Citrus Sinensis ID: 046909

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MSYARSHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDELAGNSFGEDIKATKAQM
cccccccccccccccccccccccEEEcccEEEEEEEccccccccEEEEEEcccEEEEEEEEccccccccccccccEEEEEccccEEEEEEEcccccccccEEEEEcccEEEEEcccccccccccccEEEEccccccccccccccHHcccc
ccccccccccccccccccccEEEcccccccEEEEEEccccccccEEEEEEcccEEEEEccccccccccccccccEEEEEEEccccEEEEEEccccccHHHEEEEEcccEEEEEEcccccccccccEEEEEEccccccccccccccccccc
MSYARSHFFDVMFAmtedpfrsrldgapiAHVIALDILGMKKDEVKIEVEENMVLRVsgerksddyykegvegekrhraeSTFGKFWRqfkmpmsadLEHVKVHLENgvlritvpklteekrrqpkvisindelagnsfgedIKATKAQM
msyarshfFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEveenmvlrvsgerksddyykegvegekrhraestfGKFWRQFKMPMSADLEHVKVHLengvlritvpklteekrrqpkvisindelagnsfgedikatkaqm
MSYARSHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDELAGNSFGEDIKATKAQM
******HFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLR*************************TFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKL*********************************
*****SHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLR*******************RHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITV************************************
MSYARSHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDELAGNSFGEDIKATKAQM
*****SHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGER**********EGEKRHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISIND******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYARSHFFDVMFAMTEDPFRSRLDGAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDELAGNSFGEDIKATKAQM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q38806195 22.0 kDa heat shock prote yes no 0.666 0.512 0.576 6e-26
P19244197 22.7 kDa class IV heat sh N/A no 0.686 0.522 0.523 2e-25
P30236192 22.0 kDa class IV heat sh no no 0.773 0.604 0.491 3e-23
Q53M11206 21.9 kDa heat shock prote yes no 0.82 0.597 0.425 2e-20
Q7XUW5215 23.2 kDa heat shock prote no no 0.773 0.539 0.366 4e-20
P13853157 17.6 kDa class I heat sho no no 0.653 0.624 0.447 2e-18
P27879143 18.1 kDa class I heat sho N/A no 0.68 0.713 0.432 4e-17
P27880158 18.2 kDa class I heat sho N/A no 0.653 0.620 0.438 6e-17
Q9LNW0157 17.8 kDa class I heat sho no no 0.653 0.624 0.446 6e-17
P05478161 18.5 kDa class I heat sho no no 0.706 0.658 0.427 9e-17
>sp|Q38806|HSP22_ARATH 22.0 kDa heat shock protein OS=Arabidopsis thaliana GN=HSP22.0 PE=2 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 76/104 (73%), Gaps = 4/104 (3%)

Query: 30  AHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQ 89
            H I LDI G+KKDEVKIEVEEN VLRVSGERK ++  K    G++ HR E ++GKFWRQ
Sbjct: 81  GHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKK----GDQWHRVERSYGKFWRQ 136

Query: 90  FKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDE 133
           FK+P + D+E VK  LENGVL I + KL+ EK + P+V++I  E
Sbjct: 137 FKLPDNVDMESVKAKLENGVLTINLTKLSPEKVKGPRVVNIAAE 180

Arabidopsis thaliana (taxid: 3702)
>sp|P19244|HSP41_PEA 22.7 kDa class IV heat shock protein OS=Pisum sativum GN=HSP22.7 PE=2 SV=1 Back     alignment and function description
>sp|P30236|HSP41_SOYBN 22.0 kDa class IV heat shock protein OS=Glycine max GN=HSP22.0 PE=3 SV=1 Back     alignment and function description
>sp|Q53M11|HS219_ORYSJ 21.9 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP21.9 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUW5|HS232_ORYSJ 23.2 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP23.2 PE=2 SV=2 Back     alignment and function description
>sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 Back     alignment and function description
>sp|P27879|HSP11_MEDSA 18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1 Back     alignment and function description
>sp|P27880|HSP12_MEDSA 18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LNW0|HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=2 SV=1 Back     alignment and function description
>sp|P05478|HSP16_SOYBN 18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
344190172193 heat shock protein 22 [Corylus heterophy 0.94 0.730 0.535 2e-38
255560519190 heat-shock protein, putative [Ricinus co 0.946 0.747 0.514 7e-38
297739445 284 unnamed protein product [Vitis vinifera] 0.926 0.489 0.470 8e-32
356550016198 PREDICTED: 22.7 kDa class IV heat shock 0.953 0.722 0.537 5e-31
315932712200 HSP22.9 [Citrullus lanatus] 0.913 0.685 0.464 1e-29
326499221205 predicted protein [Hordeum vulgare subsp 0.706 0.517 0.572 5e-29
449431898193 PREDICTED: 22.7 kDa class IV heat shock 0.813 0.632 0.563 3e-28
242067997207 hypothetical protein SORBIDRAFT_05g00703 0.96 0.695 0.412 7e-27
351720985197 low molecular weight heat shock protein 0.973 0.741 0.474 2e-26
145203150193 small heat shock protein [Cyclamen persi 0.92 0.715 0.446 1e-25
>gi|344190172|gb|AEM97868.1| heat shock protein 22 [Corylus heterophylla] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/168 (53%), Positives = 109/168 (64%), Gaps = 27/168 (16%)

Query: 1   MSYARSHFFDVMFAMTEDPFR--------------------SRLDGAPIAHVIALDILGM 40
           M Y R   +D++   +EDP R                    S     P  HVI+LD+ GM
Sbjct: 31  MPYTRPSLWDILLPYSEDPLRILEQTPLTIPRGVETLTLAPSDWKETPTEHVISLDVPGM 90

Query: 41  KKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEH 100
           KKD++KIEVEEN VLR+SGER   +   + VEGE+ HRAE T GKFWRQF++P +ADL+H
Sbjct: 91  KKDDIKIEVEENRVLRISGERVGKN---QEVEGERWHRAERTNGKFWRQFRLPGNADLDH 147

Query: 101 VKVHLENGVLRITVPKLTEEKRRQPKVISINDELAGNSFGEDIKATKA 148
           VK  LE+GVLRITVPK  EEK RQPKVI+I +E    SFGEDIKATKA
Sbjct: 148 VKARLEDGVLRITVPKFAEEK-RQPKVINIAEE---GSFGEDIKATKA 191

Source: Corylus heterophylla

Species: Corylus heterophylla

Genus: Corylus

Family: Betulaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255560519|ref|XP_002521274.1| heat-shock protein, putative [Ricinus communis] gi|223539542|gb|EEF41130.1| heat-shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297739445|emb|CBI29627.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550016|ref|XP_003543386.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Glycine max] Back     alignment and taxonomy information
>gi|315932712|gb|ADU55786.1| HSP22.9 [Citrullus lanatus] Back     alignment and taxonomy information
>gi|326499221|dbj|BAK06101.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533628|dbj|BAK05345.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|449431898|ref|XP_004133737.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis sativus] gi|449478100|ref|XP_004155223.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|242067997|ref|XP_002449275.1| hypothetical protein SORBIDRAFT_05g007030 [Sorghum bicolor] gi|241935118|gb|EES08263.1| hypothetical protein SORBIDRAFT_05g007030 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|351720985|ref|NP_001235147.1| low molecular weight heat shock protein Hsp22.3 precursor [Glycine max] gi|710434|gb|AAB03097.1| Hsp22.3 [Glycine max] Back     alignment and taxonomy information
>gi|145203150|gb|ABP35941.1| small heat shock protein [Cyclamen persicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2122774195 ATHSP22.0 "AT4G10250" [Arabido 0.72 0.553 0.552 1.8e-25
UNIPROTKB|Q53M11206 HSP21.9 "21.9 kDa heat shock p 0.813 0.592 0.437 2.9e-23
UNIPROTKB|Q7XUW5215 HSP23.2 "23.2 kDa heat shock p 0.673 0.469 0.396 4.4e-20
TAIR|locus:2024862157 AT1G53540 [Arabidopsis thalian 0.646 0.617 0.451 1.9e-19
TAIR|locus:2075256156 HSP17.4 "heat shock protein 17 0.646 0.621 0.461 1.9e-19
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.66 0.614 0.471 4e-19
TAIR|locus:2024997157 AT1G07400 [Arabidopsis thalian 0.653 0.624 0.446 2.2e-18
UNIPROTKB|P27777150 HSP16.9A "16.9 kDa class I hea 0.7 0.7 0.446 2.8e-18
UNIPROTKB|Q84Q72161 HSP18.1 "18.1 kDa class I heat 0.68 0.633 0.441 4.6e-18
UNIPROTKB|Q943E6150 HSP16.9B "16.9 kDa class I hea 0.7 0.7 0.437 4.6e-18
TAIR|locus:2122774 ATHSP22.0 "AT4G10250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 63/114 (55%), Positives = 81/114 (71%)

Query:    22 SRLDGAPIA--HVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRA 79
             +R+D    A  H I LDI G+KKDEVKIEVEEN VLRVSGERK ++  K    G++ HR 
Sbjct:    71 ARVDWKETAEGHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKK----GDQWHRV 126

Query:    80 ESTFGKFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDE 133
             E ++GKFWRQFK+P + D+E VK  LENGVL I + KL+ EK + P+V++I  E
Sbjct:   127 ERSYGKFWRQFKLPDNVDMESVKAKLENGVLTINLTKLSPEKVKGPRVVNIAAE 180
GO:0003674 "molecular_function" evidence=ND
GO:0009408 "response to heat" evidence=IEP;ISS;RCA
GO:0009507 "chloroplast" evidence=ISM
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0005783 "endoplasmic reticulum" evidence=IDA
UNIPROTKB|Q53M11 HSP21.9 "21.9 kDa heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XUW5 HSP23.2 "23.2 kDa heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2024862 AT1G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075256 HSP17.4 "heat shock protein 17.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024997 AT1G07400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P27777 HSP16.9A "16.9 kDa class I heat shock protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84Q72 HSP18.1 "18.1 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E6 HSP16.9B "16.9 kDa class I heat shock protein 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035360001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (260 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 9e-27
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 2e-23
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 2e-19
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 7e-16
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 3e-12
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 8e-10
cd0647090 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain 3e-05
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 0.001
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information 
 Score = 95.8 bits (239), Expect = 9e-27
 Identities = 45/89 (50%), Positives = 63/89 (70%), Gaps = 4/89 (4%)

Query: 28  PIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFW 87
           P AHV   D+ G+KK++VK+EVE+  VLR+SGERK +    E  +G+  HR E + G+F 
Sbjct: 8   PEAHVFKADVPGVKKEDVKVEVEDGRVLRISGERKKE----EEKKGDDWHRVERSSGRFV 63

Query: 88  RQFKMPMSADLEHVKVHLENGVLRITVPK 116
           R+F++P +AD + VK  LENGVL +TVPK
Sbjct: 64  RRFRLPENADADEVKAFLENGVLTVTVPK 92

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative stress. Also belonging to this group is wheat HSP16.9 which differs in quaternary structure from the shell-type particles of ScHsp26, it assembles as a dodecameric double disc, with each disc organized as a trimer of dimers. Length = 92
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107227 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
PRK11597142 heat shock chaperone IbpB; Provisional 99.97
PRK10743137 heat shock protein IbpA; Provisional 99.97
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.96
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.95
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.93
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.93
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.92
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.91
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.9
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.9
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.89
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.89
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.89
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.88
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.87
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.87
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.87
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.86
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.79
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.78
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.7
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.59
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.4
cd0646384 p23_like Proteins containing this p23_like domain 99.14
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 99.03
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.82
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 98.43
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.37
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 98.04
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.99
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.86
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.67
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.67
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.66
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.94
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.93
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.53
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 96.2
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 96.1
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 95.26
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 94.46
PF13349166 DUF4097: Domain of unknown function (DUF4097) 87.33
PF14913194 DPCD: DPCD protein family 84.74
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 84.74
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 81.99
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 81.85
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 81.62
KOG2265179 consensus Nuclear distribution protein NUDC [Signa 81.58
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 81.33
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 80.85
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 80.71
PRK10743137 heat shock protein IbpA; Provisional 80.53
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information 
Probab=99.97  E-value=2.6e-30  Score=186.13  Aligned_cols=116  Identities=17%  Similarity=0.239  Sum_probs=97.4

Q ss_pred             hHHHHhhccCCCCCCccc--C-CCCeEEEEEEcCCCCCCCeEEEEeeCcEEEEEEEEecCCCccccccCceEEEeeeeee
Q 046909            8 FFDVMFAMTEDPFRSRLD--G-APIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFG   84 (150)
Q Consensus         8 ~~d~~~~~~~~~~~p~~d--e-~~~~~~i~~~lPG~~~edI~V~v~~~~~L~I~g~~~~~~~~~~~~~~~~~~~~e~~~g   84 (150)
                      +|+.|.+.+...+.|++|  | ++++|+|.++|||++++||+|.+.+ +.|+|+|+++.      ..++.+|+++||.+|
T Consensus        19 l~~~~~~~~~~~~~P~vdI~e~~~~~y~v~adlPGv~kedi~V~v~~-~~LtI~ge~~~------~~~~~~~~~~Er~~g   91 (142)
T PRK11597         19 LANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLDIQLEG-TRLTVKGTPEQ------PEKEVKWLHQGLVNQ   91 (142)
T ss_pred             HHHHhcccCccCCCCcEEEEEcCCCEEEEEEEeCCCCHHHeEEEEEC-CEEEEEEEEcc------ccCCCcEEEEEEeCc
Confidence            333333333345678999  6 5789999999999999999999999 99999999765      235678999999999


Q ss_pred             EEEEEEECCCCCcccceEEEEeCCEEEEEEeccCcccCCCCeEEEeeec
Q 046909           85 KFWRQFKMPMSADLEHVKVHLENGVLRITVPKLTEEKRRQPKVISINDE  133 (150)
Q Consensus        85 ~f~r~~~LP~~vd~~~i~A~~~~GvL~I~lPK~~~~~~~~~~~I~I~~~  133 (150)
                      +|.|+|.||.+||.+  +|+|+||||+|+|||..++ ...+++|+|+..
T Consensus        92 ~F~R~f~LP~~vd~~--~A~~~nGVL~I~lPK~~~~-~~~~rkI~I~~~  137 (142)
T PRK11597         92 PFSLSFTLAENMEVS--GATFVNGLLHIDLIRNEPE-AIAPQRIAISER  137 (142)
T ss_pred             EEEEEEECCCCcccC--cCEEcCCEEEEEEeccCcc-ccCCcEEEECCc
Confidence            999999999999998  6999999999999997543 347899999876

>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>PF13349 DUF4097: Domain of unknown function (DUF4097) Back     alignment and domain information
>PF14913 DPCD: DPCD protein family Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>KOG2265 consensus Nuclear distribution protein NUDC [Signal transduction mechanisms] Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1gme_A151 Crystal Structure And Assembly Of An Eukaryotic Sma 5e-11
2byu_A101 Negative Stain Em Reconstruction Of M.Tuberculosis 6e-10
2h50_A93 Multiple Distinct Assemblies Reveal Conformational 7e-10
3gla_A100 Crystal Structure Of The Hspa From Xanthomonas Axon 1e-07
3gt6_A103 Crystal Structure Of The Hspa From Xanthomonas Axon 1e-07
>pdb|1GME|A Chain A, Crystal Structure And Assembly Of An Eukaryotic Small Heat Shock Protein Length = 151 Back     alignment and structure 
Iteration: 1

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 28/150 (18%)
Query: 5   RSHFFDVMFAMTEDPF---------------------RSRLDG--APIAHVIALDILGMK 41
           RS+ FD    +  DPF                      +R+D    P AHV   D+ G+K
Sbjct: 6   RSNVFDPFADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVK 65
Query: 42  KDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHV 101
           K+EVK+EVE+  VL VSGER  +   K     +K HR E + GKF R+F++   A +E V
Sbjct: 66  KEEVKVEVEDGNVLVVSGERTKEKEDKN----DKWHRVERSSGKFVRRFRLLEDAKVEEV 121
Query: 102 KVHLENGVLRITVPKLTEEKRRQPKVISIN 131
           K  LENGVL +TVPK  E K+ + K I I+
Sbjct: 122 KAGLENGVLTVTVPK-AEVKKPEVKAIQIS 150
>pdb|2BYU|A Chain A, Negative Stain Em Reconstruction Of M.Tuberculosis Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer Length = 101 Back     alignment and structure
>pdb|2H50|A Chain A, Multiple Distinct Assemblies Reveal Conformational Flexibility In The Small Heat Shock Protein Hsp26 Length = 93 Back     alignment and structure
>pdb|3GLA|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 100 Back     alignment and structure
>pdb|3GT6|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1gme_A151 Heat shock protein 16.9B; small heat shock protein 1e-29
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 4e-26
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 1e-22
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 1e-22
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 3e-13
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 2e-12
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 3e-12
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 1e-11
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 1e-11
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 8e-11
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score =  104 bits (262), Expect = 1e-29
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 28/150 (18%)

Query: 5   RSHFFDVMFAMTEDPFRSRLDGAPI-----------------------AHVIALDILGMK 41
           RS+ FD    +  DPF +     P                        AHV   D+ G+K
Sbjct: 6   RSNVFDPFADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVK 65

Query: 42  KDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHV 101
           K+EVK+EVE+  VL VSGER  +    +  + +K HR E + GKF R+F++   A +E V
Sbjct: 66  KEEVKVEVEDGNVLVVSGERTKE----KEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEV 121

Query: 102 KVHLENGVLRITVPKLTEEKRRQPKVISIN 131
           K  LENGVL +TVPK  E K+ + K I I+
Sbjct: 122 KAGLENGVLTVTVPK-AEVKKPEVKAIQIS 150
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.96
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.96
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.96
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.95
4fei_A102 Heat shock protein-related protein; stress respons 99.95
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.93
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.93
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.93
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.91
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.91
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.87
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.87
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.09
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.01
3igf_A374 ALL4481 protein; two-domained protein consisting o 98.18
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.04
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.94
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.76
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.71
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.51
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.42
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.38
2o30_A131 Nuclear movement protein; MCSG, structural genomic 97.29
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.28
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 97.13
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 97.06
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.86
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 86.79
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 82.08
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 81.92
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 81.08
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=99.96  E-value=2.5e-29  Score=170.16  Aligned_cols=96  Identities=31%  Similarity=0.561  Sum_probs=89.5

Q ss_pred             CCCCccc--CCCCeEEEEEEcCCCCCCCeEEEEeeCcEEEEEEEEecCCCccccccCceEEEeeeeeeEEEEEEECCCCC
Q 046909           19 PFRSRLD--GAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSA   96 (150)
Q Consensus        19 ~~~p~~d--e~~~~~~i~~~lPG~~~edI~V~v~~~~~L~I~g~~~~~~~~~~~~~~~~~~~~e~~~g~f~r~~~LP~~v   96 (150)
                      .|.|++|  |+++.|+|.++|||++++||+|++.+ +.|+|+|++..    +...+..+|+++||.+|+|.|+|.||.+|
T Consensus         2 ~~~P~~di~e~~~~~~v~~~lPG~~~edi~v~~~~-~~L~I~g~~~~----~~~~~~~~~~~~er~~g~f~r~~~LP~~v   76 (100)
T 3gla_A            2 QWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDK-GILSIRGERKS----ESSTETERFSRIERRYGSFHRRFALPDSA   76 (100)
T ss_dssp             CSCCCEEEEECSSEEEEEEECTTSCGGGCEEEEET-TEEEEEEEECC----GGGSSGGGEEEECCCCEEEEEEEECCTTB
T ss_pred             CccCcEEEEECCCEEEEEEECCCCCHHHEEEEEEC-CEEEEEEEEcC----cCccCCccEEEEeecceEEEEEEECCCCc
Confidence            5899999  99999999999999999999999999 99999999988    55667788999999999999999999999


Q ss_pred             cccceEEEEeCCEEEEEEeccCc
Q 046909           97 DLEHVKVHLENGVLRITVPKLTE  119 (150)
Q Consensus        97 d~~~i~A~~~~GvL~I~lPK~~~  119 (150)
                      |.++|+|+|+||+|+|++||.+.
T Consensus        77 d~~~i~A~~~~GvL~I~~pK~~~   99 (100)
T 3gla_A           77 DADGITAAGRNGVLEIRIPKRPA   99 (100)
T ss_dssp             CTTSCEEEEETTEEEEEEEBC--
T ss_pred             ChHHeEEEEeCCEEEEEEecCCC
Confidence            99999999999999999999864
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 5e-17
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 1e-13
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 71.0 bits (173), Expect = 5e-17
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 28/150 (18%)

Query: 5   RSHFFDVMFAMTEDPFRSRLDGAPI-----------------------AHVIALDILGMK 41
           RS+ FD    +  DPF +     P                        AHV   D+ G+K
Sbjct: 5   RSNVFDPFADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVK 64

Query: 42  KDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADLEHV 101
           K+EVK+EVE+  VL VSGER  +   K     +K HR E + GKF R+F++   A +E V
Sbjct: 65  KEEVKVEVEDGNVLVVSGERTKEKEDKN----DKWHRVERSSGKFVRRFRLLEDAKVEEV 120

Query: 102 KVHLENGVLRITVPKLTEEKRRQPKVISIN 131
           K  LENGVL +TVPK  E K+ + K I I+
Sbjct: 121 KAGLENGVLTVTVPK-AEVKKPEVKAIQIS 149
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.96
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.94
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.3
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 97.09
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.89
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.27
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 96.2
d1vqoe179 Ribosomal protein L6 {Archaeon Haloarcula marismor 81.81
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 80.32
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.96  E-value=2.1e-30  Score=185.83  Aligned_cols=106  Identities=46%  Similarity=0.694  Sum_probs=93.0

Q ss_pred             CCccc--CCCCeEEEEEEcCCCCCCCeEEEEeeCcEEEEEEEEecCCCccccccCceEEEeeeeeeEEEEEEECCCCCcc
Q 046909           21 RSRLD--GAPIAHVIALDILGMKKDEVKIEVEENMVLRVSGERKSDDYYKEGVEGEKRHRAESTFGKFWRQFKMPMSADL   98 (150)
Q Consensus        21 ~p~~d--e~~~~~~i~~~lPG~~~edI~V~v~~~~~L~I~g~~~~~~~~~~~~~~~~~~~~e~~~g~f~r~~~LP~~vd~   98 (150)
                      .|++|  |++++|+|+++|||++++||+|++++++.|+|+|++..    +...++..|+.+|+.+|.|.|+|.||.+||.
T Consensus        42 ~p~~dv~e~~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~----~~~~~~~~~~~~e~~~~~f~r~~~LP~~vd~  117 (150)
T d1gmea_          42 NARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTK----EKEDKNDKWHRVERSSGKFVRRFRLLEDAKV  117 (150)
T ss_dssp             GGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCC----CCCCTTCEEEECCCCCCCEEEEEECSSCCCG
T ss_pred             CCceeEEECCCEEEEEEEeCCCccCCEEEEEEEccceeEEEEEec----ccccccceeeeeeeccceEEEEEECCCCeee
Confidence            46888  99999999999999999999999987468999999877    5566788999999999999999999999999


Q ss_pred             cceEEEEeCCEEEEEEeccCcccCCCCeEEEee
Q 046909           99 EHVKVHLENGVLRITVPKLTEEKRRQPKVISIN  131 (150)
Q Consensus        99 ~~i~A~~~~GvL~I~lPK~~~~~~~~~~~I~I~  131 (150)
                      ++|+|+|+||+|+|+|||.... .++.++|+|+
T Consensus       118 ~~i~A~~~nGvL~I~lpK~~~~-~~~~~~I~I~  149 (150)
T d1gmea_         118 EEVKAGLENGVLTVTVPKAEVK-KPEVKAIQIS  149 (150)
T ss_dssp             GGCEEEEETTEEEEEEECCCCC-TTCCCCCCCC
T ss_pred             ceeEEEEECCEEEEEEEcCCcC-CCCceEEecc
Confidence            9999999999999999998876 2344455543
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure