.+.|++..+.. +-+..++..+-.+|.+.|++
T Consensus       322 ~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~  355 (388)
T d1w3ba_         322 EEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKL  355 (388)
T ss_dssp             HHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCH
Confidence            55555555543321 11234444444555444443



>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1u9pa1 a.43.1.1 (A:72-107) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure