Citrus Sinensis ID: 046743

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MGEKPPHTYGNSSIYNIAGTNASANDIEAAAREAVLREQEIETQKIIQGQREEGVVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVPGGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGILKDTSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVASEQSDSNASRNTTNGIWDNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTSLNKQQQTSNSANAKEDSGKNGPKQSWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGPLFQQRPYPSPGAVLRKNAEIASQSKKSSPHFTAISKRGDGSDGLGEAD
cccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEcccccEEcccccccccccccccccccccccEEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccc
ccccccccccccccEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccHHHHccccccHHHHHHHHHHHHcHHHHHHHcccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEccccccEcccccccccccccccccccccccEEEEccccccEEEEEccccEEEEccccccccccccccccccHHccccccccccHHHHHcccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccHHHHHHHHHHHcccccccccccEEEEcccccccccccc
mgekpphtygnssiyniagtnasanDIEAAAREAVLREQEIETQKIIqgqreegvvgashhdgadifakrsdpnaLKEHLLKMTSEHRAEMALkrgkptgpnqgnteigngygvpggVAYYNVQSTAitrtqgagndgmgqrnlkldseseqkpvtkELPEYLKQRLRARGilkdtsengdpprinnklestsaqlddrekllpgwveakdpasgasyyynestgksqwerpvetssraqtpshLSLMEDWIEAVDEtsghkyyynkrthvsqwvhpgsskpvaseqsdsnasrnttngiwdnpssglerclhcggwgvglvqtwgycnhctrvlnlpqCQYLLTSLnkqqqtsnsanakedsgkngpkqswkppmgrgnrkdsrkrafseddeldpmdpssysdaprggwvvglkgvqpraadttatgplfqqrpypspgavlrknaeiasqskkssphftaiskrgdgsdglgead
mgekpphtygnSSIYNIAGTNASANDIEAAAREAVLREQEIETQkiiqgqreegVVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKrgkptgpnqgntEIGNGYGVPGGVAYYNVQSTAITrtqgagndgmGQRNLkldseseqkpvtkelPEYLKQRLRARgilkdtsengdpprinnklestsaqldDREKLLPgwveakdpasgasyyynestgksqwerpvETSSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVAseqsdsnasrnttngiwdNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTSLNKQQQTsnsanakedsgkngpkqswkppmgrgnrkdsrkrafseddeldpmdpssysdaprGGWVVGLKGVQPRAAdttatgplfqqrpyPSPGAVLRKNAEIAsqskkssphftaiskrgdgsdglgead
MGEKPPHTYGNSSIYNIAGTNASANDIEAAAREAVLREQEIETQKIIQGQREEGVVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVPGGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGILKDTSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVASEQSDSNASRNTTNGIWDNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTSLNKQQQTSNSANAKEDSGKNGPKQSWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGPLFQQRPYPSPGAVLRKNAEIASQSKKSSPHFTAISKRGDGSDGLGEAD
**************YNI******************************************************************************************IGNGYGVPGGVAYYNVQSTAI**********************************************************************************************************************LMEDWIEAVDETSGHKYYYNKRTHVSQWV************************IWD**SSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTS***************************************************************GWVVGLKG*************************************************************
**********************************************************************************************************************AYYN***********************************************************************************WVEAKDPASGASYYYNESTGKSQWERPVE***************DWIEAVDETSGHKYYYNKRTHVSQWVHP*********************************************************************************************************************************************************************************************************
********YGNSSIYNIAGTNASANDIEAAAREAVLREQEIETQKIIQGQREEGVVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVPGGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGILKDTSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYY***********************SHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVH******************NTTNGIWDNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTSLN*******************************************************SDAPRGGWVVGLKGVQPRAADTTATGPLFQQRPYPSPGAVLRKNA************FTAISKR***********
************SIY****TNASANDIEAAAREAVLREQEIETQKIIQGQREEG********GADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVPGGVAYYNVQSTAITR***************************ELPEYLKQRLRARGILK**************************KLLPGWVEAKDPASGASYYYNESTGKSQWERPVET********HLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSK************************************************HCT*********************************************************************S*****R*GWVV*L*****RAA**T*TGPLFQQRPYPSPGAVLRKNAEIAS**************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEKPPHTYGNSSIYNIAGTNASANDIEAAAREAVLREQEIETQKIIQGQREEGVVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVPGGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGILKDTSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVASEQSDSNASRNTTNGIWDNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTSLNKQQQTSNSANAKEDSGKNGPKQSWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGPLFQQRPYPSPGAVLRKNAEIASQSKKSSPHFTAISKRGDGSDGLGEAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q2HJC9263 Polyglutamine-binding pro yes no 0.150 0.273 0.68 7e-19
Q91VJ5263 Polyglutamine-binding pro yes no 0.418 0.760 0.333 9e-19
Q6PCT5263 Polyglutamine-binding pro yes no 0.414 0.752 0.339 2e-18
O60828265 Polyglutamine-binding pro yes no 0.150 0.271 0.666 3e-18
A1YFA7265 Polyglutamine-binding pro N/A no 0.150 0.271 0.666 3e-18
A2T806265 Polyglutamine-binding pro N/A no 0.150 0.271 0.666 3e-18
Q5F457398 WW domain-binding protein yes no 0.173 0.208 0.412 7e-08
P33203 583 Pre-mRNA-processing prote yes no 0.192 0.157 0.393 5e-07
F4JCC1 992 Pre-mRNA-processing prote no no 0.192 0.092 0.348 3e-06
Q6TLK4 869 Rho GTPase-activating pro no no 0.154 0.085 0.378 5e-06
>sp|Q2HJC9|PQBP1_BOVIN Polyglutamine-binding protein 1 OS=Bos taurus GN=PQBP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 3/75 (4%)

