Citrus Sinensis ID: 046946
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 650 | ||||||
| 359386146 | 569 | poly C-binding protein [Citrus sinensis] | 0.875 | 1.0 | 1.0 | 0.0 | |
| 147790774 | 668 | hypothetical protein VITISV_027256 [Viti | 0.684 | 0.666 | 0.727 | 1e-171 | |
| 359488265 | 676 | PREDICTED: KH domain-containing protein | 0.663 | 0.637 | 0.748 | 1e-171 | |
| 255551350 | 537 | Poly(rC)-binding protein, putative [Rici | 0.661 | 0.800 | 0.758 | 1e-171 | |
| 224127654 | 563 | predicted protein [Populus trichocarpa] | 0.692 | 0.799 | 0.691 | 1e-164 | |
| 125532489 | 769 | hypothetical protein OsI_34164 [Oryza sa | 0.626 | 0.529 | 0.449 | 3e-92 | |
| 115482708 | 762 | Os10g0495000 [Oryza sativa Japonica Grou | 0.610 | 0.520 | 0.457 | 9e-92 | |
| 110289326 | 677 | KH domain containing protein, expressed | 0.610 | 0.586 | 0.457 | 1e-91 | |
| 357146815 | 777 | PREDICTED: KH domain-containing protein | 0.590 | 0.494 | 0.467 | 1e-89 | |
| 242039239 | 542 | hypothetical protein SORBIDRAFT_01g01830 | 0.587 | 0.704 | 0.464 | 6e-89 |
| >gi|359386146|gb|AEV43362.1| poly C-binding protein [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 1181 bits (3055), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 569/569 (100%), Positives = 569/569 (100%)
Query: 82 MDASKRNFFKKRPNNQFKRKGVVGIKKGNWSNSSREQSFGNSQPADTVYRILCPSRKIGG 141
MDASKRNFFKKRPNNQFKRKGVVGIKKGNWSNSSREQSFGNSQPADTVYRILCPSRKIGG
Sbjct: 1 MDASKRNFFKKRPNNQFKRKGVVGIKKGNWSNSSREQSFGNSQPADTVYRILCPSRKIGG 60
Query: 142 VIGKAGNIVKSLREETQAKITVADTIPGSEERVIIIYSSPTKIAKTQNKDDDSAAETKKE 201
VIGKAGNIVKSLREETQAKITVADTIPGSEERVIIIYSSPTKIAKTQNKDDDSAAETKKE
Sbjct: 61 VIGKAGNIVKSLREETQAKITVADTIPGSEERVIIIYSSPTKIAKTQNKDDDSAAETKKE 120
Query: 202 SMEPHCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLVPNNMVGCLLGKRGDV 261
SMEPHCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLVPNNMVGCLLGKRGDV
Sbjct: 121 SMEPHCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLVPNNMVGCLLGKRGDV 180
Query: 262 IQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNVAKRALYEVSTLLHQNPRKDKP 321
IQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNVAKRALYEVSTLLHQNPRKDKP
Sbjct: 181 IQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNVAKRALYEVSTLLHQNPRKDKP 240
Query: 322 PSSFPQAYGGQNFHSPPAPMADMHPLGNSSWPARNSSLHGMPSTPWMGGYGDQPSRMGSG 381
PSSFPQAYGGQNFHSPPAPMADMHPLGNSSWPARNSSLHGMPSTPWMGGYGDQPSRMGSG
Sbjct: 241 PSSFPQAYGGQNFHSPPAPMADMHPLGNSSWPARNSSLHGMPSTPWMGGYGDQPSRMGSG 300
Query: 382 SINSCPPGQMGEVSAEFSMKILCSAGKIGGVIGKGGFNVKQLQQETGASIHVEDAPTDSD 441
SINSCPPGQMGEVSAEFSMKILCSAGKIGGVIGKGGFNVKQLQQETGASIHVEDAPTDSD
Sbjct: 301 SINSCPPGQMGEVSAEFSMKILCSAGKIGGVIGKGGFNVKQLQQETGASIHVEDAPTDSD 360
Query: 442 ERVIRASAFEGLWNPRSQTIDAILQLQNKTSEFSEKGTITTRLLVPSSKVGCILGQGGHV 501
ERVIRASAFEGLWNPRSQTIDAILQLQNKTSEFSEKGTITTRLLVPSSKVGCILGQGGHV
Sbjct: 361 ERVIRASAFEGLWNPRSQTIDAILQLQNKTSEFSEKGTITTRLLVPSSKVGCILGQGGHV 420
Query: 502 INEMRRRTQADIRVVGARVKLQDPHPGSSECIVDIRGSSEHLISAHGTYQSFMTSGQSMK 561
INEMRRRTQADIRVVGARVKLQDPHPGSSECIVDIRGSSEHLISAHGTYQSFMTSGQSMK
Sbjct: 421 INEMRRRTQADIRVVGARVKLQDPHPGSSECIVDIRGSSEHLISAHGTYQSFMTSGQSMK 480
Query: 562 VQPSSYQNINPQQSSCQTMSSHQSSYQNMNTQQSPYHRVNAQQSPYQNINPQQSSYPMHT 621
VQPSSYQNINPQQSSCQTMSSHQSSYQNMNTQQSPYHRVNAQQSPYQNINPQQSSYPMHT
Sbjct: 481 VQPSSYQNINPQQSSCQTMSSHQSSYQNMNTQQSPYHRVNAQQSPYQNINPQQSSYPMHT 540
Query: 622 HQGAGTNPHITPTQSSYYSSSAQQGTYPY 650
HQGAGTNPHITPTQSSYYSSSAQQGTYPY
Sbjct: 541 HQGAGTNPHITPTQSSYYSSSAQQGTYPY 569
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147790774|emb|CAN72739.1| hypothetical protein VITISV_027256 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488265|ref|XP_003633728.1| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera] gi|296087281|emb|CBI33655.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255551350|ref|XP_002516721.1| Poly(rC)-binding protein, putative [Ricinus communis] gi|223544094|gb|EEF45619.1| Poly(rC)-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224127654|ref|XP_002329331.1| predicted protein [Populus trichocarpa] gi|222870785|gb|EEF07916.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|125532489|gb|EAY79054.1| hypothetical protein OsI_34164 [Oryza sativa Indica Group] gi|125575260|gb|EAZ16544.1| hypothetical protein OsJ_32017 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115482708|ref|NP_001064947.1| Os10g0495000 [Oryza sativa Japonica Group] gi|22128716|gb|AAM92828.1| putative RNA-binding protein [Oryza sativa Japonica Group] gi|110289325|gb|ABB47821.2| KH domain containing protein, expressed [Oryza sativa Japonica Group] gi|113639556|dbj|BAF26861.1| Os10g0495000 [Oryza sativa Japonica Group] gi|215694845|dbj|BAG90036.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|110289326|gb|AAP54423.2| KH domain containing protein, expressed [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|357146815|ref|XP_003574121.1| PREDICTED: KH domain-containing protein At4g18375-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242039239|ref|XP_002467014.1| hypothetical protein SORBIDRAFT_01g018300 [Sorghum bicolor] gi|241920868|gb|EER94012.1| hypothetical protein SORBIDRAFT_01g018300 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 650 | ||||||
| TAIR|locus:2150956 | 548 | AT5G15270 "AT5G15270" [Arabido | 0.321 | 0.381 | 0.398 | 2.8e-67 | |
| TAIR|locus:2035807 | 479 | AT1G14170 "AT1G14170" [Arabido | 0.34 | 0.461 | 0.406 | 4.2e-59 | |
| TAIR|locus:2161413 | 644 | AT5G46190 "AT5G46190" [Arabido | 0.690 | 0.697 | 0.306 | 6.5e-51 | |
| TAIR|locus:2831364 | 606 | AT4G18375 "AT4G18375" [Arabido | 0.62 | 0.665 | 0.331 | 2.3e-50 | |
| TAIR|locus:2168367 | 652 | RCF3 "AT5G53060" [Arabidopsis | 0.678 | 0.676 | 0.32 | 2.4e-44 | |
| TAIR|locus:2017612 | 621 | AT1G51580 "AT1G51580" [Arabido | 0.573 | 0.600 | 0.291 | 1.2e-29 | |
| TAIR|locus:2066020 | 632 | AT2G22600 "AT2G22600" [Arabido | 0.344 | 0.354 | 0.318 | 2.7e-23 | |
| TAIR|locus:2084908 | 577 | FLK "AT3G04610" [Arabidopsis t | 0.253 | 0.285 | 0.322 | 1.1e-22 | |
| TAIR|locus:2056951 | 153 | AT2G03110 "AT2G03110" [Arabido | 0.221 | 0.941 | 0.388 | 9.2e-22 | |
| ZFIN|ZDB-GENE-050522-157 | 350 | pcbp3 "poly(rC) binding protei | 0.276 | 0.514 | 0.272 | 5.1e-20 |
| TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 434 (157.8 bits), Expect = 2.8e-67, Sum P(3) = 2.8e-67
Identities = 90/226 (39%), Positives = 142/226 (62%)
Query: 127 DTVYRILCPSRKIGGVIGKAGNIVKSLREETQAKITVADTIPGSEERVIIIYSSPTKIAK 186
DTV+R LCP +KIG VIG+ G+IVK LR +T++KI + + IPG +ERVI IYS P+
Sbjct: 49 DTVFRYLCPVKKIGSVIGRGGDIVKQLRNDTRSKIRIGEAIPGCDERVITIYS-PS---- 103
Query: 187 TQNKDDDSAAETKKESMEPHCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLV 246
D+ +A ++ + P AQDAL ++HDR++ +D + D +TA+LLV
Sbjct: 104 ----DETNAFGDGEKVLSP---AQDALFRIHDRVVADD---ARSEDSPEGEKQVTAKLLV 153
Query: 247 PNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNVAKRALY 306
P++ +GC+LG+ G ++Q +RSETGA IR++ +P CA+N+DE++QISG+ + K+AL
Sbjct: 154 PSDQIGCILGRGGQIVQNIRSETGAQIRIVKDRNMPLCALNSDELIQISGEVLIVKKALL 213
Query: 307 EVSTLLHQNPRKDKPPSSFPQAY--GGQNFHSPPAPMADMHPLGNS 350
++++ LH+NP + + S Y G H+ + + PL S
Sbjct: 214 QIASRLHENPSRSQNLLSSSGGYPAGSLMSHAGGPRLVGLAPLMGS 259
|
|
| TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056951 AT2G03110 "AT2G03110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-157 pcbp3 "poly(rC) binding protein 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01230085 | hypothetical protein (563 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 650 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 1e-17 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 3e-16 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 2e-15 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-12 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-12 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 5e-12 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-11 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 4e-11 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 1e-10 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-10 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 4e-10 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 1e-09 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 1e-08 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-08 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 2e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 2e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-08 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 3e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 4e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 2e-06 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 7e-06 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 6e-05 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 1e-04 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 3e-04 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 0.001 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.003 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 0.003 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 0.003 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 76.7 bits (190), Expect = 1e-17
Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 4/69 (5%)
Query: 241 TARLLVPNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNV 300
T RLLVP++ G ++GK G I+ +R ETGA IRV +T+ +V ISGKP+
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSK----SVLPGSTERVVTISGKPSA 56
Query: 301 AKRALYEVS 309
++AL +
Sbjct: 57 VQKALLLIL 65
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 650 | |||
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 100.0 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 100.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 100.0 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.96 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.95 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.93 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.93 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.8 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.55 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.53 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.51 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.47 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.3 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.29 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.26 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.19 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.15 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.13 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.09 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.08 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 99.05 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.01 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 99.01 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.0 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.97 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 98.93 | |
| PF13014 | 43 | KH_3: KH domain | 98.87 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.78 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.76 | |
| PF13014 | 43 | KH_3: KH domain | 98.75 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.66 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.6 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.41 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.19 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.15 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.96 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 97.93 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.7 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.62 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.48 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.47 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.45 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.3 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.29 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.14 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.05 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.0 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.98 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 96.88 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.62 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.57 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.5 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 96.44 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.43 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 96.42 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.36 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.3 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.26 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.1 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 96.05 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.03 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 95.98 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.86 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 95.83 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 95.67 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 95.57 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 95.53 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 95.42 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.37 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 95.22 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.17 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 95.07 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 95.07 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.04 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.04 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 94.95 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.91 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 94.86 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 94.86 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 94.84 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.69 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 94.65 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 94.64 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 94.44 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 94.35 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 94.33 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 94.26 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 94.05 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 94.04 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 93.96 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.87 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 93.23 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.13 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 92.3 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 91.21 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 90.87 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 89.34 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 89.13 | |
| COG5166 | 657 | Uncharacterized conserved protein [Function unknow | 88.7 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 88.45 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 88.37 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 88.03 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 87.91 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 87.87 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 86.21 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 86.11 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 85.13 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 84.41 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 84.14 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 83.97 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 82.37 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 82.36 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 81.83 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 80.87 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 80.36 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 80.33 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 80.09 |
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.7e-46 Score=397.97 Aligned_cols=332 Identities=22% Similarity=0.369 Sum_probs=265.9
Q ss_pred CceEEEEEecCccccceeccCchHHHHHHHHhCceEEEecCCCCCCceEEEEecChhhhhhccCCccchhhhhhcccCCc
Q 046946 126 ADTVYRILCPSRKIGGVIGKAGNIVKSLREETQAKITVADTIPGSEERVIIIYSSPTKIAKTQNKDDDSAAETKKESMEP 205 (650)
Q Consensus 126 ~~~~~rilvP~~~vG~IIGKgG~~Ik~Ir~~TgakI~I~~~~~g~~eRvI~I~G~~e~v~~a~~~~~~~~~e~~~~~~~~ 205 (650)
..++.+..||.++||+||||+|+.|..|..++||+|+|.....+..+|-|.++|.+++|++++.++.+
T Consensus 52 ~~~~~~~~VPd~~VglvIGrgG~qI~~iqq~SgCrvq~~~~~s~~~~r~~~~~G~pe~v~~aK~li~e------------ 119 (600)
T KOG1676|consen 52 TVQTERYKVPDEAVGLVIGRGGSQIQAIQQKSGCRVQIAADPSGIGYRSVDLTGSPENVEVAKQLIGE------------ 119 (600)
T ss_pred cccccccCCCchhceeEeeccHHHhhhhhhhcCCccccCCCCCCcccccccccCCcccHHHHHHhhhh------------
Confidence 35778899999999999999999999999999999998876668899999999999998876554432
Q ss_pred ccHHHHHHHHHHHHHhhhhccCCCCCCCCCCCCceEEEEEEcCCccceeecCCchHHHHHHHHhCCeEEEccCCCCCCCC
Q 046946 206 HCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLVPNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRLPPCA 285 (650)
Q Consensus 206 ~~~a~~Al~~v~~~i~e~~~~~~~~~~~~~~~~~vt~~llVP~~~vg~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~p~~~ 285 (650)
|.++.. ... ..........++.+|+||.+.+|+||||+|++||.|++++||++.+..+.....
T Consensus 120 ----------vv~r~~---~~~--~~~~~q~~~~ttqeI~IPa~k~GlIIGKgGETikqlqe~sg~k~i~iqd~~~~~-- 182 (600)
T KOG1676|consen 120 ----------VVSRGR---PPG--GFPDNQGSVETTQEILIPANKCGLIIGKGGETIKQLQEQSGVKMILVQDGSIAT-- 182 (600)
T ss_pred ----------hhhccC---CCC--CccccCCccceeeeeccCccceeeEeccCccHHHHHHhhcCCceEEEecCCcCC--
Confidence 333332 011 111222245688999999999999999999999999999999999997655433
Q ss_pred CCCCceEEEecCHHHHHHHHHHHHHHHccCCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 046946 286 MNTDEMVQISGKPNVAKRALYEVSTLLHQNPRKDKPPSSFPQAYGGQNFHSPPAPMADMHPLGNSSWPARNSSLHGMPST 365 (650)
Q Consensus 286 ~~~dr~V~I~G~~~~V~~A~~~I~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~ 365 (650)
..++.+.|+|+++.|+.|+.+|.++|++..... . +.
T Consensus 183 -~~~KplritGdp~~ve~a~~lV~dil~e~~~~~-~---------g~--------------------------------- 218 (600)
T KOG1676|consen 183 -GADKPLRITGDPDKVEQAKQLVADILREEDDEV-P---------GS--------------------------------- 218 (600)
T ss_pred -CCCCceeecCCHHHHHHHHHHHHHHHHhcccCC-C---------cc---------------------------------
Confidence 478899999999999999999999998632211 0 00
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCceeEEEEEecCCccceecccCccchhchhhhcCceEEecCCC-CCCCccE
Q 046946 366 PWMGGYGDQPSRMGSGSINSCPPGQMGEVSAEFSMKILCSAGKIGGVIGKGGFNVKQLQQETGASIHVEDAP-TDSDERV 444 (650)
Q Consensus 366 p~~~~yg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~iP~~~~g~IIGkgG~~Ik~I~~~sga~I~i~~~~-~~~~eri 444 (650)
.+.+|..+ ....+++|.||...||.||||+|++||+|+.+||++|+|..++ +.+.||.
T Consensus 219 --~~~~g~~~-------------------g~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkpDd~p~speR~ 277 (600)
T KOG1676|consen 219 --GGHAGVRG-------------------GGSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKPDDDPSSPERP 277 (600)
T ss_pred --ccccCcCc-------------------cccceeEEeccccceeeEEecCchHHHHHhhccCceeEeecCCCCCCccce
Confidence 00111110 0134789999999999999999999999999999999998554 4889999
Q ss_pred EEEeccCCCcCccchHHHHHHHHhhhccccc---cCCce--EEEEEeCCCCceeEecCCCchHHHHHHhcCCeEEEeCCc
Q 046946 445 IRASAFEGLWNPRSQTIDAILQLQNKTSEFS---EKGTI--TTRLLVPSSKVGCILGQGGHVINEMRRRTQADIRVVGAR 519 (650)
Q Consensus 445 i~I~G~~~~~~~~~~~~~ai~~~~~~i~~~~---~~~~~--~~~l~VP~~~vG~IIGkgG~~IkeI~~~TGA~I~i~~~~ 519 (650)
+.|.|+.+.+..+..++.+|+.-.+...... ..... ...+.||+++||+||||||++||.|..+|||+|++++.
T Consensus 278 ~~IiG~~d~ie~Aa~lI~eii~~~~~~~~~~~~~G~P~~~~~fy~~VPa~KcGLvIGrGGEtIK~in~qSGA~~el~r~- 356 (600)
T KOG1676|consen 278 AQIIGTVDQIEHAAELINEIIAEAEAGAGGGMGGGAPGLVAQFYMKVPADKCGLVIGRGGETIKQINQQSGARCELSRQ- 356 (600)
T ss_pred eeeecCHHHHHHHHHHHHHHHHHHhccCCCCcCCCCccceeeEEEeccccccccccCCCccchhhhcccCCccccccCC-
Confidence 9999999888877777777766554432111 11122 78999999999999999999999999999999999963
Q ss_pred cccCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHHhc
Q 046946 520 VKLQDPHPGSSECIVDIRGSSEHLISAHGTYQSFMTS 556 (650)
Q Consensus 520 ~~l~~p~~~~~er~V~I~G~~e~V~~A~~lI~~~i~~ 556 (650)
.|..+..+++|+|+|++.+|+.|++||+++|..
T Consensus 357 ----~p~~~~~ektf~IrG~~~QIdhAk~LIr~kvg~ 389 (600)
T KOG1676|consen 357 ----PPNGNPKEKTFVIRGDKRQIDHAKQLIRDKVGD 389 (600)
T ss_pred ----CCCCCccceEEEEecCcccchHHHHHHHHHhcc
Confidence 256788999999999999999999999999964
|
|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >COG5166 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 650 | ||||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 2e-09 | ||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 3e-06 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 2e-06 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 3e-05 | ||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 3e-06 | ||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 3e-05 | ||
| 2p2r_A | 76 | Crystal Structure Of The Third Kh Domain Of Human P | 5e-04 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 9e-04 |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
|
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 650 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 5e-43 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 4e-29 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 3e-12 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-10 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 6e-10 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 6e-41 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 6e-31 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 5e-12 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 5e-11 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-09 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 4e-39 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 1e-26 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 5e-23 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-13 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 8e-11 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-37 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 9e-30 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-09 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 5e-36 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 9e-27 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 5e-13 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-12 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-09 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 5e-18 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-15 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-13 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-11 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 3e-15 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 6e-15 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 7e-13 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 3e-12 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-14 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 7e-14 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 3e-13 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 8e-12 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 5e-14 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-13 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-11 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-09 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 5e-14 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 2e-12 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 3e-11 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-08 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 3e-13 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 9e-12 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 8e-10 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 2e-09 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 7e-13 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-12 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-12 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-09 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 8e-13 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 9e-11 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 2e-10 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-08 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-12 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 3e-12 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 3e-10 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 3e-09 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-12 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-08 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 7e-08 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-07 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-11 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-10 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 8e-10 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-09 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-11 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 9e-11 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 2e-10 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 7e-09 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 6e-11 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 3e-08 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 1e-04 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 9e-11 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 1e-09 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-09 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-07 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-09 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-08 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 9e-08 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-07 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-09 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-04 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 3e-08 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 1e-06 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 4e-08 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 4e-08 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 3e-07 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 1e-05 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 1e-05 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-06 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-06 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-05 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 7e-05 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-06 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 1e-05 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 2e-05 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 2e-05 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 2e-05 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 2e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 2e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 3e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 9e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 2e-04 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
Score = 151 bits (384), Expect = 5e-43
Identities = 37/197 (18%), Positives = 86/197 (43%), Gaps = 25/197 (12%)
Query: 125 PADTVYRILCPSRKIGGVIGKAGNIVKSLREETQAKITVA---DTIPGSEERVIIIYSSP 181
+ ++L PS G +IGK G + L++ET A I ++ D PG+ ERV +I +
Sbjct: 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTI 62
Query: 182 TKIAKTQNKDDDSAAETKKESMEPHCAAQDALLKVHDRIIEEDLFGGMASDD-DNENSTI 240
+ + + ++ + + + + N +
Sbjct: 63 EALNAVHG------------------FIAEKIREMPQNVAKTEPVSILQPQTTVNPDRAN 104
Query: 241 TARLLVPNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRLPPCAMNTDEMVQISGKPNV 300
+++VPN+ G ++GK G ++ + ++GA +++ + P + +V +SG+P
Sbjct: 105 QVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQL---SQKPDGINLQNRVVTVSGEPEQ 161
Query: 301 AKRALYEVSTLLHQNPR 317
++A+ + + ++P+
Sbjct: 162 NRKAVELIIQKIQEDPQ 178
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 650 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.92 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.92 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.91 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.91 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.9 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.89 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.88 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.88 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.88 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.87 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.87 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.8 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.73 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.68 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.59 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.53 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.47 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.46 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.46 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.45 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.44 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.44 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.43 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.4 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.39 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.39 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.38 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.38 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.37 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.36 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.36 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.35 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.34 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.34 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.34 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.33 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.32 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.31 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.3 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.28 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.28 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.27 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.26 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.25 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.25 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.24 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.23 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.22 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.21 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.2 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.14 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.14 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.14 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.11 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.11 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.08 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.07 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 98.99 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.97 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.91 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.66 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.56 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.37 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.37 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.37 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.32 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.98 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.95 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.68 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.6 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.56 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.43 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.17 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.03 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 96.99 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 96.75 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.24 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 96.13 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 94.87 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 94.69 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 94.1 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 93.99 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 92.65 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 92.64 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 91.83 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 90.96 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
Probab=99.92 E-value=3.9e-25 Score=214.15 Aligned_cols=172 Identities=22% Similarity=0.415 Sum_probs=127.6
Q ss_pred CCceEEEEEecCccccceeccCchHHHHHHHHhCceEEEecC---CCCCCceEEEEecChhhhhhccCCccchhhhhhcc
Q 046946 125 PADTVYRILCPSRKIGGVIGKAGNIVKSLREETQAKITVADT---IPGSEERVIIIYSSPTKIAKTQNKDDDSAAETKKE 201 (650)
Q Consensus 125 ~~~~~~rilvP~~~vG~IIGKgG~~Ik~Ir~~TgakI~I~~~---~~g~~eRvI~I~G~~e~v~~a~~~~~~~~~e~~~~ 201 (650)
+++++++|+||.+++|.||||+|++|++|+++|||+|+|.+. .+++++|+|+|+|.++++.+|.+++.++..+....
T Consensus 3 ~~~~~~~i~vp~~~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~~~I~~~~~~~~~~ 82 (178)
T 2anr_A 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQN 82 (178)
T ss_dssp CCCEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHHHHHHHHHTCCCCC
T ss_pred CCCEEEEEEEChhHeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHHHHHHHHHhccCCc
Confidence 347999999999999999999999999999999999999853 47899999999999888766544333222111000
Q ss_pred cCCcccHHHHHHHHHHHHHhhhhccCCCCCCCCCCCCceEEEEEEcCCccceeecCCchHHHHHHHHhCCeEEEccCCCC
Q 046946 202 SMEPHCAAQDALLKVHDRIIEEDLFGGMASDDDNENSTITARLLVPNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRL 281 (650)
Q Consensus 202 ~~~~~~~a~~Al~~v~~~i~e~~~~~~~~~~~~~~~~~vt~~llVP~~~vg~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~ 281 (650)
.+......+ . .. ......+...+++|+||.+++|+||||+|++||+|+++|||+|+|.+.+.
T Consensus 83 ------~~~~~~~~~----~-----~~--~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~~~- 144 (178)
T 2anr_A 83 ------VAKTEPVSI----L-----QP--QTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPD- 144 (178)
T ss_dssp ----------------------------------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCCC--
T ss_pred ------cccCCcccc----c-----CC--ccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCCCC-
Confidence 000000000 0 00 00112234578999999999999999999999999999999999986432
Q ss_pred CCCCCCCCceEEEecCHHHHHHHHHHHHHHHccCC
Q 046946 282 PPCAMNTDEMVQISGKPNVAKRALYEVSTLLHQNP 316 (650)
Q Consensus 282 p~~~~~~dr~V~I~G~~~~V~~A~~~I~~~l~~~~ 316 (650)
+....++.|+|+|++++|++|+.+|.+++.++|
T Consensus 145 --~~~~~~~~v~I~G~~~~v~~A~~~I~~~i~e~p 177 (178)
T 2anr_A 145 --GINLQNRVVTVSGEPEQNRKAVELIIQKIQEDP 177 (178)
T ss_dssp -----CCEEEEEEESSHHHHHHHHHHHHHHHHSCC
T ss_pred --CCCCCceEEEEEcCHHHHHHHHHHHHHHHHhCC
Confidence 334678999999999999999999999999865
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 650 | ||||
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 5e-16 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 2e-12 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 2e-11 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-09 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-14 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-12 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-11 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 6e-10 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 9e-14 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 3e-09 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 7e-09 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 1e-06 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 3e-13 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 3e-11 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 2e-10 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 1e-07 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-12 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-10 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 7e-10 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 3e-09 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 3e-12 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 1e-11 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 5e-11 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 1e-08 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 5e-12 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 8e-10 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 4e-09 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 3e-06 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 5e-12 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-10 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 2e-10 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-07 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 7e-11 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-09 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 9e-09 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-08 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 1e-10 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 4e-10 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 8e-10 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-08 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 5e-10 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 6e-09 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-08 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 7e-08 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 8e-10 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 2e-08 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 6e-08 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 8e-08 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 4e-08 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 3e-06 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 3e-06 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 3e-06 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 5e-08 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 7e-08 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 1e-04 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 2e-04 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-07 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-07 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 6e-05 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-04 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 5e-07 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 6e-06 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 3e-05 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 0.002 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 4e-06 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 3e-05 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 7e-05 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 2e-04 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 4e-06 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 3e-05 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-04 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 6e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 4e-06 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 2e-05 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 0.004 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 4e-05 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 9e-05 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 6e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 7e-05 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 0.001 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 1e-04 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 7e-04 |
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.0 bits (174), Expect = 5e-16
Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 7/78 (8%)
Query: 237 NSTITARLLVPNNMVGCLLGKRGDVIQRLRSETGANIRVLPADRLPPCAMNTDEMVQISG 296
N T+T RLL+ VG ++GK+G+ ++++R E+GA I + + + ++ ++G
Sbjct: 1 NVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGN-------CPERIITLAG 53
Query: 297 KPNVAKRALYEVSTLLHQ 314
N +A + L +
Sbjct: 54 PTNAIFKAFAMIIDKLEE 71
|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 650 | |||
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.54 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.52 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.51 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.49 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.48 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.46 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.45 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.43 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.42 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.41 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.41 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.41 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.41 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.37 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.36 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.33 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.13 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.12 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.1 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.01 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.99 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.74 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.7 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.61 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.59 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.56 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.48 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.47 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.42 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.36 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.3 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.0 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 97.82 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.41 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.29 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 94.19 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.13 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 93.83 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 93.55 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 82.39 |
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.54 E-value=2.7e-15 Score=120.64 Aligned_cols=70 Identities=23% Similarity=0.449 Sum_probs=63.4
Q ss_pred EEEEEeCCCCceeEecCCCchHHHHHHhcCCeEEEeCCccccCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHH
Q 046946 481 TTRLLVPSSKVGCILGQGGHVINEMRRRTQADIRVVGARVKLQDPHPGSSECIVDIRGSSEHLISAHGTYQSFM 554 (650)
Q Consensus 481 ~~~l~VP~~~vG~IIGkgG~~IkeI~~~TGA~I~i~~~~~~l~~p~~~~~er~V~I~G~~e~V~~A~~lI~~~i 554 (650)
+.+|.||++++|+||||+|++||+|++.|||+|+|++.. ++..+..+|.|+|+|++++|+.|+++|.++|
T Consensus 2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga~I~i~~~~----~~~~~~~~r~v~I~G~~~~v~~A~~~I~e~i 71 (71)
T d1j4wa2 2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNP----PPNADPNMKLFTIRGTPQQIDYARQLIEEKI 71 (71)
T ss_dssp EEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEEEECCC----TTTSCTTEEEEEEECCHHHHHHHHHHHHHHC
T ss_pred EEEEEEChHhcceEECCCCcChHHHHhhcCcEEEEeecC----CCCCCCCeEEEEEEeCHHHHHHHHHHHHhhC
Confidence 468999999999999999999999999999999998653 3456678999999999999999999999875
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|