Query: 384 SRKRAFSEDDELDPMDPSSYSDAPRGGWVVGL--KGVQPRAADTTATGPLFQQRPYPSPG 441
           S+K A  +D+ELDPMDPSSYSDAPRG W  GL  +      ADTTA GPLFQQRPYPSPG
Sbjct: 188 SKKAASRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPG 247

Query: 442 AVLRKNAEIASQSKK 456
           AVLR NAE AS++K+
Sbjct: 248 AVLRANAE-ASRTKQ 261
May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery. May be involved in ATXN1 mutant-induced cell death. The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit.
Bos taurus (taxid: 9913)
>sp|Q91VJ5|PQBP1_MOUSE Polyglutamine-binding protein 1 OS=Mus musculus GN=Pqbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PCT5|PQBP1_RAT Polyglutamine-binding protein 1 OS=Rattus norvegicus GN=Pqbp1 PE=2 SV=1 Back     alignment and function description
>sp|O60828|PQBP1_HUMAN Polyglutamine-binding protein 1 OS=Homo sapiens GN=PQBP1 PE=1 SV=1 Back     alignment and function description
>sp|A1YFA7|PQBP1_GORGO Polyglutamine-binding protein 1 OS=Gorilla gorilla gorilla GN=PQBP1 PE=3 SV=1 Back     alignment and function description
>sp|A2T806|PQBP1_PONPY Polyglutamine-binding protein 1 OS=Pongo pygmaeus GN=PQBP1 PE=3 SV=1 Back     alignment and function description
>sp|Q5F457|WBP4_CHICK WW domain-binding protein 4 OS=Gallus gallus GN=WBP4 PE=2 SV=1 Back     alignment and function description
>sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 Back     alignment and function description
>sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 Back     alignment and function description
>sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
449437753 600 PREDICTED: uncharacterized protein LOC10 0.962 0.766 0.549 1e-149
297741712532 unnamed protein product [Vitis vinifera] 0.960 0.862 0.630 1e-148
359481578514 PREDICTED: uncharacterized protein LOC10 0.922 0.857 0.628 1e-146
356502968540 PREDICTED: uncharacterized protein LOC10 0.956 0.846 0.6 1e-139
297824041461 WW domain-containing protein [Arabidopsi 0.905 0.939 0.555 1e-132
21593049463 unknown [Arabidopsis thaliana] 0.924 0.954 0.541 1e-131
30688500463 polyglutamine-binding protein 1 [Arabido 0.924 0.954 0.541 1e-131
56784944524 putative poly-glutamine tract-binding pr 0.928 0.847 0.555 1e-127
115441827498 Os01g0916300 [Oryza sativa Japonica Grou 0.928 0.891 0.555 1e-127
56784945464 putative poly-glutamine tract-binding pr 0.928 0.956 0.555 1e-127
>gi|449437753|ref|XP_004136655.1| PREDICTED: uncharacterized protein LOC101203374 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  535 bits (1379), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 290/528 (54%), Positives = 351/528 (66%), Gaps = 68/528 (12%)

Query: 6   PH--TYGN---SSIYNIAGTNASANDIEAAAREAVLREQEIETQKIIQGQREEGVVGASH 60
           PH  T+ N   SS  N       A DI+ A ++AVLREQE+ TQ II+ QR+   VGA  
Sbjct: 86  PHHGTFNNIAVSSSSNFRSNVDDARDIDIAVQDAVLREQELATQNIIRSQRDS--VGA-- 141

Query: 61  HDG-----ADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGPNQGNTEIGNGYGVP 115
            DG     +DIF++R DP++LKEHLLK+TSEHRAEMA+KRGK   P +GN EIGNGYGVP
Sbjct: 142 -DGLPVERSDIFSERYDPSSLKEHLLKITSEHRAEMAIKRGKLNLPEEGNLEIGNGYGVP 200

Query: 116 GGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGILKD 175
           GG A+Y      I      GN+  GQ+      E+EQ   +K LPEYLKQ+LRARGILK+
Sbjct: 201 GGCAFYGASKPGIVAN---GNNVTGQKIQGQIKEAEQSSASKALPEYLKQKLRARGILKE 257

Query: 176 TSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYYYNESTGKSQWERPVET 235
            +E+ +  R +   ++ S      EKL  GWVEAKDP SG SYYYNES+GKSQWERP E 
Sbjct: 258 DAEHSNSVRADTNSDAVSNTKLQGEKLPHGWVEAKDPHSGVSYYYNESSGKSQWERPSEL 317

Query: 236 SSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVASEQSD------ 289
           SS  Q  S +SL EDW+EA+D+TSG KYYYN RTHV+QW      +PVAS Q+       
Sbjct: 318 SSNTQLSSAVSLPEDWMEAIDQTSGVKYYYNMRTHVTQW-----ERPVASHQTTLTHSND 372

Query: 290 ------------------------------------SNASRNTTNGIWDNPSSGLERCLH 313
                                               S  S ++TNGIW +  S   +C+ 
Sbjct: 373 KFPGPWNDQTLEQSKCITCGSGMTLVQGSRYCNSCTSGVSTSSTNGIWQDQPSEQNKCMG 432

Query: 314 CGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTS-LNKQQQTSNSANAKEDSGKNG--PKQ 370
           CGGWG+GLVQ WGYC HCTR+L LPQCQYL T+ ++ QQ+  N  ++ + S K     + 
Sbjct: 433 CGGWGLGLVQAWGYCIHCTRILGLPQCQYLPTNNISNQQKIENVKHSADPSIKKSVTDRS 492

Query: 371 SWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGP 430
            WKPP+G+G +++SRKR++SEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGP
Sbjct: 493 KWKPPIGKGGKRESRKRSYSEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTATGP 552

Query: 431 LFQQRPYPSPGAVLRKNAEIASQSKKSSPHFTAISKRGDGSDGLGEAD 478
           LFQQRPYPSPGAVLRKNAEIASQ+KK S H+  ISKRGDGSDGLG+AD
Sbjct: 553 LFQQRPYPSPGAVLRKNAEIASQTKKGSSHYAPISKRGDGSDGLGDAD 600

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297741712|emb|CBI32844.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481578|ref|XP_002278437.2| PREDICTED: uncharacterized protein LOC100263596 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502968|ref|XP_003520286.1| PREDICTED: uncharacterized protein LOC100779869 [Glycine max] Back     alignment and taxonomy information
>gi|297824041|ref|XP_002879903.1| WW domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325742|gb|EFH56162.1| WW domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21593049|gb|AAM64998.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30688500|ref|NP_181635.2| polyglutamine-binding protein 1 [Arabidopsis thaliana] gi|51970094|dbj|BAD43739.1| unknown protein [Arabidopsis thaliana] gi|330254823|gb|AEC09917.1| polyglutamine-binding protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|56784944|dbj|BAD82402.1| putative poly-glutamine tract-binding protein [Oryza sativa Japonica Group] gi|57900433|dbj|BAD87726.1| putative poly-glutamine tract-binding protein [Oryza sativa Japonica Group] gi|215736964|dbj|BAG95893.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115441827|ref|NP_001045193.1| Os01g0916300 [Oryza sativa Japonica Group] gi|113534724|dbj|BAF07107.1| Os01g0916300 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|56784945|dbj|BAD82403.1| putative poly-glutamine tract-binding protein [Oryza sativa Japonica Group] gi|57900434|dbj|BAD87727.1| putative poly-glutamine tract-binding protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2063250463 AT2G41020 [Arabidopsis thalian 0.933 0.963 0.549 4.8e-126
UNIPROTKB|E2RHX2265 PQBP1 "Uncharacterized protein 0.150 0.271 0.68 8.3e-30
UNIPROTKB|G3FP13265 PQBP1 "Polyglutamine binding p 0.150 0.271 0.68 8.3e-30
UNIPROTKB|Q2HJC9263 PQBP1 "Polyglutamine-binding p 0.150 0.273 0.68 4.5e-29
MGI|MGI:1859638263 Pqbp1 "polyglutamine binding p 0.213 0.387 0.490 9.6e-29
RGD|1549750263 Pqbp1 "polyglutamine binding p 0.213 0.387 0.490 4.1e-28
UNIPROTKB|O60828265 PQBP1 "Polyglutamine-binding p 0.150 0.271 0.666 4.3e-28
WB|WBGene00020647280 pqbp-1.1 [Caenorhabditis elega 0.196 0.335 0.449 8.4e-21
UNIPROTKB|Q5F457398 WBP4 "WW domain-binding protei 0.282 0.339 0.339 2.4e-11
UNIPROTKB|F1NXG2398 WBP4 "WW domain-binding protei 0.267 0.321 0.340 5.2e-11
TAIR|locus:2063250 AT2G41020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1238 (440.9 bits), Expect = 4.8e-126, P = 4.8e-126
 Identities = 272/495 (54%), Positives = 328/495 (66%)

Query:     1 MGEKPPHTYGNSSIYNIAGTNAS-----ANDIEAAAREAVLREQEIETQKIIQGQREEG- 54
             MGE+  +    SS+ +  G  +S     + DIE+AA  A+LREQEIETQKIIQGQRE G 
Sbjct:     1 MGEELQYQQNGSSVTSNYGYGSSLAYDQSQDIESAANTALLREQEIETQKIIQGQREAGT 60

Query:    55 -VVGASHHDGADIFAKRSDPNALKEHLLKMTSEHRAEMALKRGKPTGP-NQGNTEIGNGY 112
              V G S H+  DI   R+DPNALKEHLLK T+ HRAE A KRG       +GN ++GNGY
Sbjct:    61 SVAGDSKHN-TDILRDRADPNALKEHLLKFTANHRAEAAAKRGGSVSTCGEGNVDVGNGY 119

Query:   113 GVPGGVAYYNVQSTAITRTQGAGNDGMGQRNLKLDSESEQKPVTKELPEYLKQRLRARGI 172
             G+PGGVAY             AG+        +L  + E    +  LPEYLKQ+L+ARGI
Sbjct:   120 GIPGGVAY-------------AGHS-------ELSGKPEPTNASNNLPEYLKQKLKARGI 159

Query:   173 LKD-----TSENGDPPRINNKLESTSAQLDDREKLLPGWVEAKDPASGASYYYNESTGKS 227
             L+D     TS   D   ++   ++T     +   L  GWV+AKDPASGA+YYYN+ TG  
Sbjct:   160 LRDGAGAVTSNPEDTSAVSWNRQATLPFQANASTLPLGWVDAKDPASGATYYYNQHTGTC 219

Query:   228 QWERPVETS-SRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHPGSSKPVASE 286
             QWERPVE S + +  P  LS  E+WIE  DE SGHKY+YN RTHVSQW  P S +  A+ 
Sbjct:   220 QWERPVELSYATSSAPPVLS-KEEWIETFDEASGHKYFYNTRTHVSQWEPPASLQKPAAT 278

Query:   287 QSDSNASRNTTNGIWDNPSSGLERCLHCGGWGVGLVQTWGYCNHCTRVLNLPQCQYLLTS 346
              S++  +++T NG  ++P S L RC  CGGWGVGLVQ WGYC HCTRV NLP+ Q+L   
Sbjct:   279 NSNNAVTQSTANGKGEHPPSQLPRCSGCGGWGVGLVQRWGYCVHCTRVFNLPEKQFLPAH 338

Query:   347 LNKQQQTSNSANAKEDSGKNGPKQ--SWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYS 404
             LN      +  NA  DSG+  P Q  S KPPM    +   +KRA +EDDELDPMDPSSYS
Sbjct:   339 LN------HFTNAG-DSGQKDPNQRSSSKPPM---KKVIGKKRAHAEDDELDPMDPSSYS 388

Query:   405 DAPRGGWVVGLKGVQPRAADTTATGPLFQQRPYPSPGAVLRKNAEIAS-QSKKSSPHFTA 463
             DAPRGGWVVGLKGVQPRAADTTA+GPLFQQRPYPSPGAVLR+NAE+AS Q KK +  FT 
Sbjct:   389 DAPRGGWVVGLKGVQPRAADTTASGPLFQQRPYPSPGAVLRRNAEVASSQKKKPNSQFTE 448

Query:   464 ISKRGDGSDGLGEAD 478
             I+KRGDGSDGLG+AD
Sbjct:   449 ITKRGDGSDGLGDAD 463
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0019722 "calcium-mediated signaling" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
UNIPROTKB|E2RHX2 PQBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3FP13 PQBP1 "Polyglutamine binding protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJC9 PQBP1 "Polyglutamine-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1859638 Pqbp1 "polyglutamine binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1549750 Pqbp1 "polyglutamine binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60828 PQBP1 "Polyglutamine-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00020647 pqbp-1.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F457 WBP4 "WW domain-binding protein 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXG2 WBP4 "WW domain-binding protein 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
pfam0039730 pfam00397, WW, WW domain 2e-08
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 6e-08
COG5104 590 COG5104, PRP40, Splicing factor [RNA processing an 7e-08
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 1e-07
pfam0039730 pfam00397, WW, WW domain 2e-06
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 2e-05
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 3e-05
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information 
 Score = 49.9 bits (120), Expect = 2e-08
 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 202 LLPGWVEAKDPASGASYYYNESTGKSQWERP 232
           L PGW E  D   G  YYYN +TG++QWERP
Sbjct: 1   LPPGWEERTDT-DGRPYYYNHNTGETQWERP 30

The WW domain is a protein module with two highly conserved tryptophans that binds proline-rich peptide motifs in vitro. Length = 30
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG3427222 consensus Polyglutamine tract-binding protein PQBP 99.92
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.96
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.88
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 98.85
KOG1891271 consensus Proline binding protein WW45 [General fu 98.76
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.69
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.64
cd0020131 WW Two conserved tryptophans domain; also known as 98.51
cd0020131 WW Two conserved tryptophans domain; also known as 98.49
KOG3259163 consensus Peptidyl-prolyl cis-trans isomerase [Pos 98.3
KOG3209 984 consensus WW domain-containing protein [General fu 98.24
KOG0155 617 consensus Transcription factor CA150 [Transcriptio 98.23
KOG3427222 consensus Polyglutamine tract-binding protein PQBP 98.12
KOG3259163 consensus Peptidyl-prolyl cis-trans isomerase [Pos 98.06
KOG1891271 consensus Proline binding protein WW45 [General fu 97.95
KOG3209 984 consensus WW domain-containing protein [General fu 97.5
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 97.1
KOG0940358 consensus Ubiquitin protein ligase RSP5/NEDD4 [Pos 96.87
KOG0155 617 consensus Transcription factor CA150 [Transcriptio 94.29
KOG0152463 consensus Spliceosomal protein FBP11/Splicing fact 91.1
KOG4334 650 consensus Uncharacterized conserved protein, conta 83.19
KOG1450650 consensus Predicted Rho GTPase-activating protein 82.82
>KOG3427 consensus Polyglutamine tract-binding protein PQBP-1 [Transcription] Back     alignment and domain information 
Probab=99.92  E-value=1.1e-25  Score=213.48  Aligned_cols=80  Identities=44%  Similarity=0.644  Sum_probs=66.4

Q ss_pred             CCCCCCCCCCCccccccccCCCCCCCCCCCCCCCCCCCCCcccCcc-----cCCCCccccCCCCCCccCCCCCCChHHHh
Q 046743          371 SWKPPMGRGNRKDSRKRAFSEDDELDPMDPSSYSDAPRGGWVVGLK-----GVQPRAADTTATGPLFQQRPYPSPGAVLR  445 (478)
Q Consensus       371 ~~~~p~~k~~~~~~~~r~~~~~~~~dpmdp~~y~d~p~g~w~~gl~-----~~~~~~~d~ta~g~l~q~rpyp~pg~~l~  445 (478)
                      .+-.++.+.++-..     .+...+|||||++|++||+|.|++||.     .+..||+|+||+||||||||||+||||||
T Consensus       137 ~e~~~y~r~k~avs-----~kg~~~~~ad~tas~~afr~~~stgl~~~~~r~e~vt~ad~ta~gPlfqqrpyPapgavlR  211 (222)
T KOG3427|consen  137 KEFYFYPRTKQAVS-----RKGPSHDPADPTASAGAFRGQWSTGLDEFNFRTEMVTGADSTANGPLFQQRPYPAPGAVLR  211 (222)
T ss_pred             hhhccCCcccceec-----ccCCCCCCCCccccccchhhhhccCCcccccccccccccccccCCCccccCcCCCchhHHh
Confidence            45555555532222     257889999999999999999999995     36688999999999999999999999999


Q ss_pred             hhHHHHhhcC
Q 046743          446 KNAEIASQSK  455 (478)
Q Consensus       446 ~~~~~~~~~~  455 (478)
                      +|++.++.++
T Consensus       212 ~nae~~~~~~  221 (222)
T KOG3427|consen  212 DNAEKIQRRR  221 (222)
T ss_pred             hhhHhhhhhc
Confidence            9999986654

>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1891 consensus Proline binding protein WW45 [General function prediction only] Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG0155 consensus Transcription factor CA150 [Transcription] Back     alignment and domain information
>KOG3427 consensus Polyglutamine tract-binding protein PQBP-1 [Transcription] Back     alignment and domain information
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1891 consensus Proline binding protein WW45 [General function prediction only] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0940 consensus Ubiquitin protein ligase RSP5/NEDD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0155 consensus Transcription factor CA150 [Transcription] Back     alignment and domain information
>KOG0152 consensus Spliceosomal protein FBP11/Splicing factor PRP40 [RNA processing and modification] Back     alignment and domain information
>KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] Back     alignment and domain information
>KOG1450 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1o6w_A75 Solution Structure Of The Prp40 Ww Domain Pair Of T 3e-06
3tc5_A166 Selective Targeting Of Disease-Relevant Protein Bin 2e-05
2itk_A167 Human Pin1 Bound To D-Peptide Length = 167 3e-05
3kad_A167 Structure-Guided Design Of Alpha-Amino Acid-Derived 3e-05
2zr6_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 3e-05
1f8a_B167 Structural Basis For The Phosphoserine-Proline Reco 1e-04
2zr5_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-04
2zqs_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-04
1pin_A163 Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo 2e-04
2zqt_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-04
2l5f_A92 Solution Structure Of The Tandem Ww Domains From Hy 2e-04
2zr4_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 3e-04
2f21_A162 Human Pin1 Fip Mutant Length = 162 4e-04
3tcz_A158 Human Pin1 Bound To Cis Peptidomimetic Inhibitor Le 7e-04
2zqv_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 8e-04
>pdb|1O6W|A Chain A, Solution Structure Of The Prp40 Ww Domain Pair Of The Yeast Splicing Factor Prp40 Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 39/76 (51%), Gaps = 5/76 (6%)
Query: 206 WVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHKYYY 265
           W EAKD ASG  YYYN  T KS WE+P E  S+ +    L L E+  +A     G  YYY
Sbjct: 4   WKEAKD-ASGRIYYYNTLTKKSTWEKPKELISQEE----LLLRENGWKAAKTADGKVYYY 58
Query: 266 NKRTHVSQWVHPGSSK 281
           N  T  + W  P   K
Sbjct: 59  NPTTRETSWTIPAFEK 74
>pdb|3TC5|A Chain A, Selective Targeting Of Disease-Relevant Protein Binding Domains By O- Phosphorylated Natural Product Derivatives Length = 166 Back     alignment and structure
>pdb|2ITK|A Chain A, Human Pin1 Bound To D-Peptide Length = 167 Back     alignment and structure
>pdb|3KAD|A Chain A, Structure-Guided Design Of Alpha-Amino Acid-Derived Pin1 Inhibitors Length = 167 Back     alignment and structure
>pdb|2ZR6|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|1F8A|B Chain B, Structural Basis For The Phosphoserine-Proline Recognition By Group Iv Ww Domains Length = 167 Back     alignment and structure
>pdb|2ZR5|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2ZQS|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|1PIN|A Chain A, Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo Sapiens Length = 163 Back     alignment and structure
>pdb|2ZQT|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2L5F|A Chain A, Solution Structure Of The Tandem Ww Domains From HypaFBP11 Length = 92 Back     alignment and structure
>pdb|2ZR4|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>pdb|2F21|A Chain A, Human Pin1 Fip Mutant Length = 162 Back     alignment and structure
>pdb|3TCZ|A Chain A, Human Pin1 Bound To Cis Peptidomimetic Inhibitor Length = 158 Back     alignment and structure
>pdb|2ZQV|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 6e-17
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 6e-16
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 3e-15
2jxw_A75 WW domain-binding protein 4; WW domain containing 1e-14
2jxw_A75 WW domain-binding protein 4; WW domain containing 2e-04
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 3e-12
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 4e-04
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 4e-06
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 4e-06
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 5e-06
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 6e-06
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 7e-06
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 8e-06
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 1e-05
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 1e-05
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 1e-05
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 7e-04
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 1e-05
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 2e-05
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 2e-05
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 3e-05
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 3e-05
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 5e-05
1ymz_A43 CC45; artificial protein, computational design, un 7e-05
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 8e-05
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 1e-04
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 1e-04
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 2e-04
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 2e-04
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 4e-04
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 5e-04
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 6e-04
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 8e-04
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 8e-04
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
 Score = 74.5 bits (183), Expect = 6e-17
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 203 LPGWVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHK 262
           +  W EAKD  SG  YYYN  T KS WE+P E      +   L L E+  +A     G  
Sbjct: 1   MSIWKEAKDA-SGRIYYYNTLTKKSTWEKPKE----LISQEELLLRENGWKAAKTADGKV 55

Query: 263 YYYNKRTHVSQWVHPGSSK 281
           YYYN  T  + W  P   K
Sbjct: 56  YYYNPTTRETSWTIPAFEK 74
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Length = 41 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Length = 37 Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 50 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Length = 54 Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 39 Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 55 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.82
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.82
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 99.77
2jxw_A75 WW domain-binding protein 4; WW domain containing 99.73
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.72
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.57
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.53
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 99.23
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.19
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.18
2jxw_A75 WW domain-binding protein 4; WW domain containing 99.16
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.09
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.08
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.05
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.04
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.04
1ymz_A43 CC45; artificial protein, computational design, un 99.04
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.03
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.03
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 99.03
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.03
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.03
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.02
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.02
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.02
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.01
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.01
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.0
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.0
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 98.99
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 98.98
1ymz_A43 CC45; artificial protein, computational design, un 98.98
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 98.98
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.98
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 98.97
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 98.96
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 98.96
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 98.96
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 98.96
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.96
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 98.95
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 98.95
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 98.94
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 98.93
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 98.93
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 98.93
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 98.92
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 98.92
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 98.91
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 98.9
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 98.9
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.89
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 98.89
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.89
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 98.89
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 98.88
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 98.88
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.84
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 98.84
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 98.81
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 98.8
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.79
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 98.79
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.75
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.73
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 98.73
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.73
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.72
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.66
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.65
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.61
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.61
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 98.61
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.58
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.57
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.54
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.49
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.49
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.48
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.3
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 98.07
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 98.06
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.98
2dk7_A73 Transcription elongation regulator 1; structural g 97.93
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.88
2dk7_A73 Transcription elongation regulator 1; structural g 97.82
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 97.78
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 97.73
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 97.43
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 96.84
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 93.28
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 88.18
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
Probab=99.82  E-value=6.4e-21  Score=158.65  Aligned_cols=80  Identities=18%  Similarity=0.397  Sum_probs=67.2

Q ss_pred             CCCCCCCCcEEEEcCCCCceeeeeCCCCCeeccCCCcccccCCCCCCcCCCCCcEEEEecCCCcEEEEeCCCCeeeccCC
Q 046743          198 DREKLLPGWVEAKDPASGASYYYNESTGKSQWERPVETSSRAQTPSHLSLMEDWIEAVDETSGHKYYYNKRTHVSQWVHP  277 (478)
Q Consensus       198 ~~e~LPpGWEe~~Dp~SGR~YYyN~~TgeTTWErP~~~~~~~~~pa~~~LP~GWEE~~DpssGR~YYyN~~TgeTqWEdP  277 (478)
                      ...+||++|++++|+. |++|||||.|++|+|++|..............||.||++++|+ +|++|||||+|++|+|++|
T Consensus         9 ~~~~LP~gWe~~~~~~-Gr~Yy~n~~t~~t~W~~P~~~~~~~~~~~~~~LP~gWe~~~~~-~G~~Yy~nh~t~~ttw~~P   86 (88)
T 1tk7_A            9 ALGPLPDGWEKKIQSD-NRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTA-AGERFFVDHNTRRTTFEDP   86 (88)
T ss_dssp             TTSSSSSSCCEEEETT-TEEEEEETTTTEEEEESCCCTTTCCHHHHSCSSCSSCEEEEET-TTEEEEEETTTTEEESSSS
T ss_pred             ccCCCCCCcEEEECCC-CCEEEEECCCCCeEeecccccccccccccccccCCceEEEECC-CCCEEEEECCCCcEeCCCC
Confidence            4557999999999985 9999999999999999998764221000134789999999996 8999999999999999999


Q ss_pred             CC
Q 046743          278 GS  279 (478)
Q Consensus       278 r~  279 (478)
                      ++
T Consensus        87 rl   88 (88)
T 1tk7_A           87 RP   88 (88)
T ss_dssp             CC
T ss_pred             CC
Confidence            84
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 1e-09
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 4e-06
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 3e-07
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 2e-04
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 8e-07
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 5e-05
d1o6wa129 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's y 1e-06
d1o6wa129 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's y 7e-05
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 2e-06
d1ywia128 b.72.1.1 (A:15-42) Huntingtin-interacting protein 3e-06
d1ywia128 b.72.1.1 (A:15-42) Huntingtin-interacting protein 4e-04
d2dk1a138 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP 3e-06
d2dk1a138 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP 1e-04
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 4e-06
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 4e-04
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 6e-06
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 7e-05
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure

class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Mitotic rotamase PIN1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.2 bits (123), Expect = 1e-09
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 201 KLLPGWVEAKDPASGASYYYNESTGKSQWERP 232
           KL PGW +    +SG  YY+N  T  SQWERP
Sbjct: 1   KLPPGWEKRMSRSSGRVYYFNHITNASQWERP 32
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 29 Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 29 Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 99.17
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.15
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.14
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 99.06
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.02
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.01
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.01
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 98.99
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 98.96
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 98.95
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 98.8
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 98.77
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.68
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.66
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.61
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.6
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.49
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.48
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 98.44
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 98.44
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 98.32
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 97.88
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 95.86
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 95.22
d2ysca126 Amyloid beta A4 precursor protein-binding family B 94.41
d2ysca126 Amyloid beta A4 precursor protein-binding family B 89.16
d1e0na_27 Hypothetical protein Yjq8 (Set2p) {Baker's yeast ( 81.67
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Mitotic rotamase PIN1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.17  E-value=9.3e-12  Score=86.05  Aligned_cols=34  Identities=50%  Similarity=0.953  Sum_probs=31.9

Q ss_pred             CCCCCcEEEEcCCCCceeeeeCCCCCeeccCCCc
Q 046743          201 KLLPGWVEAKDPASGASYYYNESTGKSQWERPVE  234 (478)
Q Consensus       201 ~LPpGWEe~~Dp~SGR~YYyN~~TgeTTWErP~~  234 (478)
                      .||+||++++|+.+|+.||||+.|++|+|++|..
T Consensus         1 ~LP~GW~~~~d~~~G~~YY~n~~T~~T~W~~Pt~   34 (34)
T d1pina1           1 KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG   34 (34)
T ss_dssp             CCCTTEEEEECTTSCCEEEEETTTCCEESSCSCC
T ss_pred             CcCCCcEEEECCCCCCEEEEECCCCCEEccCCCC
Confidence            3899999999998999999999999999999963
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0na_ b.72.1.1 (A:) Hypothetical protein Yjq8 (Set2p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure